Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q5R7Q6
(Oxidoreductase-like domain-containing protein 1) with a FATCAT P-Value: 2.34e-06 and RMSD of 2.07 angstrom. The sequence alignment identity is 89.9%.
Structural alignment shown in left. Query protein Q5BKU9 colored as red in alignment, homolog Q5R7Q6 colored as blue.
Query protein Q5BKU9 is also shown in right top, homolog Q5R7Q6 showed in right bottom. They are colored based on secondary structures.
Q5BKU9 MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKAS------------LPPELQPPT 88 Q5R7Q6 MLLRRVVEGGWAVAAAARGSGAHRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPSGGPSEPQYPLPPELQPPT 100 Q5BKU9 NCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGG 147 Q5R7Q6 NCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIQLHTRCGG 159
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005739 | mitochondrion |
| 2. P | GO:0042550 | photosystem I stabilization |
| 2. P | GO:0070995 | NADPH oxidation |
| 2. P | GO:0048025 | negative regulation of mRNA splicing, via spliceosome |
| 2. P | GO:0051402 | neuron apoptotic process |
| 2. P | GO:0106035 | protein maturation by [4Fe-4S] cluster transfer |
| 2. P | GO:0042644 | chloroplast nucleoid |
| 2. P | GO:0050567 | glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity |
| 2. P | GO:0014065 | phosphatidylinositol 3-kinase signaling |
| 2. P | GO:0016972 | thiol oxidase activity |
| 2. P | GO:0030150 | protein import into mitochondrial matrix |
| 2. P | GO:0019034 | viral replication complex |
| 2. P | GO:0009941 | chloroplast envelope |
| 2. P | GO:0103012 | ferredoxin-thioredoxin reductase activity |
| 2. P | GO:0005080 | protein kinase C binding |
| 2. P | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 2. P | GO:0022417 | protein maturation by protein folding |
| 2. P | GO:0034703 | cation channel complex |
| 2. P | GO:0048786 | presynaptic active zone |
| 2. P | GO:0009506 | plasmodesma |
| 2. P | GO:0015986 | ATP synthesis coupled proton transport |
| 2. P | GO:0009579 | thylakoid |
| 2. P | GO:0005758 | mitochondrial intermembrane space |
| 2. P | GO:0042446 | hormone biosynthetic process |
| 2. P | GO:1905242 | response to 3,3',5-triiodo-L-thyronine |
| 2. P | GO:1904231 | positive regulation of succinate dehydrogenase activity |
| 2. P | GO:2000510 | positive regulation of dendritic cell chemotaxis |
| 2. P | GO:0009536 | plastid |
| 2. P | GO:0019230 | proprioception |
| 2. P | GO:0008047 | enzyme activator activity |
| 2. P | GO:0010917 | negative regulation of mitochondrial membrane potential |
| 2. P | GO:0003714 | transcription corepressor activity |
| 2. P | GO:0051561 | positive regulation of mitochondrial calcium ion concentration |
| 2. P | GO:0034986 | iron chaperone activity |
| 2. P | GO:0009725 | response to hormone |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0005540 | hyaluronic acid binding |
| 2. P | GO:1904234 | positive regulation of aconitate hydratase activity |
| 2. P | GO:0051537 | 2 iron, 2 sulfur cluster binding |
| 2. P | GO:0008289 | lipid binding |
| 2. P | GO:0009749 | response to glucose |
| 2. P | GO:0015078 | proton transmembrane transporter activity |
| 2. P | GO:0009055 | electron transfer activity |
| 2. P | GO:0032544 | plastid translation |
| 2. P | GO:0018283 | iron incorporation into metallo-sulfur cluster |
| 2. P | GO:0097753 | membrane bending |
| 2. P | GO:0045454 | cell redox homeostasis |
| 2. P | GO:0044572 | [4Fe-4S] cluster assembly |
| 2. P | GO:0036444 | calcium import into the mitochondrion |
| 2. P | GO:0031669 | cellular response to nutrient levels |
| 2. P | GO:0030093 | chloroplast photosystem I |
| 2. P | GO:0045785 | positive regulation of cell adhesion |
| 2. P | GO:0030061 | mitochondrial crista |
| 2. P | GO:0009570 | chloroplast stroma |
| 2. P | GO:0016226 | iron-sulfur cluster assembly |
| 2. P | GO:0001405 | PAM complex, Tim23 associated import motor |
| 2. P | GO:0016671 | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor |
| 2. P | GO:0022834 | ligand-gated channel activity |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0016123 | xanthophyll biosynthetic process |
| 2. P | GO:0034553 | mitochondrial respiratory chain complex II assembly |
| 2. P | GO:0050687 | negative regulation of defense response to virus |
| 2. P | GO:0009344 | nitrite reductase complex [NAD(P)H] |
| 2. P | GO:0031224 | intrinsic component of membrane |
| 2. P | GO:1990221 | L-cysteine desulfurase complex |
| 2. P | GO:0009773 | photosynthetic electron transport in photosystem I |
| 2. P | GO:0009853 | photorespiration |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0042775 | mitochondrial ATP synthesis coupled electron transport |
| 2. P | GO:1990524 | INA complex |
| 2. P | GO:0010460 | positive regulation of heart rate |
| 2. P | GO:0045815 | epigenetic maintenance of chromatin in transcription-competent conformation |
| 2. P | GO:0045333 | cellular respiration |
| 2. P | GO:0018316 | peptide cross-linking via L-cystine |
| 2. P | GO:0009538 | photosystem I reaction center |
| 2. P | GO:0042646 | plastid nucleoid |
| 2. P | GO:0009507 | chloroplast |
| 2. P | GO:0010722 | regulation of ferrochelatase activity |
| 2. P | GO:0009768 | photosynthesis, light harvesting in photosystem I |
| 2. P | GO:0008203 | cholesterol metabolic process |
| 2. P | GO:0042407 | cristae formation |
| 2. P | GO:0051349 | positive regulation of lyase activity |
| 2. P | GO:0009658 | chloroplast organization |
| 2. P | GO:0080153 | negative regulation of reductive pentose-phosphate cycle |
| 2. P | GO:0150034 | distal axon |
| 2. P | GO:0022900 | electron transport chain |
| 2. P | GO:0009535 | chloroplast thylakoid membrane |
| 2. P | GO:0045777 | positive regulation of blood pressure |
| 2. P | GO:0097428 | protein maturation by iron-sulfur cluster transfer |
| 2. P | GO:0016540 | protein autoprocessing |
| 2. P | GO:0071456 | cellular response to hypoxia |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0009654 | photosystem II oxygen evolving complex |
| 2. P | GO:0019898 | extrinsic component of membrane |
| 2. P | GO:0009643 | photosynthetic acclimation |
| 2. P | GO:0006121 | mitochondrial electron transport, succinate to ubiquinone |
| 2. P | GO:0005759 | mitochondrial matrix |
| 2. P | GO:0004129 | cytochrome-c oxidase activity |
| 2. P | GO:0034704 | calcium channel complex |
| 2. P | GO:0009060 | aerobic respiration |
| 2. P | GO:0032543 | mitochondrial translation |
| 2. P | GO:0008494 | translation activator activity |
| 2. P | GO:0032307 | negative regulation of prostaglandin secretion |
| 2. P | GO:0051353 | positive regulation of oxidoreductase activity |
| 2. P | GO:0051897 | positive regulation of protein kinase B signaling |
| 2. P | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
| 2. P | GO:0010598 | NAD(P)H dehydrogenase complex (plastoquinone) |
| 2. P | GO:0009534 | chloroplast thylakoid |
| 2. P | GO:0097573 | glutathione oxidoreductase activity |
| 2. P | GO:0031305 | integral component of mitochondrial inner membrane |
| 2. P | GO:1905232 | cellular response to L-glutamate |
| 2. P | GO:0034599 | cellular response to oxidative stress |
| 2. P | GO:1900139 | negative regulation of arachidonic acid secretion |
| 2. P | GO:0043249 | erythrocyte maturation |
| 2. P | GO:0042776 | mitochondrial ATP synthesis coupled proton transport |
| 2. P | GO:0009744 | response to sucrose |
| 2. P | GO:0046931 | pore complex assembly |
| 2. P | GO:0032981 | mitochondrial respiratory chain complex I assembly |
| 2. P | GO:0009416 | response to light stimulus |
| 2. P | GO:0039536 | negative regulation of RIG-I signaling pathway |
| 2. P | GO:0009543 | chloroplast thylakoid lumen |
| 2. P | GO:0030984 | kininogen binding |
| 2. P | GO:1901165 | positive regulation of trophoblast cell migration |
| 2. P | GO:1903850 | regulation of cristae formation |
| 2. P | GO:0140467 | integrated stress response signaling |
| 2. P | GO:0010196 | nonphotochemical quenching |
| 2. P | GO:0050821 | protein stabilization |
| 2. P | GO:0048678 | response to axon injury |
| 2. P | GO:0005762 | mitochondrial large ribosomal subunit |
| 2. P | GO:0000427 | plastid-encoded plastid RNA polymerase complex |
| 2. P | GO:0001849 | complement component C1q complex binding |
| 2. P | GO:0031690 | adrenergic receptor binding |
| 2. P | GO:0015292 | uniporter activity |
| 2. P | GO:0006450 | regulation of translational fidelity |
| 2. P | GO:0080167 | response to karrikin |
| 2. P | GO:0005763 | mitochondrial small ribosomal subunit |
| 2. P | GO:0009631 | cold acclimation |
| 2. P | GO:0015035 | protein-disulfide reductase activity |
| 2. P | GO:0010637 | negative regulation of mitochondrial fusion |
| 2. P | GO:0006120 | mitochondrial electron transport, NADH to ubiquinone |
| 2. P | GO:0140468 | HRI-mediated signaling |
| 2. P | GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) |
| 2. P | GO:0015979 | photosynthesis |
| 2. P | GO:0005753 | mitochondrial proton-transporting ATP synthase complex |
| 2. P | GO:0005761 | mitochondrial ribosome |
| 2. P | GO:0043065 | positive regulation of apoptotic process |
| 2. P | GO:0097177 | mitochondrial ribosome binding |
| 2. P | GO:0009578 | etioplast stroma |
| 2. P | GO:0047134 | protein-disulfide reductase (NAD(P)) activity |
| 2. P | GO:0045471 | response to ethanol |
| 2. P | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 2. P | GO:0031638 | zymogen activation |
| 2. P | GO:0031942 | i-AAA complex |
| 2. P | GO:0045041 | protein import into mitochondrial intermembrane space |
| 2. P | GO:0030449 | regulation of complement activation |
| 2. P | GO:0042256 | mature ribosome assembly |
| 2. P | GO:0006958 | complement activation, classical pathway |
| 2. P | GO:0009515 | granal stacked thylakoid |
| 2. P | GO:0009522 | photosystem I |
| 2. P | GO:0005751 | mitochondrial respiratory chain complex IV |
| 2. P | GO:0005749 | mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) |
| 2. P | GO:0010287 | plastoglobule |
| 2. P | GO:0039534 | negative regulation of MDA-5 signaling pathway |
| 2. P | GO:0009508 | plastid chromosome |
| 2. P | GO:0061959 | response to (R)-carnitine |
| 2. P | GO:0010027 | thylakoid membrane organization |
| 2. P | GO:1990246 | uniplex complex |
| 2. P | GO:0042549 | photosystem II stabilization |
| 2. P | GO:0009780 | photosynthetic NADP+ reduction |
| 2. P | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 2. P | GO:0003677 | DNA binding |
| 2. P | GO:0009353 | mitochondrial oxoglutarate dehydrogenase complex |
| 2. P | GO:0032689 | negative regulation of interferon-gamma production |
| 2. P | GO:0006754 | ATP biosynthetic process |
| 2. P | GO:0005747 | mitochondrial respiratory chain complex I |
| 2. P | GO:0032695 | negative regulation of interleukin-12 production |
| 2. P | GO:0034982 | mitochondrial protein processing |
| 2. P | GO:0070681 | glutaminyl-tRNAGln biosynthesis via transamidation |
| 2. P | GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
| 2. P | GO:0006694 | steroid biosynthetic process |
| 2. P | GO:0097009 | energy homeostasis |
| 2. P | GO:0009523 | photosystem II |
| 2. P | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0004362 | glutathione-disulfide reductase (NADPH) activity |
| 2. P | GO:0033615 | mitochondrial proton-transporting ATP synthase complex assembly |
| 2. P | GO:0005743 | mitochondrial inner membrane |
| 2. P | GO:0031966 | mitochondrial membrane |
| 2. P | GO:0033614 | chloroplast proton-transporting ATP synthase complex assembly |
| 2. P | GO:0098982 | GABA-ergic synapse |
| 2. P | GO:0090023 | positive regulation of neutrophil chemotaxis |
| 2. P | GO:0070131 | positive regulation of mitochondrial translation |
| 2. P | GO:0071320 | cellular response to cAMP |
| 2. P | GO:0003729 | mRNA binding |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0045273 | respiratory chain complex II |
| 2. P | GO:0002024 | diet induced thermogenesis |
| 2. P | GO:0009893 | positive regulation of metabolic process |
| 2. P | GO:0019253 | reductive pentose-phosphate cycle |
| 2. P | GO:0090391 | granum assembly |
| 2. P | GO:0009767 | photosynthetic electron transport chain |
| 2. P | GO:0006662 | glycerol ether metabolic process |
| 2. P | GO:0045648 | positive regulation of erythrocyte differentiation |
| 2. P | GO:0046034 | ATP metabolic process |
| 2. P | GO:0046872 | metal ion binding |
| 2. P | GO:0016730 | oxidoreductase activity, acting on iron-sulfur proteins as donors |
| 2. P | GO:0000506 | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| 2. P | GO:0009644 | response to high light intensity |
| 2. P | GO:0051560 | mitochondrial calcium ion homeostasis |
| 2. P | GO:0006506 | GPI anchor biosynthetic process |
| 2. P | GO:0033108 | mitochondrial respiratory chain complex assembly |
| 2. P | GO:0004322 | ferroxidase activity |
| 2. P | GO:0006851 | mitochondrial calcium ion transmembrane transport |
| 2. P | GO:0014850 | response to muscle activity |
| 2. P | GO:0099080 | supramolecular complex |
| 2. P | GO:1904322 | cellular response to forskolin |
| 2. P | GO:0006123 | mitochondrial electron transport, cytochrome c to oxygen |
| 2. P | GO:0071486 | cellular response to high light intensity |
| 2. P | GO:0014070 | response to organic cyclic compound |
| 2. P | GO:0045773 | positive regulation of axon extension |
| 2. P | GO:0030956 | glutamyl-tRNA(Gln) amidotransferase complex |
| 3. B | GO:0016491 | oxidoreductase activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A7YVI8 | Oxidoreductase-like domain-containing protein 1 | 4.75e-06 | 9.27e-54 | 2.06e-59 |
| 1. PB | Q9CR10 | Oxidoreductase-like domain-containing protein 1 | 9.46e-05 | 1.46e-21 | 1.11e-46 |
| 1. PB | Q5R7Q6 | Oxidoreductase-like domain-containing protein 1 | 2.34e-06 | 1.67e-73 | 1.24e-98 |
| 1. PB | Q5BKU9 | Oxidoreductase-like domain-containing protein 1 | 0 | 1.49e-129 | 1.65e-105 |
| 2. P | P27788 | Ferredoxin-3, chloroplastic | 1.58e-01 | 3.25e-03 | NA |
| 2. P | B5DFW7 | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial | 3.93e-01 | 4.72e-02 | NA |
| 2. P | Q9ZTS2 | Ferredoxin, chloroplastic | 2.83e-01 | 2.90e-03 | NA |
| 2. P | Q6YTI3 | Thioredoxin-like 4, chloroplastic | 3.19e-02 | 1.43e-02 | NA |
| 2. P | P29684 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 9.91e-02 | 9.76e-03 | NA |
| 2. P | Q4RSW7 | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial | 2.94e-01 | 3.96e-03 | NA |
| 2. P | P00228 | Ferredoxin, chloroplastic | 1.18e-01 | 2.32e-06 | NA |
| 2. P | Q6CSA1 | Mitochondrial intermembrane space import and assembly protein 40 | 2.77e-01 | 3.36e-04 | NA |
| 2. P | P09911 | Ferredoxin-1, chloroplastic | 3.54e-01 | 2.88e-02 | NA |
| 2. P | O80439 | 30S ribosomal protein S31, chloroplastic | 2.00e-01 | 3.96e-03 | NA |
| 2. P | Q0JG75 | Photosystem II reaction center PSB28 protein, chloroplastic | 9.37e-02 | 8.81e-05 | NA |
| 2. P | O22914 | Calvin cycle protein CP12-1, chloroplastic | 1.65e-02 | 1.42e-02 | NA |
| 2. P | Q8S904 | Adrenodoxin-like protein 2, mitochondrial | 1.41e-01 | 1.43e-02 | NA |
| 2. P | A7TGK3 | Inner membrane assembly complex subunit 17 | 1.17e-01 | 5.40e-03 | NA |
| 2. P | B3LPE4 | Mitochondrial protein import protein ZIM17 | 7.16e-02 | 2.76e-05 | NA |
| 2. P | Q0D5P8 | Oxygen-evolving enhancer protein 3, chloroplastic | 5.23e-02 | 4.46e-04 | NA |
| 2. P | A3BKF2 | Protein LHCP TRANSLOCATION DEFECT | 2.01e-02 | 1.69e-04 | NA |
| 2. P | B5VQB0 | Mitochondrial protein import protein ZIM17 | 3.20e-01 | 2.76e-05 | NA |
| 2. P | Q9T070 | Cytochrome c oxidase subunit 6a, mitochondrial | 4.87e-01 | 3.18e-02 | NA |
| 2. P | B5VRJ9 | Altered inheritance of mitochondria protein 39, mitochondrial | 3.71e-01 | 1.18e-02 | NA |
| 2. P | P07179 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 | 1.34e-01 | 4.47e-03 | NA |
| 2. P | P41348 | Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic | 6.91e-02 | 1.95e-02 | NA |
| 2. P | A6QPI4 | Protein FAM162B | 1.03e-01 | 2.35e-03 | NA |
| 2. P | Q9FX83 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial | 4.36e-01 | 2.95e-04 | NA |
| 2. P | P04669 | Ferredoxin, chloroplastic | 3.66e-01 | 1.13e-02 | NA |
| 2. P | Q6FRU5 | Inner membrane assembly complex subunit 17 | 1.95e-01 | 2.55e-02 | NA |
| 2. P | Q949Q5 | Photosystem I subunit O | 1.75e-02 | 8.90e-05 | NA |
| 2. P | Q42599 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial | 3.11e-01 | 7.13e-03 | NA |
| 2. P | O74471 | Cytochrome c oxidase subunit 13, mitochondrial | 1.01e-01 | 1.80e-03 | NA |
| 2. P | Q4WKN3 | Presequence translocated-associated motor subunit pam17, mitochondrial | 1.84e-02 | 5.49e-04 | NA |
| 2. P | Q94KR8 | Translation initiation factor IF-1, chloroplastic | 1.82e-01 | 2.83e-02 | NA |
| 2. P | O93980 | Cytochrome c oxidase polypeptide 5, mitochondrial | 3.51e-01 | 1.51e-05 | NA |
| 2. P | Q10217 | Putative acyl carrier protein, mitochondrial | 7.42e-02 | 8.04e-03 | NA |
| 2. P | Q9M0V0 | Adrenodoxin-like protein 1, mitochondrial | 1.37e-01 | 4.15e-03 | NA |
| 2. P | Q09218 | Uncharacterized protein B0495.9 | 8.66e-02 | 3.24e-02 | NA |
| 2. P | Q3UMR5 | Calcium uniporter protein, mitochondrial | 2.99e-01 | 2.50e-02 | NA |
| 2. P | Q9MZE0 | Complement component 1 Q subcomponent-binding protein, mitochondrial | 2.56e-01 | 9.97e-05 | NA |
| 2. P | Q9US57 | Uncharacterized protein C1002.01 | 6.23e-02 | 4.33e-02 | NA |
| 2. P | Q6DQX6 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 5.09e-02 | 1.26e-02 | NA |
| 2. P | Q9CPU2 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 2.23e-01 | 7.62e-04 | NA |
| 2. P | Q95108 | Thioredoxin, mitochondrial | 3.54e-01 | 1.56e-08 | NA |
| 2. P | Q7X8R5 | Thioredoxin M2, chloroplastic | 1.01e-01 | 3.32e-02 | NA |
| 2. P | Q07021 | Complement component 1 Q subcomponent-binding protein, mitochondrial | 4.33e-01 | 1.01e-04 | NA |
| 2. P | Q66KZ3 | 39S ribosomal protein L51, mitochondrial | 5.22e-02 | 1.34e-02 | NA |
| 2. P | Q9P0M9 | 39S ribosomal protein L27, mitochondrial | 2.03e-01 | 1.69e-02 | NA |
| 2. P | Q7XJ02 | Probable L-ascorbate peroxidase 7, chloroplastic | 3.05e-01 | 3.15e-02 | NA |
| 2. P | Q03672 | ATP synthase subunit 9, mitochondrial | 4.62e-02 | 1.01e-02 | NA |
| 2. P | Q9DB10 | Essential MCU regulator, mitochondrial | 6.53e-02 | 1.83e-03 | NA |
| 2. P | Q9U505 | ATP synthase lipid-binding protein, mitochondrial | 1.39e-02 | 1.27e-04 | NA |
| 2. P | P43266 | Ubiquinol-cytochrome-C reductase complex subunit IX, mitochondrial | 1.24e-01 | 3.04e-02 | NA |
| 2. P | P22179 | Photosystem I reaction center subunit VI, chloroplastic | 1.67e-01 | 2.83e-02 | NA |
| 2. P | P16132 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 | 8.58e-02 | 7.47e-03 | NA |
| 2. P | P0C2B9 | 28S ribosomal protein L42, mitochondrial | 8.58e-02 | 6.04e-03 | NA |
| 2. P | Q5BJJ8 | 39S ribosomal protein L51, mitochondrial | 3.67e-02 | 2.16e-03 | NA |
| 2. P | P69250 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 | 1.77e-01 | 1.03e-02 | NA |
| 2. P | Q06056 | ATP synthase F(0) complex subunit C2, mitochondrial | 2.32e-02 | 1.03e-02 | NA |
| 2. P | F1SZ42 | Protein FERTILITY RESTORER RF2, mitochondrial | 3.00e-02 | 6.25e-04 | NA |
| 2. P | Q3MHJ5 | 39S ribosomal protein L54, mitochondrial | 1.73e-01 | 5.91e-06 | NA |
| 2. P | Q6K471 | Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic | 2.30e-01 | 1.88e-03 | NA |
| 2. P | Q08BI9 | Calcium uniporter protein, mitochondrial | 2.73e-01 | 2.50e-02 | NA |
| 2. P | P56383 | ATP synthase F(0) complex subunit C2, mitochondrial | 9.76e-02 | 4.40e-02 | NA |
| 2. P | Q93W20 | NifU-like protein 2, chloroplastic | 5.75e-02 | 2.69e-02 | NA |
| 2. P | Q5U1Z8 | Protein preY, mitochondrial | 8.16e-01 | 1.28e-02 | NA |
| 2. P | B0VYY1 | Cytochrome c oxidase subunit 5A, mitochondrial | 2.15e-02 | 3.22e-03 | NA |
| 2. P | P04715 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 | 1.13e-01 | 2.37e-02 | NA |
| 2. P | Q04472 | Mitochondrial inner membrane i-AAA protease supercomplex subunit MGR3 | 2.24e-01 | 2.71e-02 | NA |
| 2. P | P07926 | ATP synthase F(0) complex subunit C2, mitochondrial | 1.96e-02 | 2.09e-02 | NA |
| 2. P | O49856 | Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic | 1.07e-01 | 5.97e-06 | NA |
| 2. P | Q0MQD7 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 7.61e-01 | 1.81e-02 | NA |
| 2. P | P97493 | Thioredoxin, mitochondrial | 3.44e-01 | 8.61e-07 | NA |
| 2. P | P0CM68 | Mitochondrial intermembrane space import and assembly protein 40 | 1.43e-01 | 8.68e-06 | NA |
| 2. P | Q41387 | Photosystem II reaction center W protein, chloroplastic | 5.97e-02 | 1.54e-04 | NA |
| 2. P | Q1LXI5 | 39S ribosomal protein L54, mitochondrial | 3.20e-01 | 8.53e-05 | NA |
| 2. P | P0DKI0 | Succinate dehydrogenase subunit 3-1, mitochondrial | 1.47e-01 | 5.74e-05 | NA |
| 2. P | F1SZ44 | Protein FERTILITY RESTORER RF2, mitochondrial | 3.00e-02 | 1.04e-03 | NA |
| 2. P | Q9VCI5 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial | 2.25e-01 | 3.66e-02 | NA |
| 2. P | Q8LCT3 | Thioredoxin-like 2-2, chloroplastic | 5.41e-02 | 3.89e-02 | NA |
| 2. P | A2BHB7 | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial | 8.45e-02 | 1.48e-02 | NA |
| 2. P | Q06055 | ATP synthase F(0) complex subunit C2, mitochondrial | 1.62e-02 | 4.19e-03 | NA |
| 2. P | Q8LCA1 | Protein CURVATURE THYLAKOID 1B, chloroplastic | 8.34e-02 | 3.12e-02 | NA |
| 2. P | P00258 | Adrenodoxin, mitochondrial | 1.94e-01 | 1.61e-02 | NA |
| 2. P | P10647 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 | 1.42e-01 | 8.50e-03 | NA |
| 2. P | P46656 | Adrenodoxin, mitochondrial | 2.25e-01 | 1.85e-03 | NA |
| 2. P | Q9USM2 | Uncharacterized protein C16A11.15c | 1.61e-01 | 1.05e-03 | NA |
| 2. P | P0CQ49 | 54S ribosomal protein L27, mitochondrial | 6.00e-01 | 3.07e-03 | NA |
| 2. P | P10796 | Ribulose bisphosphate carboxylase small subunit 1B, chloroplastic | 1.52e-01 | 3.47e-02 | NA |
| 2. P | Q7XZZ1 | Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial | 7.44e-02 | 3.31e-05 | NA |
| 2. P | Q9VE04 | 39S ribosomal protein L55, mitochondrial | 4.18e-01 | 4.80e-02 | NA |
| 2. P | P53266 | Cytochrome oxidase assembly protein SHY1 | 3.48e-01 | 9.58e-03 | NA |
| 2. P | Q9CR84 | ATP synthase F(0) complex subunit C1, mitochondrial | 7.74e-02 | 8.83e-04 | NA |
| 2. P | Q4V7Q1 | 39S ribosomal protein L52, mitochondrial | 8.43e-02 | 2.33e-03 | NA |
| 2. P | Q9SR32 | UPF0161 protein At3g09310 | 4.26e-02 | 1.72e-05 | NA |
| 2. P | Q96KR6 | Protein FAM210B, mitochondrial | 3.85e-02 | 1.13e-05 | NA |
| 2. P | A2XK57 | Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial | 4.43e-01 | 3.31e-05 | NA |
| 2. P | C8ZHR0 | Altered inheritance of mitochondria protein 39, mitochondrial | 2.71e-01 | 8.74e-03 | NA |
| 2. P | P36886 | Photosystem I reaction center subunit psaK, chloroplastic | 6.01e-02 | 4.89e-02 | NA |
| 2. P | P87059 | Mitochondrial intermembrane space import and assembly protein 40 | 9.07e-02 | 5.86e-05 | NA |
| 2. P | Q290M9 | Essential MCU regulator, mitochondrial | 2.62e-01 | 2.87e-03 | NA |
| 2. P | Q0MQJ5 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 4.85e-02 | 6.63e-04 | NA |
| 2. P | B0VYX9 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.45e-02 | 8.91e-04 | NA |
| 2. P | Q9H4I9 | Essential MCU regulator, mitochondrial | 7.05e-02 | 8.62e-05 | NA |
| 2. P | P10797 | Ribulose bisphosphate carboxylase small subunit 2B, chloroplastic | 1.76e-01 | 7.54e-03 | NA |
| 2. P | Q8VY88 | Protein LHCP TRANSLOCATION DEFECT | 2.82e-01 | 6.21e-03 | NA |
| 2. P | C5WR30 | Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial | 1.02e-01 | 1.78e-05 | NA |
| 2. P | B9RRX2 | Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial | 7.81e-02 | 1.42e-02 | NA |
| 2. P | P16972 | Ferredoxin-2, chloroplastic | 1.45e-01 | 2.45e-06 | NA |
| 2. P | Q96A26 | Protein FAM162A | 1.50e-01 | 2.00e-02 | NA |
| 2. P | O04683 | Ferredoxin-1, chloroplastic | 3.34e-01 | 1.25e-02 | NA |
| 2. P | P0C5N3 | Uncharacterized protein YGL041W-A, mitochondrial | 3.64e-02 | 1.86e-05 | NA |
| 2. P | O65037 | 50S ribosomal protein L27, chloroplastic | 3.07e-01 | 1.48e-02 | NA |
| 2. P | P69249 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.19e-01 | 1.03e-02 | NA |
| 2. P | Q5R4S3 | 39S ribosomal protein L42, mitochondrial | 2.08e-01 | 3.76e-05 | NA |
| 2. P | P31333 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 3.25e-01 | 2.88e-02 | NA |
| 2. P | Q6BSK8 | Mitochondrial intermembrane space import and assembly protein 40 | 1.96e-01 | 2.46e-04 | NA |
| 2. P | Q3SZN3 | Metalloendopeptidase OMA1, mitochondrial | 3.14e-01 | 1.12e-02 | NA |
| 2. P | Q5R504 | Protein FAM162A | 4.75e-01 | 3.73e-02 | NA |
| 2. P | Q02374 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 2.41e-01 | 1.43e-04 | NA |
| 2. P | Q9SRX6 | Late embryogenis abundant protein 2 | 1.26e-01 | 2.02e-02 | NA |
| 2. P | Q9LZP9 | Calvin cycle protein CP12-2, chloroplastic | 1.22e-01 | 1.68e-03 | NA |
| 2. P | Q9XF14 | Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic | 1.59e-01 | 3.41e-02 | NA |
| 2. P | Q38853 | Rhodanese-like domain-containing protein 15, chloroplastic | 5.42e-02 | 5.84e-06 | NA |
| 2. P | P00842 | ATP synthase subunit 9, mitochondrial | 3.59e-02 | 1.18e-02 | NA |
| 2. P | Q41351 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.31e-01 | 7.61e-03 | NA |
| 2. P | Q9LLC6 | Cytochrome b6-f complex subunit petO, chloroplastic | 5.72e-02 | 2.46e-02 | NA |
| 2. P | Q6RUT7 | Protein CCSMST1 | 2.02e-01 | 3.01e-02 | NA |
| 2. P | Q0MQJ2 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | 2.69e-01 | 2.71e-03 | NA |
| 2. P | Q94KR9 | Translation initiation factor IF-1, chloroplastic | 5.83e-01 | 2.39e-02 | NA |
| 2. P | Q9Y3D5 | 28S ribosomal protein S18c, mitochondrial | 1.03e-01 | 3.67e-03 | NA |
| 2. P | Q09774 | ATP synthase subunit g, mitochondrial | 2.42e-01 | 1.17e-02 | NA |
| 2. P | B0VYY4 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.41e-01 | 4.31e-03 | NA |
| 2. P | P46485 | Glycine cleavage system H protein, mitochondrial | 2.11e-01 | 3.10e-02 | NA |
| 2. P | Q9XFT3 | Oxygen-evolving enhancer protein 3-1, chloroplastic | 1.26e-02 | 9.85e-03 | NA |
| 2. P | P32876 | ATP synthase F(0) complex subunit C1, mitochondrial | 7.85e-02 | 8.57e-04 | NA |
| 2. P | Q8GWS0 | Glutaredoxin-C5, chloroplastic | 1.13e-01 | 2.38e-05 | NA |
| 2. P | Q17424 | Probable thioredoxin-2 | 8.06e-02 | 9.15e-03 | NA |
| 2. P | Q9UTF6 | Cytochrome c oxidase subunit 6, mitochondrial | 7.12e-03 | 1.60e-03 | NA |
| 2. P | Q3ZC75 | ATP synthase F(0) complex subunit C3, mitochondrial | 1.67e-02 | 1.24e-03 | NA |
| 2. P | B0VYX2 | Cytochrome c oxidase subunit 5A, mitochondrial | NA | 2.78e-04 | NA |
| 2. P | B0VYX5 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.62e-02 | 7.47e-04 | NA |
| 2. P | P0DKI1 | Succinate dehydrogenase subunit 3-2, mitochondrial | 8.18e-02 | 5.74e-05 | NA |
| 2. P | Q84Y95 | Monothiol glutaredoxin-S14, chloroplastic | 2.57e-02 | 1.37e-02 | NA |
| 2. P | Q17ED3 | Essential MCU regulator, mitochondrial | 6.24e-02 | 4.35e-03 | NA |
| 2. P | Q0MQJ3 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 7.93e-02 | 1.18e-03 | NA |
| 2. P | Q53CF8 | Cytochrome c oxidase subunit 5A, mitochondrial | 2.15e-02 | 1.24e-03 | NA |
| 2. P | O94629 | Stress-responsive protein 1 | 1.32e-01 | 1.45e-05 | NA |
| 2. P | Q5RAP9 | ATP synthase F(0) complex subunit C2, mitochondrial | 1.88e-02 | 1.81e-02 | NA |
| 2. P | Q8HXG5 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 7.97e-02 | 5.87e-03 | NA |
| 2. P | P00221 | Ferredoxin-1, chloroplastic | 4.39e-01 | 1.25e-03 | NA |
| 2. P | Q9D113 | DNL-type zinc finger protein | 2.32e-01 | 8.91e-04 | NA |
| 2. P | G4NFB7 | Thioredoxin-2 | 5.22e-02 | 1.02e-03 | NA |
| 2. P | P04714 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 | 1.39e-01 | 3.28e-03 | NA |
| 2. P | P0CAN9 | Uncharacterized protein PB1A10.16, mitochondrial | 1.05e-01 | 3.38e-02 | NA |
| 2. P | P16032 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 | 1.84e-01 | 2.09e-03 | NA |
| 2. P | Q9SJU8 | 30S ribosomal protein S31, mitochondrial | 6.44e-01 | 6.62e-03 | NA |
| 2. P | Q5S3G4 | Cytochrome c oxidase subunit 5B, mitochondrial | 2.35e-01 | 2.57e-02 | NA |
| 2. P | O35796 | Complement component 1 Q subcomponent-binding protein, mitochondrial | 2.58e-01 | 4.23e-05 | NA |
| 2. P | Q9CQH3 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 3.23e-01 | 2.35e-03 | NA |
| 2. P | F1SZ41 | Protein FERTILITY RESTORER RF2, mitochondrial | 2.87e-02 | 6.25e-04 | NA |
| 2. P | Q851Y7 | Monothiol glutaredoxin-S7, chloroplastic | 5.27e-02 | 5.49e-04 | NA |
| 2. P | O04166 | Ferredoxin, chloroplastic | 4.05e-01 | 1.40e-03 | NA |
| 2. P | Q9D0B5 | Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 | 6.79e-02 | 3.50e-02 | NA |
| 2. P | Q08223 | Altered inheritance of mitochondria protein 39, mitochondrial | 4.68e-01 | 1.06e-02 | NA |
| 2. P | P56384 | ATP synthase F(0) complex subunit C3, mitochondrial | 2.02e-01 | 2.79e-05 | NA |
| 2. P | B8NHF2 | Required for respiratory growth protein 9, mitochondrial | 9.74e-02 | 1.76e-02 | NA |
| 2. P | P56181 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | 9.89e-02 | 2.71e-03 | NA |
| 2. P | Q0MQD6 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 3.52e-01 | 9.15e-03 | NA |
| 2. P | Q0IH40 | DNL-type zinc finger protein | 1.37e-01 | 3.63e-08 | NA |
| 2. P | Q4ICM9 | Presequence translocated-associated motor subunit PAM17, mitochondrial | 2.59e-02 | 6.75e-03 | NA |
| 2. P | Q2TBI6 | 39S ribosomal protein L32, mitochondrial | 6.66e-01 | 1.40e-04 | NA |
| 2. P | B0VYX3 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.78e-02 | 3.68e-04 | NA |
| 2. P | P05349 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 | 1.42e-01 | 2.64e-02 | NA |
| 2. P | P14277 | Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) | NA | 2.78e-02 | NA |
| 2. P | Q7JZM8 | 39S ribosomal protein L41, mitochondrial | 8.38e-01 | 9.24e-03 | NA |
| 2. P | Q0VG49 | Uncharacterized protein C15orf61 homolog | 5.76e-01 | 2.31e-04 | NA |
| 2. P | P41347 | Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic | 4.83e-02 | 2.05e-05 | NA |
| 2. P | Q9SPI9 | Photosystem II reaction center W protein, chloroplastic | 2.90e-01 | 5.89e-04 | NA |
| 2. P | B6UFC7 | Protein PLASTID REDOX INSENSITIVE 2, chloroplastic | 2.04e-02 | 1.23e-03 | NA |
| 2. P | Q9M9H3 | Embryogenesis-like protein | 8.19e-03 | 1.03e-08 | NA |
| 2. P | Q6H611 | Succinate dehydrogenase subunit 7, mitochondrial | 1.39e-01 | 4.78e-03 | NA |
| 2. P | Q5TC12 | ATP synthase mitochondrial F1 complex assembly factor 1 | 5.08e-01 | 1.16e-04 | NA |
| 2. P | Q9SBM8 | Cytochrome b6-f complex subunit 8, chloroplastic | 4.74e-02 | 3.83e-02 | NA |
| 2. P | Q86TS9 | 39S ribosomal protein L52, mitochondrial | 2.29e-01 | 3.69e-02 | NA |
| 2. P | Q01359 | Cytochrome c oxidase subunit 6, mitochondrial | 3.99e-03 | 3.47e-03 | NA |
| 2. P | P14276 | Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) | NA | 3.66e-02 | NA |
| 2. P | C8VTR5 | Presequence translocated-associated motor subunit pam17, mitochondrial | 4.69e-02 | 7.75e-03 | NA |
| 2. P | Q0MQJ0 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | 1.50e-01 | 3.87e-04 | NA |
| 2. P | Q9M7I9 | Stress enhanced protein 1, chloroplastic | 4.89e-03 | 3.34e-03 | NA |
| 2. P | Q9D8B6 | Protein FAM210B, mitochondrial | 3.39e-02 | 7.32e-04 | NA |
| 2. P | Q9D6U8 | Protein FAM162A | 3.70e-01 | 1.76e-02 | NA |
| 2. P | Q95283 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Fragment) | NA | 7.15e-05 | NA |
| 2. P | Q942X4 | Succinate dehydrogenase subunit 4, mitochondrial | 4.29e-02 | 1.11e-04 | NA |
| 2. P | Q84RQ7 | NifU-like protein 3, chloroplastic | 7.57e-02 | 2.35e-02 | NA |
| 2. P | Q8LD49 | Thioredoxin X, chloroplastic | 4.44e-02 | 3.63e-02 | NA |
| 2. P | Q28GD1 | 39S ribosomal protein L51, mitochondrial | 3.85e-01 | 7.47e-04 | NA |
| 2. P | Q9SX68 | 50S ribosomal protein L18, chloroplastic | 5.14e-01 | 7.00e-03 | NA |
| 2. P | Q0J8M2 | Ferredoxin-1, chloroplastic | 1.61e-01 | 7.32e-04 | NA |
| 2. P | Q43517 | Ferredoxin-1, chloroplastic | 3.20e-01 | 1.93e-04 | NA |
| 2. P | P83646 | Oxygen-evolving enhancer protein 3, chloroplastic | 3.84e-02 | 4.46e-04 | NA |
| 2. P | P0CQ48 | 54S ribosomal protein L27, mitochondrial | 7.14e-01 | 3.07e-03 | NA |
| 2. P | P48201 | ATP synthase F(0) complex subunit C3, mitochondrial | 4.71e-02 | 3.30e-04 | NA |
| 2. P | Q5ZKG1 | 39S ribosomal protein L51, mitochondrial | 4.18e-02 | 3.89e-03 | NA |
| 2. P | P26573 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 3.52e-01 | 1.40e-03 | NA |
| 2. P | P18960 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.49e-01 | 3.24e-02 | NA |
| 2. P | Q8W0Y8 | Photosystem II reaction center PSB28 protein, chloroplastic | 2.45e-01 | 2.05e-03 | NA |
| 2. P | Q811I0 | ATP synthase mitochondrial F1 complex assembly factor 1 | 2.76e-01 | 1.12e-03 | NA |
| 2. P | P08706 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 | 1.28e-01 | 2.25e-02 | NA |
| 2. P | Q28ED6 | Essential MCU regulator, mitochondrial | 1.55e-01 | 7.22e-05 | NA |
| 2. P | Q7QHP6 | Essential MCU regulator, mitochondrial | 1.91e-01 | 1.11e-02 | NA |
| 2. P | P27789 | Ferredoxin-5, chloroplastic | 1.64e-01 | 7.00e-03 | NA |
| 2. P | C0SC25 | Required for respiratory growth protein 9, mitochondrial | 3.68e-01 | 2.02e-02 | NA |
| 2. P | Q04450 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 | 1.71e-01 | 3.10e-02 | NA |
| 2. P | Q99N92 | 39S ribosomal protein L27, mitochondrial | 2.93e-01 | 1.20e-03 | NA |
| 2. P | P32764 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 6 | 1.42e-01 | 2.11e-03 | NA |
| 2. P | P18859 | ATP synthase-coupling factor 6, mitochondrial | 1.89e-01 | 1.05e-04 | NA |
| 2. P | P37293 | Putative N-terminal acetyltransferase 2 | 1.20e-01 | 2.51e-03 | NA |
| 2. P | Q84LK7 | NifU-like protein 1, chloroplastic | 7.56e-02 | 3.60e-02 | NA |
| 2. P | Q8CEI1 | BolA-like protein 3 | 2.86e-02 | 2.92e-03 | NA |
| 2. P | O43674 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 2.49e-01 | 1.81e-02 | NA |
| 2. P | Q42496 | Cytochrome b6-f complex subunit 7, chloroplastic | 3.97e-02 | 1.63e-03 | NA |
| 2. P | Q9ZQG8 | Ferredoxin-3, chloroplastic | 4.32e-01 | 2.48e-04 | NA |
| 2. P | Q5VUE5 | Uncharacterized protein C1orf53 | 2.70e-02 | 1.77e-10 | NA |
| 2. P | Q0MQD8 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 6.18e-01 | 1.81e-02 | NA |
| 2. P | P05496 | ATP synthase F(0) complex subunit C1, mitochondrial | 2.85e-02 | 1.06e-03 | NA |
| 2. P | Q9NX14 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 4.80e-02 | 1.02e-02 | NA |
| 2. P | B0VYX6 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.05e-01 | 8.32e-04 | NA |
| 2. P | Q9C4Z7 | Cell division topological specificity factor homolog, chloroplastic | 2.15e-01 | 1.65e-03 | NA |
| 2. P | B0VYY0 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.99e-02 | 1.64e-04 | NA |
| 2. P | C5GEF3 | Required for respiratory growth protein 9, mitochondrial | 7.80e-02 | 3.35e-02 | NA |
| 2. P | P46522 | Late embryogenesis abundant protein Lea5-D | 1.54e-01 | 5.41e-06 | NA |
| 2. P | B3LJ06 | Altered inheritance of mitochondria protein 39, mitochondrial | 3.49e-01 | 1.27e-02 | NA |
| 2. P | Q9Y6G3 | 39S ribosomal protein L42, mitochondrial | 3.82e-01 | 1.92e-05 | NA |
| 2. P | Q9SX22 | 30S ribosomal protein 3-1, chloroplastic | 1.38e-02 | 1.07e-06 | NA |
| 2. P | Q06645 | ATP synthase F(0) complex subunit C1, mitochondrial | 9.21e-02 | 2.20e-04 | NA |
| 2. P | Q5R9K2 | Cytochrome c oxidase subunit 7B, mitochondrial | 2.84e-01 | 3.21e-02 | NA |
| 2. P | Q6FW26 | Mitochondrial intermembrane space import and assembly protein 40 | 6.94e-02 | 3.04e-03 | NA |
| 2. P | Q3T0B6 | Complement component 1 Q subcomponent-binding protein, mitochondrial | 2.60e-01 | 1.32e-03 | NA |
| 2. P | Q0JQ97 | Monothiol glutaredoxin-S1, mitochondrial | 3.14e-01 | 5.81e-03 | NA |
| 2. P | P87133 | Meiotically up-regulated gene 143 protein | 3.08e-02 | 1.06e-05 | NA |
| 2. P | Q4U2R6 | 39S ribosomal protein L51, mitochondrial | 2.52e-01 | 9.24e-03 | NA |
| 2. P | O24143 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial | 5.32e-01 | 2.81e-04 | NA |
| 2. P | B0VYY3 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.74e-02 | 1.22e-03 | NA |
| 2. P | P20674 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.86e-02 | 1.14e-03 | NA |
| 2. P | P25348 | 54S ribosomal protein L32, mitochondrial | 1.21e-01 | 8.90e-05 | NA |
| 2. P | Q9ZT05 | Photosystem I reaction center subunit psaK, chloroplastic | 3.26e-01 | 1.89e-04 | NA |
| 2. P | A1L1P7 | DNL-type zinc finger protein | 2.87e-01 | 3.97e-05 | NA |
| 2. P | O80813 | Ycf20-like protein | 6.08e-02 | 4.10e-02 | NA |
| 2. P | B0VYY5 | Cytochrome c oxidase subunit 5A, mitochondrial | NA | 1.40e-03 | NA |
| 2. P | Q6P4F2 | Ferredoxin-2, mitochondrial | 7.00e-01 | 1.13e-02 | NA |
| 2. P | P46521 | Late embryogenesis abundant protein Lea5-A | 2.94e-01 | 7.38e-05 | NA |
| 2. P | Q8BTE0 | Succinate dehydrogenase assembly factor 4, mitochondrial | 1.13e-01 | 7.53e-05 | NA |
| 2. P | Q5XG64 | Essential MCU regulator, mitochondrial | 1.03e-01 | 1.36e-05 | NA |
| 2. P | P02721 | ATP synthase-coupling factor 6, mitochondrial | 1.53e-01 | 8.10e-05 | NA |
| 2. P | Q41048 | Oxygen-evolving enhancer protein 3-1, chloroplastic | 2.53e-02 | 4.39e-03 | NA |
| 2. P | P80269 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial | 9.00e-01 | 3.54e-03 | NA |
| 2. P | O35943 | Frataxin, mitochondrial | 2.73e-01 | 1.28e-02 | NA |
| 2. P | Q9BKS0 | ATP synthase lipid-binding protein, mitochondrial | 1.07e-01 | 1.86e-02 | NA |
| 2. P | Q32PC3 | 39S ribosomal protein L27, mitochondrial | 3.71e-01 | 3.86e-02 | NA |
| 2. P | P19308 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 | 1.13e-01 | 1.46e-02 | NA |
| 2. P | Q0J3L4 | Monothiol glutaredoxin-S10 | 6.40e-02 | 4.80e-05 | NA |
| 2. P | A2YQD9 | Ferredoxin-1, chloroplastic | 2.29e-01 | 7.32e-04 | NA |
| 2. P | Q0MQC8 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 4.93e-01 | 1.11e-03 | NA |
| 2. P | Q53CG1 | Cytochrome c oxidase subunit 5A, mitochondrial | NA | 5.05e-03 | NA |
| 2. P | A1XQS5 | ATP synthase F(0) complex subunit C1, mitochondrial | 7.31e-02 | 3.91e-04 | NA |
| 2. P | O04090 | Ferredoxin-1, chloroplastic | 1.26e-01 | 2.39e-04 | NA |
| 2. P | Q71S46 | ATP synthase F(0) complex subunit C3, mitochondrial | 5.66e-02 | 3.30e-04 | NA |
| 2. P | P10798 | Ribulose bisphosphate carboxylase small subunit 3B, chloroplastic | 1.34e-01 | 6.15e-03 | NA |
| 2. P | Q8S091 | Thioredoxin F, chloroplastic | 1.58e-02 | 3.96e-02 | NA |
| 2. P | P25712 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | 8.71e-02 | 2.86e-04 | NA |
| 2. P | Q5ZEG0 | Protein MAO HUZI 4, chloroplastic | 2.28e-02 | 7.61e-05 | NA |
| 2. P | B0VYY2 | Cytochrome c oxidase subunit 5A, mitochondrial | 2.64e-02 | 1.63e-03 | NA |
| 2. P | Q6YFE4 | Monothiol glutaredoxin-5, mitochondrial | 2.78e-01 | 3.15e-02 | NA |
| 2. P | Q1L987 | ATP synthase mitochondrial F1 complex assembly factor 1 | 5.38e-01 | 2.16e-03 | NA |
| 2. P | Q9I8U0 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | 2.95e-01 | 8.19e-03 | NA |
| 2. P | O64764 | Thioredoxin O1, mitochondrial | 3.81e-02 | 4.68e-02 | NA |
| 2. P | Q5UR00 | Uncharacterized protein L908 | NA | 3.39e-06 | NA |
| 2. P | P24483 | Adrenodoxin, mitochondrial | 2.15e-01 | 4.37e-04 | NA |
| 2. P | P87127 | Protein atp11, mitochondrial | 8.03e-01 | 2.25e-02 | NA |
| 2. P | Q61Z75 | Probable NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 6.49e-01 | 1.12e-03 | NA |
| 2. P | Q9BYC8 | 39S ribosomal protein L32, mitochondrial | 6.31e-01 | 1.92e-05 | NA |
| 2. P | Q5M8Z2 | Protein preY, mitochondrial | 6.74e-01 | 1.05e-04 | NA |
| 2. P | Q5RFL2 | ATP synthase F(0) complex subunit C3, mitochondrial | 3.34e-02 | 6.83e-04 | NA |
| 2. P | Q0MQJ4 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | 4.10e-02 | 1.20e-02 | NA |
| 2. P | Q3E870 | Succinate dehydrogenase subunit 7B, mitochondrial | 2.50e-01 | 1.22e-02 | NA |
| 2. P | Q0MQC7 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 4.53e-01 | 1.58e-03 | NA |
| 2. P | P26574 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 | 1.29e-01 | 3.15e-02 | NA |
| 2. P | A8NN94 | 39S ribosomal protein L34, mitochondrial | 7.48e-02 | 4.72e-02 | NA |
| 2. P | A6ZNF7 | Altered inheritance of mitochondria protein 39, mitochondrial | 2.54e-01 | 1.47e-02 | NA |
| 2. P | Q06646 | ATP synthase F(0) complex subunit C2, mitochondrial | 3.15e-02 | 3.96e-03 | NA |
| 2. P | Q20412 | Probable NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 1.36e-01 | 3.18e-02 | NA |
| 2. P | Q39644 | Late embryogenesis abundant protein Lea5 | 1.22e-01 | 1.58e-05 | NA |
| 2. P | Q7S3S2 | Mitochondrial intermembrane space import and assembly protein 40 | 1.73e-01 | 4.11e-04 | NA |
| 2. P | C7GK20 | Altered inheritance of mitochondria protein 39, mitochondrial | 2.57e-01 | 1.16e-02 | NA |
| 2. P | P12301 | Oxygen-evolving enhancer protein 3, chloroplastic | 5.11e-02 | 3.32e-02 | NA |
| 2. P | P97615 | Thioredoxin, mitochondrial | 2.44e-01 | 1.85e-06 | NA |
| 2. P | Q8JZS9 | 39S ribosomal protein L48, mitochondrial | 2.71e-01 | 7.40e-03 | NA |
| 2. P | Q9CX19 | Protein FAM162B | 3.45e-02 | 2.35e-03 | NA |
| 2. P | P21571 | ATP synthase-coupling factor 6, mitochondrial | 1.45e-01 | 9.27e-06 | NA |
| 2. P | Q09759 | Uncharacterized protein C24H6.02c | 8.11e-01 | 3.80e-05 | NA |
| 2. P | Q6H7E4 | Thioredoxin M1, chloroplastic | 5.03e-02 | 6.75e-03 | NA |
| 2. P | P46486 | Photosystem I reaction center subunit III, chloroplastic | 1.41e-01 | 4.60e-05 | NA |
| 2. P | Q291A0 | 39S ribosomal protein L41, mitochondrial | 7.82e-01 | 1.60e-03 | NA |
| 2. P | P19312 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 6 | 1.81e-01 | 4.48e-02 | NA |
| 2. P | Q9S7N7 | Photosystem I reaction center subunit V, chloroplastic | 7.59e-02 | 7.68e-03 | NA |
| 2. P | P38231 | Protein FMP23, mitochondrial | 9.61e-02 | 2.95e-03 | NA |
| 2. P | A2YLX7 | Protein LHCP TRANSLOCATION DEFECT | 5.65e-02 | 1.69e-04 | NA |
| 2. P | Q12349 | ATP synthase subunit H, mitochondrial | 2.18e-01 | 3.99e-04 | NA |
| 2. P | Q9VLJ9 | 39S ribosomal protein L51, mitochondrial | 2.35e-01 | 4.18e-02 | NA |
| 2. P | Q0MQJ1 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | 6.96e-02 | 2.56e-03 | NA |
| 2. P | Q8SPH6 | ATP synthase-coupling factor 6, mitochondrial | 1.68e-01 | 5.62e-05 | NA |
| 2. P | A8XDX2 | ATP synthase lipid-binding protein, mitochondrial | 1.16e-01 | 1.86e-02 | NA |
| 2. P | P16136 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 3 | 2.49e-01 | 1.50e-02 | NA |
| 2. P | B0VYX4 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.64e-02 | 5.55e-04 | NA |
| 2. P | Q96542 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.52e-01 | 3.81e-03 | NA |
| 2. P | P19955 | 37S ribosomal protein YMR-31, mitochondrial | 7.54e-01 | 1.07e-03 | NA |
| 2. P | P0CM69 | Mitochondrial intermembrane space import and assembly protein 40 | 3.92e-02 | 2.14e-05 | NA |
| 2. P | Q9XIK0 | Protein PLASTID REDOX INSENSITIVE 2, chloroplastic | 1.14e-02 | 1.00e-03 | NA |
| 2. P | Q24407 | ATP synthase-coupling factor 6, mitochondrial | 1.96e-01 | 7.68e-03 | NA |
| 2. P | Q9Y7U8 | 54S ribosomal protein L37, mitochondrial | 5.45e-02 | 3.71e-03 | NA |
| 2. P | Q54C45 | Frataxin, mitochondrial | 7.94e-02 | 4.25e-02 | NA |
| 2. P | P27787 | Ferredoxin-1, chloroplastic | 3.15e-01 | 5.16e-05 | NA |
| 2. P | P42844 | Mitochondrial protein import protein ZIM17 | 1.67e-01 | 2.76e-05 | NA |
| 2. P | P36046 | Mitochondrial intermembrane space import and assembly protein 40 | 2.53e-01 | 1.73e-02 | NA |
| 2. P | Q9LU21 | Photosynthetic NDH subunit of subcomplex B 3, chloroplastic | 6.80e-01 | 1.38e-03 | NA |
| 2. P | Q0E3V2 | Protein YELLOW LEAF 1, choloroplastic | 1.58e-01 | 3.60e-02 | NA |
| 2. P | A0A0S4IJL0 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.39e-01 | 9.85e-03 | NA |
| 2. P | P00257 | Adrenodoxin, mitochondrial | 1.30e-01 | 2.19e-02 | NA |
| 2. P | Q5VUM1 | Succinate dehydrogenase assembly factor 4, mitochondrial | 9.30e-02 | 3.76e-02 | NA |
| 2. P | Q5RBH2 | Diablo homolog, mitochondrial | 9.47e-02 | 6.56e-03 | NA |
| 2. P | Q02380 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 5.99e-01 | 2.28e-03 | NA |
| 2. P | Q42823 | Ribulose bisphosphate carboxylase small subunit, chloroplastic | 1.01e-01 | 4.48e-02 | NA |
| 2. P | Q96I23 | Protein preY, mitochondrial | 2.82e-01 | 6.26e-03 | NA |
| 2. P | Q5TKD8 | Thioredoxin-like 2, chloroplastic | 2.11e-02 | 2.82e-03 | NA |
| 2. P | P17605 | ATP synthase F(0) complex subunit C1, mitochondrial | 4.01e-02 | 1.60e-03 | NA |
| 2. P | Q9LFV0 | 30S ribosomal protein 3-2, chloroplastic | 2.67e-02 | 2.96e-07 | NA |
| 2. P | Q6P161 | 39S ribosomal protein L54, mitochondrial | 1.91e-01 | 1.48e-04 | NA |
| 2. P | Q4QQV3 | Protein FAM162A | 1.01e-01 | 2.69e-02 | NA |
| 2. P | Q4P8D2 | Mitochondrial intermembrane space import and assembly protein 40 | 2.26e-01 | 1.64e-07 | NA |
| 2. P | Q7SEE1 | Presequence translocated-associated motor subunit pam17, mitochondrial | 2.98e-01 | 2.86e-04 | NA |
| 2. P | B0VYX7 | Cytochrome c oxidase subunit 5A, mitochondrial | 2.21e-02 | 6.37e-04 | NA |
| 2. P | O22591 | Oxygen-evolving enhancer protein 3, chloroplastic | 4.29e-02 | 1.46e-02 | NA |
| 2. P | Q5ZBY9 | Photosystem II reaction center W protein, chloroplastic | 5.16e-01 | 1.42e-03 | NA |
| 2. P | E9QBI7 | Metalloendopeptidase OMA1, mitochondrial | 4.52e-01 | 3.83e-02 | NA |
| 2. P | Q99757 | Thioredoxin, mitochondrial | 2.84e-01 | 1.96e-07 | NA |
| 2. P | Q8LBK6 | Monothiol glutaredoxin-S15, mitochondrial | 8.40e-02 | 1.26e-02 | NA |
| 2. P | Q9U616 | Glycine cleavage system H protein, mitochondrial | 3.02e-01 | 6.25e-04 | NA |
| 2. P | F4JV80 | Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial | 1.25e-01 | 3.62e-07 | NA |
| 2. P | Q9LF68 | Protein BOLA4, chloroplastic/mitochondrial | 5.00e-02 | 1.64e-04 | NA |
| 2. P | Q5T6X4 | Protein FAM162B | 3.14e-02 | 7.53e-06 | NA |
| 2. P | O23344 | Ferredoxin C 1, chloroplastic | 1.45e-01 | 6.32e-03 | NA |
| 2. P | Q9SUI5 | Photosystem I reaction center subunit psaK, chloroplastic | 3.06e-01 | 2.04e-02 | NA |
| 2. P | P27626 | Senescence-associated protein DIN1 | 7.11e-02 | 2.05e-05 | NA |
| 2. P | Q9XI73 | Photosynthetic NDH subunit of lumenal location 2, chloroplastic | 2.62e-02 | 8.08e-04 | NA |
| 2. P | Q2M2S2 | Essential MCU regulator, mitochondrial | 7.67e-02 | 2.82e-05 | NA |
| 2. P | Q39084 | Late embryogenis abundant protein 41 | 1.27e-01 | 2.98e-05 | NA |
| 2. P | Q54P40 | Iron-sulfur cluster assembly 2 homolog, mitochondrial | 2.40e-01 | 1.73e-02 | NA |
| 2. P | A6ZSH0 | Mitochondrial protein import protein ZIM17 | 8.51e-02 | 2.76e-05 | NA |
| 2. P | P80971 | Cytochrome c oxidase subunit 4 isoform 2, mitochondrial | 4.49e-02 | 4.03e-03 | NA |
| 2. P | O80429 | Ferredoxin-2, chloroplastic | 2.08e-01 | 1.53e-05 | NA |
| 2. P | Q39194 | Photosystem II reaction center W protein, chloroplastic | 1.79e-01 | 7.47e-04 | NA |
| 2. P | A6NNL5 | Uncharacterized protein C15orf61 | 5.79e-01 | 1.74e-03 | NA |
| 2. P | P97450 | ATP synthase-coupling factor 6, mitochondrial | 1.45e-01 | 1.01e-04 | NA |
| 2. P | O35658 | Complement component 1 Q subcomponent-binding protein, mitochondrial | 2.52e-01 | 1.29e-04 | NA |
| 2. P | P00426 | Cytochrome c oxidase subunit 5A, mitochondrial | 2.13e-02 | 4.56e-03 | NA |
| 2. P | P0C2B7 | 39S ribosomal protein L52, mitochondrial | 1.73e-01 | 1.23e-02 | NA |
| 2. P | Q8LBS4 | Monothiol glutaredoxin-S12, chloroplastic | 1.42e-01 | 3.33e-04 | NA |
| 2. P | Q7Z7F7 | 39S ribosomal protein L55, mitochondrial | 1.41e-01 | 3.69e-02 | NA |
| 2. P | B0VYX8 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.47e-02 | 1.21e-03 | NA |
| 2. P | Q0JM76 | Monothiol glutaredoxin-S4, mitochondrial | 2.45e-01 | 2.74e-03 | NA |
| 2. P | B0VYX1 | Cytochrome c oxidase subunit 5A, mitochondrial | 1.65e-02 | 4.83e-04 | NA |
| 2. P | O82230 | Nucleoid-associated protein At2g24020, chloroplastic | 4.55e-02 | 1.46e-02 | NA |
| 2. P | D3ZS74 | Metalloendopeptidase OMA1, mitochondrial | 3.58e-01 | 3.21e-02 | NA |
| 2. P | Q5RBY3 | ATP synthase-coupling factor 6, mitochondrial | 8.95e-02 | 1.54e-03 | NA |
| 2. P | Q4R4E0 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | 1.44e-01 | 1.64e-02 | NA |
| 2. P | P82162 | 30S ribosomal protein S10 alpha, chloroplastic | 7.44e-02 | 2.88e-02 | NA |
| 2. P | Q9SWI6 | 50S ribosomal protein L29, chloroplastic | 9.48e-03 | 1.60e-06 | NA |
| 2. P | O95178 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial | 9.10e-01 | 2.79e-05 | NA |
| 2. P | Q08C57 | Ferredoxin-2, mitochondrial | 1.77e-01 | 5.44e-04 | NA |
| 2. P | P10109 | Adrenodoxin, mitochondrial | 2.98e-01 | 9.79e-06 | NA |
| 2. P | P83565 | 39S ribosomal protein L40, mitochondrial | 1.94e-01 | 1.28e-02 | NA |
| 2. P | O43045 | Iron-sulfur assembly protein 2 | 5.95e-01 | 5.33e-04 | NA |
| 2. P | P16137 | Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 | 8.17e-02 | 2.27e-02 | NA |
| 2. P | Q9DCI9 | 39S ribosomal protein L32, mitochondrial | 7.93e-01 | 7.39e-04 | NA |
| 2. P | Q2UF33 | Required for respiratory growth protein 9, mitochondrial | 6.66e-02 | 1.76e-02 | NA |
| 2. P | Q05B51 | Ferredoxin-2, mitochondrial | 6.14e-01 | 1.70e-02 | NA |
| 2. P | A8JGV8 | ATP-dependent Clp protease adapter protein CLPS2, chloroplastic | 7.14e-02 | 4.07e-02 | NA |
| 2. P | Q9CPW3 | 39S ribosomal protein L54, mitochondrial | 2.22e-01 | 6.19e-04 | NA |
| 2. P | Q9M812 | Protein CURVATURE THYLAKOID 1C, chloroplastic | 1.51e-02 | 8.45e-05 | NA |
| 3. B | Q02873 | UPF0651 protein YPL107W, mitochondrial | 3.52e-02 | NA | 5.11e-04 |
| 3. B | Q9USH2 | UPF0651 protein P31B10.02, mitochondrial | 5.97e-02 | NA | 2.30e-04 |