Summary

Q5BKU9

Homolog: Q5R7Q6.
Function: Oxidoreductase-like domain-containing protein 1.

Statistics

Total GO Annotation: 221
Unique PROST Go: 219
Unique BLAST Go: 1

Total Homologs: 393
Unique PROST Homologs: 387
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5R7Q6 (Oxidoreductase-like domain-containing protein 1) with a FATCAT P-Value: 2.34e-06 and RMSD of 2.07 angstrom. The sequence alignment identity is 89.9%.
Structural alignment shown in left. Query protein Q5BKU9 colored as red in alignment, homolog Q5R7Q6 colored as blue. Query protein Q5BKU9 is also shown in right top, homolog Q5R7Q6 showed in right bottom. They are colored based on secondary structures. 

  Q5BKU9 MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKAS------------LPPELQPPT 88
  Q5R7Q6 MLLRRVVEGGWAVAAAARGSGAHRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPSGGPSEPQYPLPPELQPPT 100

  Q5BKU9 NCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGG 147
  Q5R7Q6 NCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIQLHTRCGG 159

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005739 mitochondrion
2. P GO:0042550 photosystem I stabilization
2. P GO:0070995 NADPH oxidation
2. P GO:0048025 negative regulation of mRNA splicing, via spliceosome
2. P GO:0051402 neuron apoptotic process
2. P GO:0106035 protein maturation by [4Fe-4S] cluster transfer
2. P GO:0042644 chloroplast nucleoid
2. P GO:0050567 glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity
2. P GO:0014065 phosphatidylinositol 3-kinase signaling
2. P GO:0016972 thiol oxidase activity
2. P GO:0030150 protein import into mitochondrial matrix
2. P GO:0019034 viral replication complex
2. P GO:0009941 chloroplast envelope
2. P GO:0103012 ferredoxin-thioredoxin reductase activity
2. P GO:0005080 protein kinase C binding
2. P GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
2. P GO:0022417 protein maturation by protein folding
2. P GO:0034703 cation channel complex
2. P GO:0048786 presynaptic active zone
2. P GO:0009506 plasmodesma
2. P GO:0015986 ATP synthesis coupled proton transport
2. P GO:0009579 thylakoid
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0042446 hormone biosynthetic process
2. P GO:1905242 response to 3,3',5-triiodo-L-thyronine
2. P GO:1904231 positive regulation of succinate dehydrogenase activity
2. P GO:2000510 positive regulation of dendritic cell chemotaxis
2. P GO:0009536 plastid
2. P GO:0019230 proprioception
2. P GO:0008047 enzyme activator activity
2. P GO:0010917 negative regulation of mitochondrial membrane potential
2. P GO:0003714 transcription corepressor activity
2. P GO:0051561 positive regulation of mitochondrial calcium ion concentration
2. P GO:0034986 iron chaperone activity
2. P GO:0009725 response to hormone
2. P GO:0044877 protein-containing complex binding
2. P GO:0005540 hyaluronic acid binding
2. P GO:1904234 positive regulation of aconitate hydratase activity
2. P GO:0051537 2 iron, 2 sulfur cluster binding
2. P GO:0008289 lipid binding
2. P GO:0009749 response to glucose
2. P GO:0015078 proton transmembrane transporter activity
2. P GO:0009055 electron transfer activity
2. P GO:0032544 plastid translation
2. P GO:0018283 iron incorporation into metallo-sulfur cluster
2. P GO:0097753 membrane bending
2. P GO:0045454 cell redox homeostasis
2. P GO:0044572 [4Fe-4S] cluster assembly
2. P GO:0036444 calcium import into the mitochondrion
2. P GO:0031669 cellular response to nutrient levels
2. P GO:0030093 chloroplast photosystem I
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:0030061 mitochondrial crista
2. P GO:0009570 chloroplast stroma
2. P GO:0016226 iron-sulfur cluster assembly
2. P GO:0001405 PAM complex, Tim23 associated import motor
2. P GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
2. P GO:0022834 ligand-gated channel activity
2. P GO:0005737 cytoplasm
2. P GO:0016123 xanthophyll biosynthetic process
2. P GO:0034553 mitochondrial respiratory chain complex II assembly
2. P GO:0050687 negative regulation of defense response to virus
2. P GO:0009344 nitrite reductase complex [NAD(P)H]
2. P GO:0031224 intrinsic component of membrane
2. P GO:1990221 L-cysteine desulfurase complex
2. P GO:0009773 photosynthetic electron transport in photosystem I
2. P GO:0009853 photorespiration
2. P GO:0005524 ATP binding
2. P GO:0042775 mitochondrial ATP synthesis coupled electron transport
2. P GO:1990524 INA complex
2. P GO:0010460 positive regulation of heart rate
2. P GO:0045815 epigenetic maintenance of chromatin in transcription-competent conformation
2. P GO:0045333 cellular respiration
2. P GO:0018316 peptide cross-linking via L-cystine
2. P GO:0009538 photosystem I reaction center
2. P GO:0042646 plastid nucleoid
2. P GO:0009507 chloroplast
2. P GO:0010722 regulation of ferrochelatase activity
2. P GO:0009768 photosynthesis, light harvesting in photosystem I
2. P GO:0008203 cholesterol metabolic process
2. P GO:0042407 cristae formation
2. P GO:0051349 positive regulation of lyase activity
2. P GO:0009658 chloroplast organization
2. P GO:0080153 negative regulation of reductive pentose-phosphate cycle
2. P GO:0150034 distal axon
2. P GO:0022900 electron transport chain
2. P GO:0009535 chloroplast thylakoid membrane
2. P GO:0045777 positive regulation of blood pressure
2. P GO:0097428 protein maturation by iron-sulfur cluster transfer
2. P GO:0016540 protein autoprocessing
2. P GO:0071456 cellular response to hypoxia
2. P GO:0005886 plasma membrane
2. P GO:0009654 photosystem II oxygen evolving complex
2. P GO:0019898 extrinsic component of membrane
2. P GO:0009643 photosynthetic acclimation
2. P GO:0006121 mitochondrial electron transport, succinate to ubiquinone
2. P GO:0005759 mitochondrial matrix
2. P GO:0004129 cytochrome-c oxidase activity
2. P GO:0034704 calcium channel complex
2. P GO:0009060 aerobic respiration
2. P GO:0032543 mitochondrial translation
2. P GO:0008494 translation activator activity
2. P GO:0032307 negative regulation of prostaglandin secretion
2. P GO:0051353 positive regulation of oxidoreductase activity
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:1903427 negative regulation of reactive oxygen species biosynthetic process
2. P GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone)
2. P GO:0009534 chloroplast thylakoid
2. P GO:0097573 glutathione oxidoreductase activity
2. P GO:0031305 integral component of mitochondrial inner membrane
2. P GO:1905232 cellular response to L-glutamate
2. P GO:0034599 cellular response to oxidative stress
2. P GO:1900139 negative regulation of arachidonic acid secretion
2. P GO:0043249 erythrocyte maturation
2. P GO:0042776 mitochondrial ATP synthesis coupled proton transport
2. P GO:0009744 response to sucrose
2. P GO:0046931 pore complex assembly
2. P GO:0032981 mitochondrial respiratory chain complex I assembly
2. P GO:0009416 response to light stimulus
2. P GO:0039536 negative regulation of RIG-I signaling pathway
2. P GO:0009543 chloroplast thylakoid lumen
2. P GO:0030984 kininogen binding
2. P GO:1901165 positive regulation of trophoblast cell migration
2. P GO:1903850 regulation of cristae formation
2. P GO:0140467 integrated stress response signaling
2. P GO:0010196 nonphotochemical quenching
2. P GO:0050821 protein stabilization
2. P GO:0048678 response to axon injury
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0000427 plastid-encoded plastid RNA polymerase complex
2. P GO:0001849 complement component C1q complex binding
2. P GO:0031690 adrenergic receptor binding
2. P GO:0015292 uniporter activity
2. P GO:0006450 regulation of translational fidelity
2. P GO:0080167 response to karrikin
2. P GO:0005763 mitochondrial small ribosomal subunit
2. P GO:0009631 cold acclimation
2. P GO:0015035 protein-disulfide reductase activity
2. P GO:0010637 negative regulation of mitochondrial fusion
2. P GO:0006120 mitochondrial electron transport, NADH to ubiquinone
2. P GO:0140468 HRI-mediated signaling
2. P GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
2. P GO:0015979 photosynthesis
2. P GO:0005753 mitochondrial proton-transporting ATP synthase complex
2. P GO:0005761 mitochondrial ribosome
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:0097177 mitochondrial ribosome binding
2. P GO:0009578 etioplast stroma
2. P GO:0047134 protein-disulfide reductase (NAD(P)) activity
2. P GO:0045471 response to ethanol
2. P GO:0090200 positive regulation of release of cytochrome c from mitochondria
2. P GO:0031638 zymogen activation
2. P GO:0031942 i-AAA complex
2. P GO:0045041 protein import into mitochondrial intermembrane space
2. P GO:0030449 regulation of complement activation
2. P GO:0042256 mature ribosome assembly
2. P GO:0006958 complement activation, classical pathway
2. P GO:0009515 granal stacked thylakoid
2. P GO:0009522 photosystem I
2. P GO:0005751 mitochondrial respiratory chain complex IV
2. P GO:0005749 mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
2. P GO:0010287 plastoglobule
2. P GO:0039534 negative regulation of MDA-5 signaling pathway
2. P GO:0009508 plastid chromosome
2. P GO:0061959 response to (R)-carnitine
2. P GO:0010027 thylakoid membrane organization
2. P GO:1990246 uniplex complex
2. P GO:0042549 photosystem II stabilization
2. P GO:0009780 photosynthetic NADP+ reduction
2. P GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
2. P GO:0003677 DNA binding
2. P GO:0009353 mitochondrial oxoglutarate dehydrogenase complex
2. P GO:0032689 negative regulation of interferon-gamma production
2. P GO:0006754 ATP biosynthetic process
2. P GO:0005747 mitochondrial respiratory chain complex I
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0034982 mitochondrial protein processing
2. P GO:0070681 glutaminyl-tRNAGln biosynthesis via transamidation
2. P GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)
2. P GO:0006694 steroid biosynthetic process
2. P GO:0097009 energy homeostasis
2. P GO:0009523 photosystem II
2. P GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0004362 glutathione-disulfide reductase (NADPH) activity
2. P GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly
2. P GO:0005743 mitochondrial inner membrane
2. P GO:0031966 mitochondrial membrane
2. P GO:0033614 chloroplast proton-transporting ATP synthase complex assembly
2. P GO:0098982 GABA-ergic synapse
2. P GO:0090023 positive regulation of neutrophil chemotaxis
2. P GO:0070131 positive regulation of mitochondrial translation
2. P GO:0071320 cellular response to cAMP
2. P GO:0003729 mRNA binding
2. P GO:0016021 integral component of membrane
2. P GO:0045273 respiratory chain complex II
2. P GO:0002024 diet induced thermogenesis
2. P GO:0009893 positive regulation of metabolic process
2. P GO:0019253 reductive pentose-phosphate cycle
2. P GO:0090391 granum assembly
2. P GO:0009767 photosynthetic electron transport chain
2. P GO:0006662 glycerol ether metabolic process
2. P GO:0045648 positive regulation of erythrocyte differentiation
2. P GO:0046034 ATP metabolic process
2. P GO:0046872 metal ion binding
2. P GO:0016730 oxidoreductase activity, acting on iron-sulfur proteins as donors
2. P GO:0000506 glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
2. P GO:0009644 response to high light intensity
2. P GO:0051560 mitochondrial calcium ion homeostasis
2. P GO:0006506 GPI anchor biosynthetic process
2. P GO:0033108 mitochondrial respiratory chain complex assembly
2. P GO:0004322 ferroxidase activity
2. P GO:0006851 mitochondrial calcium ion transmembrane transport
2. P GO:0014850 response to muscle activity
2. P GO:0099080 supramolecular complex
2. P GO:1904322 cellular response to forskolin
2. P GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
2. P GO:0071486 cellular response to high light intensity
2. P GO:0014070 response to organic cyclic compound
2. P GO:0045773 positive regulation of axon extension
2. P GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex
3. B GO:0016491 oxidoreductase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A7YVI8 Oxidoreductase-like domain-containing protein 1 4.75e-06 9.27e-54 2.06e-59
1. PB Q9CR10 Oxidoreductase-like domain-containing protein 1 9.46e-05 1.46e-21 1.11e-46
1. PB Q5R7Q6 Oxidoreductase-like domain-containing protein 1 2.34e-06 1.67e-73 1.24e-98
1. PB Q5BKU9 Oxidoreductase-like domain-containing protein 1 0 1.49e-129 1.65e-105
2. P P27788 Ferredoxin-3, chloroplastic 1.58e-01 3.25e-03 NA
2. P B5DFW7 Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial 3.93e-01 4.72e-02 NA
2. P Q9ZTS2 Ferredoxin, chloroplastic 2.83e-01 2.90e-03 NA
2. P Q6YTI3 Thioredoxin-like 4, chloroplastic 3.19e-02 1.43e-02 NA
2. P P29684 Ribulose bisphosphate carboxylase small subunit, chloroplastic 9.91e-02 9.76e-03 NA
2. P Q4RSW7 Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial 2.94e-01 3.96e-03 NA
2. P P00228 Ferredoxin, chloroplastic 1.18e-01 2.32e-06 NA
2. P Q6CSA1 Mitochondrial intermembrane space import and assembly protein 40 2.77e-01 3.36e-04 NA
2. P P09911 Ferredoxin-1, chloroplastic 3.54e-01 2.88e-02 NA
2. P O80439 30S ribosomal protein S31, chloroplastic 2.00e-01 3.96e-03 NA
2. P Q0JG75 Photosystem II reaction center PSB28 protein, chloroplastic 9.37e-02 8.81e-05 NA
2. P O22914 Calvin cycle protein CP12-1, chloroplastic 1.65e-02 1.42e-02 NA
2. P Q8S904 Adrenodoxin-like protein 2, mitochondrial 1.41e-01 1.43e-02 NA
2. P A7TGK3 Inner membrane assembly complex subunit 17 1.17e-01 5.40e-03 NA
2. P B3LPE4 Mitochondrial protein import protein ZIM17 7.16e-02 2.76e-05 NA
2. P Q0D5P8 Oxygen-evolving enhancer protein 3, chloroplastic 5.23e-02 4.46e-04 NA
2. P A3BKF2 Protein LHCP TRANSLOCATION DEFECT 2.01e-02 1.69e-04 NA
2. P B5VQB0 Mitochondrial protein import protein ZIM17 3.20e-01 2.76e-05 NA
2. P Q9T070 Cytochrome c oxidase subunit 6a, mitochondrial 4.87e-01 3.18e-02 NA
2. P B5VRJ9 Altered inheritance of mitochondria protein 39, mitochondrial 3.71e-01 1.18e-02 NA
2. P P07179 Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 1.34e-01 4.47e-03 NA
2. P P41348 Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic 6.91e-02 1.95e-02 NA
2. P A6QPI4 Protein FAM162B 1.03e-01 2.35e-03 NA
2. P Q9FX83 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial 4.36e-01 2.95e-04 NA
2. P P04669 Ferredoxin, chloroplastic 3.66e-01 1.13e-02 NA
2. P Q6FRU5 Inner membrane assembly complex subunit 17 1.95e-01 2.55e-02 NA
2. P Q949Q5 Photosystem I subunit O 1.75e-02 8.90e-05 NA
2. P Q42599 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial 3.11e-01 7.13e-03 NA
2. P O74471 Cytochrome c oxidase subunit 13, mitochondrial 1.01e-01 1.80e-03 NA
2. P Q4WKN3 Presequence translocated-associated motor subunit pam17, mitochondrial 1.84e-02 5.49e-04 NA
2. P Q94KR8 Translation initiation factor IF-1, chloroplastic 1.82e-01 2.83e-02 NA
2. P O93980 Cytochrome c oxidase polypeptide 5, mitochondrial 3.51e-01 1.51e-05 NA
2. P Q10217 Putative acyl carrier protein, mitochondrial 7.42e-02 8.04e-03 NA
2. P Q9M0V0 Adrenodoxin-like protein 1, mitochondrial 1.37e-01 4.15e-03 NA
2. P Q09218 Uncharacterized protein B0495.9 8.66e-02 3.24e-02 NA
2. P Q3UMR5 Calcium uniporter protein, mitochondrial 2.99e-01 2.50e-02 NA
2. P Q9MZE0 Complement component 1 Q subcomponent-binding protein, mitochondrial 2.56e-01 9.97e-05 NA
2. P Q9US57 Uncharacterized protein C1002.01 6.23e-02 4.33e-02 NA
2. P Q6DQX6 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 5.09e-02 1.26e-02 NA
2. P Q9CPU2 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 2.23e-01 7.62e-04 NA
2. P Q95108 Thioredoxin, mitochondrial 3.54e-01 1.56e-08 NA
2. P Q7X8R5 Thioredoxin M2, chloroplastic 1.01e-01 3.32e-02 NA
2. P Q07021 Complement component 1 Q subcomponent-binding protein, mitochondrial 4.33e-01 1.01e-04 NA
2. P Q66KZ3 39S ribosomal protein L51, mitochondrial 5.22e-02 1.34e-02 NA
2. P Q9P0M9 39S ribosomal protein L27, mitochondrial 2.03e-01 1.69e-02 NA
2. P Q7XJ02 Probable L-ascorbate peroxidase 7, chloroplastic 3.05e-01 3.15e-02 NA
2. P Q03672 ATP synthase subunit 9, mitochondrial 4.62e-02 1.01e-02 NA
2. P Q9DB10 Essential MCU regulator, mitochondrial 6.53e-02 1.83e-03 NA
2. P Q9U505 ATP synthase lipid-binding protein, mitochondrial 1.39e-02 1.27e-04 NA
2. P P43266 Ubiquinol-cytochrome-C reductase complex subunit IX, mitochondrial 1.24e-01 3.04e-02 NA
2. P P22179 Photosystem I reaction center subunit VI, chloroplastic 1.67e-01 2.83e-02 NA
2. P P16132 Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 8.58e-02 7.47e-03 NA
2. P P0C2B9 28S ribosomal protein L42, mitochondrial 8.58e-02 6.04e-03 NA
2. P Q5BJJ8 39S ribosomal protein L51, mitochondrial 3.67e-02 2.16e-03 NA
2. P P69250 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 1.77e-01 1.03e-02 NA
2. P Q06056 ATP synthase F(0) complex subunit C2, mitochondrial 2.32e-02 1.03e-02 NA
2. P F1SZ42 Protein FERTILITY RESTORER RF2, mitochondrial 3.00e-02 6.25e-04 NA
2. P Q3MHJ5 39S ribosomal protein L54, mitochondrial 1.73e-01 5.91e-06 NA
2. P Q6K471 Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic 2.30e-01 1.88e-03 NA
2. P Q08BI9 Calcium uniporter protein, mitochondrial 2.73e-01 2.50e-02 NA
2. P P56383 ATP synthase F(0) complex subunit C2, mitochondrial 9.76e-02 4.40e-02 NA
2. P Q93W20 NifU-like protein 2, chloroplastic 5.75e-02 2.69e-02 NA
2. P Q5U1Z8 Protein preY, mitochondrial 8.16e-01 1.28e-02 NA
2. P B0VYY1 Cytochrome c oxidase subunit 5A, mitochondrial 2.15e-02 3.22e-03 NA
2. P P04715 Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 1.13e-01 2.37e-02 NA
2. P Q04472 Mitochondrial inner membrane i-AAA protease supercomplex subunit MGR3 2.24e-01 2.71e-02 NA
2. P P07926 ATP synthase F(0) complex subunit C2, mitochondrial 1.96e-02 2.09e-02 NA
2. P O49856 Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic 1.07e-01 5.97e-06 NA
2. P Q0MQD7 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 7.61e-01 1.81e-02 NA
2. P P97493 Thioredoxin, mitochondrial 3.44e-01 8.61e-07 NA
2. P P0CM68 Mitochondrial intermembrane space import and assembly protein 40 1.43e-01 8.68e-06 NA
2. P Q41387 Photosystem II reaction center W protein, chloroplastic 5.97e-02 1.54e-04 NA
2. P Q1LXI5 39S ribosomal protein L54, mitochondrial 3.20e-01 8.53e-05 NA
2. P P0DKI0 Succinate dehydrogenase subunit 3-1, mitochondrial 1.47e-01 5.74e-05 NA
2. P F1SZ44 Protein FERTILITY RESTORER RF2, mitochondrial 3.00e-02 1.04e-03 NA
2. P Q9VCI5 Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial 2.25e-01 3.66e-02 NA
2. P Q8LCT3 Thioredoxin-like 2-2, chloroplastic 5.41e-02 3.89e-02 NA
2. P A2BHB7 Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial 8.45e-02 1.48e-02 NA
2. P Q06055 ATP synthase F(0) complex subunit C2, mitochondrial 1.62e-02 4.19e-03 NA
2. P Q8LCA1 Protein CURVATURE THYLAKOID 1B, chloroplastic 8.34e-02 3.12e-02 NA
2. P P00258 Adrenodoxin, mitochondrial 1.94e-01 1.61e-02 NA
2. P P10647 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 1.42e-01 8.50e-03 NA
2. P P46656 Adrenodoxin, mitochondrial 2.25e-01 1.85e-03 NA
2. P Q9USM2 Uncharacterized protein C16A11.15c 1.61e-01 1.05e-03 NA
2. P P0CQ49 54S ribosomal protein L27, mitochondrial 6.00e-01 3.07e-03 NA
2. P P10796 Ribulose bisphosphate carboxylase small subunit 1B, chloroplastic 1.52e-01 3.47e-02 NA
2. P Q7XZZ1 Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial 7.44e-02 3.31e-05 NA
2. P Q9VE04 39S ribosomal protein L55, mitochondrial 4.18e-01 4.80e-02 NA
2. P P53266 Cytochrome oxidase assembly protein SHY1 3.48e-01 9.58e-03 NA
2. P Q9CR84 ATP synthase F(0) complex subunit C1, mitochondrial 7.74e-02 8.83e-04 NA
2. P Q4V7Q1 39S ribosomal protein L52, mitochondrial 8.43e-02 2.33e-03 NA
2. P Q9SR32 UPF0161 protein At3g09310 4.26e-02 1.72e-05 NA
2. P Q96KR6 Protein FAM210B, mitochondrial 3.85e-02 1.13e-05 NA
2. P A2XK57 Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial 4.43e-01 3.31e-05 NA
2. P C8ZHR0 Altered inheritance of mitochondria protein 39, mitochondrial 2.71e-01 8.74e-03 NA
2. P P36886 Photosystem I reaction center subunit psaK, chloroplastic 6.01e-02 4.89e-02 NA
2. P P87059 Mitochondrial intermembrane space import and assembly protein 40 9.07e-02 5.86e-05 NA
2. P Q290M9 Essential MCU regulator, mitochondrial 2.62e-01 2.87e-03 NA
2. P Q0MQJ5 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 4.85e-02 6.63e-04 NA
2. P B0VYX9 Cytochrome c oxidase subunit 5A, mitochondrial 1.45e-02 8.91e-04 NA
2. P Q9H4I9 Essential MCU regulator, mitochondrial 7.05e-02 8.62e-05 NA
2. P P10797 Ribulose bisphosphate carboxylase small subunit 2B, chloroplastic 1.76e-01 7.54e-03 NA
2. P Q8VY88 Protein LHCP TRANSLOCATION DEFECT 2.82e-01 6.21e-03 NA
2. P C5WR30 Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial 1.02e-01 1.78e-05 NA
2. P B9RRX2 Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial 7.81e-02 1.42e-02 NA
2. P P16972 Ferredoxin-2, chloroplastic 1.45e-01 2.45e-06 NA
2. P Q96A26 Protein FAM162A 1.50e-01 2.00e-02 NA
2. P O04683 Ferredoxin-1, chloroplastic 3.34e-01 1.25e-02 NA
2. P P0C5N3 Uncharacterized protein YGL041W-A, mitochondrial 3.64e-02 1.86e-05 NA
2. P O65037 50S ribosomal protein L27, chloroplastic 3.07e-01 1.48e-02 NA
2. P P69249 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.19e-01 1.03e-02 NA
2. P Q5R4S3 39S ribosomal protein L42, mitochondrial 2.08e-01 3.76e-05 NA
2. P P31333 Ribulose bisphosphate carboxylase small subunit, chloroplastic 3.25e-01 2.88e-02 NA
2. P Q6BSK8 Mitochondrial intermembrane space import and assembly protein 40 1.96e-01 2.46e-04 NA
2. P Q3SZN3 Metalloendopeptidase OMA1, mitochondrial 3.14e-01 1.12e-02 NA
2. P Q5R504 Protein FAM162A 4.75e-01 3.73e-02 NA
2. P Q02374 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 2.41e-01 1.43e-04 NA
2. P Q9SRX6 Late embryogenis abundant protein 2 1.26e-01 2.02e-02 NA
2. P Q9LZP9 Calvin cycle protein CP12-2, chloroplastic 1.22e-01 1.68e-03 NA
2. P Q9XF14 Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic 1.59e-01 3.41e-02 NA
2. P Q38853 Rhodanese-like domain-containing protein 15, chloroplastic 5.42e-02 5.84e-06 NA
2. P P00842 ATP synthase subunit 9, mitochondrial 3.59e-02 1.18e-02 NA
2. P Q41351 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.31e-01 7.61e-03 NA
2. P Q9LLC6 Cytochrome b6-f complex subunit petO, chloroplastic 5.72e-02 2.46e-02 NA
2. P Q6RUT7 Protein CCSMST1 2.02e-01 3.01e-02 NA
2. P Q0MQJ2 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 2.69e-01 2.71e-03 NA
2. P Q94KR9 Translation initiation factor IF-1, chloroplastic 5.83e-01 2.39e-02 NA
2. P Q9Y3D5 28S ribosomal protein S18c, mitochondrial 1.03e-01 3.67e-03 NA
2. P Q09774 ATP synthase subunit g, mitochondrial 2.42e-01 1.17e-02 NA
2. P B0VYY4 Cytochrome c oxidase subunit 5A, mitochondrial 1.41e-01 4.31e-03 NA
2. P P46485 Glycine cleavage system H protein, mitochondrial 2.11e-01 3.10e-02 NA
2. P Q9XFT3 Oxygen-evolving enhancer protein 3-1, chloroplastic 1.26e-02 9.85e-03 NA
2. P P32876 ATP synthase F(0) complex subunit C1, mitochondrial 7.85e-02 8.57e-04 NA
2. P Q8GWS0 Glutaredoxin-C5, chloroplastic 1.13e-01 2.38e-05 NA
2. P Q17424 Probable thioredoxin-2 8.06e-02 9.15e-03 NA
2. P Q9UTF6 Cytochrome c oxidase subunit 6, mitochondrial 7.12e-03 1.60e-03 NA
2. P Q3ZC75 ATP synthase F(0) complex subunit C3, mitochondrial 1.67e-02 1.24e-03 NA
2. P B0VYX2 Cytochrome c oxidase subunit 5A, mitochondrial NA 2.78e-04 NA
2. P B0VYX5 Cytochrome c oxidase subunit 5A, mitochondrial 1.62e-02 7.47e-04 NA
2. P P0DKI1 Succinate dehydrogenase subunit 3-2, mitochondrial 8.18e-02 5.74e-05 NA
2. P Q84Y95 Monothiol glutaredoxin-S14, chloroplastic 2.57e-02 1.37e-02 NA
2. P Q17ED3 Essential MCU regulator, mitochondrial 6.24e-02 4.35e-03 NA
2. P Q0MQJ3 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 7.93e-02 1.18e-03 NA
2. P Q53CF8 Cytochrome c oxidase subunit 5A, mitochondrial 2.15e-02 1.24e-03 NA
2. P O94629 Stress-responsive protein 1 1.32e-01 1.45e-05 NA
2. P Q5RAP9 ATP synthase F(0) complex subunit C2, mitochondrial 1.88e-02 1.81e-02 NA
2. P Q8HXG5 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 7.97e-02 5.87e-03 NA
2. P P00221 Ferredoxin-1, chloroplastic 4.39e-01 1.25e-03 NA
2. P Q9D113 DNL-type zinc finger protein 2.32e-01 8.91e-04 NA
2. P G4NFB7 Thioredoxin-2 5.22e-02 1.02e-03 NA
2. P P04714 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 1.39e-01 3.28e-03 NA
2. P P0CAN9 Uncharacterized protein PB1A10.16, mitochondrial 1.05e-01 3.38e-02 NA
2. P P16032 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 1.84e-01 2.09e-03 NA
2. P Q9SJU8 30S ribosomal protein S31, mitochondrial 6.44e-01 6.62e-03 NA
2. P Q5S3G4 Cytochrome c oxidase subunit 5B, mitochondrial 2.35e-01 2.57e-02 NA
2. P O35796 Complement component 1 Q subcomponent-binding protein, mitochondrial 2.58e-01 4.23e-05 NA
2. P Q9CQH3 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 3.23e-01 2.35e-03 NA
2. P F1SZ41 Protein FERTILITY RESTORER RF2, mitochondrial 2.87e-02 6.25e-04 NA
2. P Q851Y7 Monothiol glutaredoxin-S7, chloroplastic 5.27e-02 5.49e-04 NA
2. P O04166 Ferredoxin, chloroplastic 4.05e-01 1.40e-03 NA
2. P Q9D0B5 Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 6.79e-02 3.50e-02 NA
2. P Q08223 Altered inheritance of mitochondria protein 39, mitochondrial 4.68e-01 1.06e-02 NA
2. P P56384 ATP synthase F(0) complex subunit C3, mitochondrial 2.02e-01 2.79e-05 NA
2. P B8NHF2 Required for respiratory growth protein 9, mitochondrial 9.74e-02 1.76e-02 NA
2. P P56181 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 9.89e-02 2.71e-03 NA
2. P Q0MQD6 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 3.52e-01 9.15e-03 NA
2. P Q0IH40 DNL-type zinc finger protein 1.37e-01 3.63e-08 NA
2. P Q4ICM9 Presequence translocated-associated motor subunit PAM17, mitochondrial 2.59e-02 6.75e-03 NA
2. P Q2TBI6 39S ribosomal protein L32, mitochondrial 6.66e-01 1.40e-04 NA
2. P B0VYX3 Cytochrome c oxidase subunit 5A, mitochondrial 1.78e-02 3.68e-04 NA
2. P P05349 Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 1.42e-01 2.64e-02 NA
2. P P14277 Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) NA 2.78e-02 NA
2. P Q7JZM8 39S ribosomal protein L41, mitochondrial 8.38e-01 9.24e-03 NA
2. P Q0VG49 Uncharacterized protein C15orf61 homolog 5.76e-01 2.31e-04 NA
2. P P41347 Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic 4.83e-02 2.05e-05 NA
2. P Q9SPI9 Photosystem II reaction center W protein, chloroplastic 2.90e-01 5.89e-04 NA
2. P B6UFC7 Protein PLASTID REDOX INSENSITIVE 2, chloroplastic 2.04e-02 1.23e-03 NA
2. P Q9M9H3 Embryogenesis-like protein 8.19e-03 1.03e-08 NA
2. P Q6H611 Succinate dehydrogenase subunit 7, mitochondrial 1.39e-01 4.78e-03 NA
2. P Q5TC12 ATP synthase mitochondrial F1 complex assembly factor 1 5.08e-01 1.16e-04 NA
2. P Q9SBM8 Cytochrome b6-f complex subunit 8, chloroplastic 4.74e-02 3.83e-02 NA
2. P Q86TS9 39S ribosomal protein L52, mitochondrial 2.29e-01 3.69e-02 NA
2. P Q01359 Cytochrome c oxidase subunit 6, mitochondrial 3.99e-03 3.47e-03 NA
2. P P14276 Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) NA 3.66e-02 NA
2. P C8VTR5 Presequence translocated-associated motor subunit pam17, mitochondrial 4.69e-02 7.75e-03 NA
2. P Q0MQJ0 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 1.50e-01 3.87e-04 NA
2. P Q9M7I9 Stress enhanced protein 1, chloroplastic 4.89e-03 3.34e-03 NA
2. P Q9D8B6 Protein FAM210B, mitochondrial 3.39e-02 7.32e-04 NA
2. P Q9D6U8 Protein FAM162A 3.70e-01 1.76e-02 NA
2. P Q95283 Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Fragment) NA 7.15e-05 NA
2. P Q942X4 Succinate dehydrogenase subunit 4, mitochondrial 4.29e-02 1.11e-04 NA
2. P Q84RQ7 NifU-like protein 3, chloroplastic 7.57e-02 2.35e-02 NA
2. P Q8LD49 Thioredoxin X, chloroplastic 4.44e-02 3.63e-02 NA
2. P Q28GD1 39S ribosomal protein L51, mitochondrial 3.85e-01 7.47e-04 NA
2. P Q9SX68 50S ribosomal protein L18, chloroplastic 5.14e-01 7.00e-03 NA
2. P Q0J8M2 Ferredoxin-1, chloroplastic 1.61e-01 7.32e-04 NA
2. P Q43517 Ferredoxin-1, chloroplastic 3.20e-01 1.93e-04 NA
2. P P83646 Oxygen-evolving enhancer protein 3, chloroplastic 3.84e-02 4.46e-04 NA
2. P P0CQ48 54S ribosomal protein L27, mitochondrial 7.14e-01 3.07e-03 NA
2. P P48201 ATP synthase F(0) complex subunit C3, mitochondrial 4.71e-02 3.30e-04 NA
2. P Q5ZKG1 39S ribosomal protein L51, mitochondrial 4.18e-02 3.89e-03 NA
2. P P26573 Ribulose bisphosphate carboxylase small subunit, chloroplastic 3.52e-01 1.40e-03 NA
2. P P18960 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.49e-01 3.24e-02 NA
2. P Q8W0Y8 Photosystem II reaction center PSB28 protein, chloroplastic 2.45e-01 2.05e-03 NA
2. P Q811I0 ATP synthase mitochondrial F1 complex assembly factor 1 2.76e-01 1.12e-03 NA
2. P P08706 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 1.28e-01 2.25e-02 NA
2. P Q28ED6 Essential MCU regulator, mitochondrial 1.55e-01 7.22e-05 NA
2. P Q7QHP6 Essential MCU regulator, mitochondrial 1.91e-01 1.11e-02 NA
2. P P27789 Ferredoxin-5, chloroplastic 1.64e-01 7.00e-03 NA
2. P C0SC25 Required for respiratory growth protein 9, mitochondrial 3.68e-01 2.02e-02 NA
2. P Q04450 Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 1.71e-01 3.10e-02 NA
2. P Q99N92 39S ribosomal protein L27, mitochondrial 2.93e-01 1.20e-03 NA
2. P P32764 Ribulose bisphosphate carboxylase small subunit, chloroplastic 6 1.42e-01 2.11e-03 NA
2. P P18859 ATP synthase-coupling factor 6, mitochondrial 1.89e-01 1.05e-04 NA
2. P P37293 Putative N-terminal acetyltransferase 2 1.20e-01 2.51e-03 NA
2. P Q84LK7 NifU-like protein 1, chloroplastic 7.56e-02 3.60e-02 NA
2. P Q8CEI1 BolA-like protein 3 2.86e-02 2.92e-03 NA
2. P O43674 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 2.49e-01 1.81e-02 NA
2. P Q42496 Cytochrome b6-f complex subunit 7, chloroplastic 3.97e-02 1.63e-03 NA
2. P Q9ZQG8 Ferredoxin-3, chloroplastic 4.32e-01 2.48e-04 NA
2. P Q5VUE5 Uncharacterized protein C1orf53 2.70e-02 1.77e-10 NA
2. P Q0MQD8 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 6.18e-01 1.81e-02 NA
2. P P05496 ATP synthase F(0) complex subunit C1, mitochondrial 2.85e-02 1.06e-03 NA
2. P Q9NX14 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 4.80e-02 1.02e-02 NA
2. P B0VYX6 Cytochrome c oxidase subunit 5A, mitochondrial 1.05e-01 8.32e-04 NA
2. P Q9C4Z7 Cell division topological specificity factor homolog, chloroplastic 2.15e-01 1.65e-03 NA
2. P B0VYY0 Cytochrome c oxidase subunit 5A, mitochondrial 1.99e-02 1.64e-04 NA
2. P C5GEF3 Required for respiratory growth protein 9, mitochondrial 7.80e-02 3.35e-02 NA
2. P P46522 Late embryogenesis abundant protein Lea5-D 1.54e-01 5.41e-06 NA
2. P B3LJ06 Altered inheritance of mitochondria protein 39, mitochondrial 3.49e-01 1.27e-02 NA
2. P Q9Y6G3 39S ribosomal protein L42, mitochondrial 3.82e-01 1.92e-05 NA
2. P Q9SX22 30S ribosomal protein 3-1, chloroplastic 1.38e-02 1.07e-06 NA
2. P Q06645 ATP synthase F(0) complex subunit C1, mitochondrial 9.21e-02 2.20e-04 NA
2. P Q5R9K2 Cytochrome c oxidase subunit 7B, mitochondrial 2.84e-01 3.21e-02 NA
2. P Q6FW26 Mitochondrial intermembrane space import and assembly protein 40 6.94e-02 3.04e-03 NA
2. P Q3T0B6 Complement component 1 Q subcomponent-binding protein, mitochondrial 2.60e-01 1.32e-03 NA
2. P Q0JQ97 Monothiol glutaredoxin-S1, mitochondrial 3.14e-01 5.81e-03 NA
2. P P87133 Meiotically up-regulated gene 143 protein 3.08e-02 1.06e-05 NA
2. P Q4U2R6 39S ribosomal protein L51, mitochondrial 2.52e-01 9.24e-03 NA
2. P O24143 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial 5.32e-01 2.81e-04 NA
2. P B0VYY3 Cytochrome c oxidase subunit 5A, mitochondrial 1.74e-02 1.22e-03 NA
2. P P20674 Cytochrome c oxidase subunit 5A, mitochondrial 1.86e-02 1.14e-03 NA
2. P P25348 54S ribosomal protein L32, mitochondrial 1.21e-01 8.90e-05 NA
2. P Q9ZT05 Photosystem I reaction center subunit psaK, chloroplastic 3.26e-01 1.89e-04 NA
2. P A1L1P7 DNL-type zinc finger protein 2.87e-01 3.97e-05 NA
2. P O80813 Ycf20-like protein 6.08e-02 4.10e-02 NA
2. P B0VYY5 Cytochrome c oxidase subunit 5A, mitochondrial NA 1.40e-03 NA
2. P Q6P4F2 Ferredoxin-2, mitochondrial 7.00e-01 1.13e-02 NA
2. P P46521 Late embryogenesis abundant protein Lea5-A 2.94e-01 7.38e-05 NA
2. P Q8BTE0 Succinate dehydrogenase assembly factor 4, mitochondrial 1.13e-01 7.53e-05 NA
2. P Q5XG64 Essential MCU regulator, mitochondrial 1.03e-01 1.36e-05 NA
2. P P02721 ATP synthase-coupling factor 6, mitochondrial 1.53e-01 8.10e-05 NA
2. P Q41048 Oxygen-evolving enhancer protein 3-1, chloroplastic 2.53e-02 4.39e-03 NA
2. P P80269 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial 9.00e-01 3.54e-03 NA
2. P O35943 Frataxin, mitochondrial 2.73e-01 1.28e-02 NA
2. P Q9BKS0 ATP synthase lipid-binding protein, mitochondrial 1.07e-01 1.86e-02 NA
2. P Q32PC3 39S ribosomal protein L27, mitochondrial 3.71e-01 3.86e-02 NA
2. P P19308 Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 1.13e-01 1.46e-02 NA
2. P Q0J3L4 Monothiol glutaredoxin-S10 6.40e-02 4.80e-05 NA
2. P A2YQD9 Ferredoxin-1, chloroplastic 2.29e-01 7.32e-04 NA
2. P Q0MQC8 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 4.93e-01 1.11e-03 NA
2. P Q53CG1 Cytochrome c oxidase subunit 5A, mitochondrial NA 5.05e-03 NA
2. P A1XQS5 ATP synthase F(0) complex subunit C1, mitochondrial 7.31e-02 3.91e-04 NA
2. P O04090 Ferredoxin-1, chloroplastic 1.26e-01 2.39e-04 NA
2. P Q71S46 ATP synthase F(0) complex subunit C3, mitochondrial 5.66e-02 3.30e-04 NA
2. P P10798 Ribulose bisphosphate carboxylase small subunit 3B, chloroplastic 1.34e-01 6.15e-03 NA
2. P Q8S091 Thioredoxin F, chloroplastic 1.58e-02 3.96e-02 NA
2. P P25712 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 8.71e-02 2.86e-04 NA
2. P Q5ZEG0 Protein MAO HUZI 4, chloroplastic 2.28e-02 7.61e-05 NA
2. P B0VYY2 Cytochrome c oxidase subunit 5A, mitochondrial 2.64e-02 1.63e-03 NA
2. P Q6YFE4 Monothiol glutaredoxin-5, mitochondrial 2.78e-01 3.15e-02 NA
2. P Q1L987 ATP synthase mitochondrial F1 complex assembly factor 1 5.38e-01 2.16e-03 NA
2. P Q9I8U0 Cytochrome c oxidase subunit 4 isoform 1, mitochondrial 2.95e-01 8.19e-03 NA
2. P O64764 Thioredoxin O1, mitochondrial 3.81e-02 4.68e-02 NA
2. P Q5UR00 Uncharacterized protein L908 NA 3.39e-06 NA
2. P P24483 Adrenodoxin, mitochondrial 2.15e-01 4.37e-04 NA
2. P P87127 Protein atp11, mitochondrial 8.03e-01 2.25e-02 NA
2. P Q61Z75 Probable NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 6.49e-01 1.12e-03 NA
2. P Q9BYC8 39S ribosomal protein L32, mitochondrial 6.31e-01 1.92e-05 NA
2. P Q5M8Z2 Protein preY, mitochondrial 6.74e-01 1.05e-04 NA
2. P Q5RFL2 ATP synthase F(0) complex subunit C3, mitochondrial 3.34e-02 6.83e-04 NA
2. P Q0MQJ4 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial 4.10e-02 1.20e-02 NA
2. P Q3E870 Succinate dehydrogenase subunit 7B, mitochondrial 2.50e-01 1.22e-02 NA
2. P Q0MQC7 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 4.53e-01 1.58e-03 NA
2. P P26574 Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 1.29e-01 3.15e-02 NA
2. P A8NN94 39S ribosomal protein L34, mitochondrial 7.48e-02 4.72e-02 NA
2. P A6ZNF7 Altered inheritance of mitochondria protein 39, mitochondrial 2.54e-01 1.47e-02 NA
2. P Q06646 ATP synthase F(0) complex subunit C2, mitochondrial 3.15e-02 3.96e-03 NA
2. P Q20412 Probable NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 1.36e-01 3.18e-02 NA
2. P Q39644 Late embryogenesis abundant protein Lea5 1.22e-01 1.58e-05 NA
2. P Q7S3S2 Mitochondrial intermembrane space import and assembly protein 40 1.73e-01 4.11e-04 NA
2. P C7GK20 Altered inheritance of mitochondria protein 39, mitochondrial 2.57e-01 1.16e-02 NA
2. P P12301 Oxygen-evolving enhancer protein 3, chloroplastic 5.11e-02 3.32e-02 NA
2. P P97615 Thioredoxin, mitochondrial 2.44e-01 1.85e-06 NA
2. P Q8JZS9 39S ribosomal protein L48, mitochondrial 2.71e-01 7.40e-03 NA
2. P Q9CX19 Protein FAM162B 3.45e-02 2.35e-03 NA
2. P P21571 ATP synthase-coupling factor 6, mitochondrial 1.45e-01 9.27e-06 NA
2. P Q09759 Uncharacterized protein C24H6.02c 8.11e-01 3.80e-05 NA
2. P Q6H7E4 Thioredoxin M1, chloroplastic 5.03e-02 6.75e-03 NA
2. P P46486 Photosystem I reaction center subunit III, chloroplastic 1.41e-01 4.60e-05 NA
2. P Q291A0 39S ribosomal protein L41, mitochondrial 7.82e-01 1.60e-03 NA
2. P P19312 Ribulose bisphosphate carboxylase small subunit, chloroplastic 6 1.81e-01 4.48e-02 NA
2. P Q9S7N7 Photosystem I reaction center subunit V, chloroplastic 7.59e-02 7.68e-03 NA
2. P P38231 Protein FMP23, mitochondrial 9.61e-02 2.95e-03 NA
2. P A2YLX7 Protein LHCP TRANSLOCATION DEFECT 5.65e-02 1.69e-04 NA
2. P Q12349 ATP synthase subunit H, mitochondrial 2.18e-01 3.99e-04 NA
2. P Q9VLJ9 39S ribosomal protein L51, mitochondrial 2.35e-01 4.18e-02 NA
2. P Q0MQJ1 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 6.96e-02 2.56e-03 NA
2. P Q8SPH6 ATP synthase-coupling factor 6, mitochondrial 1.68e-01 5.62e-05 NA
2. P A8XDX2 ATP synthase lipid-binding protein, mitochondrial 1.16e-01 1.86e-02 NA
2. P P16136 Ribulose bisphosphate carboxylase small subunit, chloroplastic 3 2.49e-01 1.50e-02 NA
2. P B0VYX4 Cytochrome c oxidase subunit 5A, mitochondrial 1.64e-02 5.55e-04 NA
2. P Q96542 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.52e-01 3.81e-03 NA
2. P P19955 37S ribosomal protein YMR-31, mitochondrial 7.54e-01 1.07e-03 NA
2. P P0CM69 Mitochondrial intermembrane space import and assembly protein 40 3.92e-02 2.14e-05 NA
2. P Q9XIK0 Protein PLASTID REDOX INSENSITIVE 2, chloroplastic 1.14e-02 1.00e-03 NA
2. P Q24407 ATP synthase-coupling factor 6, mitochondrial 1.96e-01 7.68e-03 NA
2. P Q9Y7U8 54S ribosomal protein L37, mitochondrial 5.45e-02 3.71e-03 NA
2. P Q54C45 Frataxin, mitochondrial 7.94e-02 4.25e-02 NA
2. P P27787 Ferredoxin-1, chloroplastic 3.15e-01 5.16e-05 NA
2. P P42844 Mitochondrial protein import protein ZIM17 1.67e-01 2.76e-05 NA
2. P P36046 Mitochondrial intermembrane space import and assembly protein 40 2.53e-01 1.73e-02 NA
2. P Q9LU21 Photosynthetic NDH subunit of subcomplex B 3, chloroplastic 6.80e-01 1.38e-03 NA
2. P Q0E3V2 Protein YELLOW LEAF 1, choloroplastic 1.58e-01 3.60e-02 NA
2. P A0A0S4IJL0 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.39e-01 9.85e-03 NA
2. P P00257 Adrenodoxin, mitochondrial 1.30e-01 2.19e-02 NA
2. P Q5VUM1 Succinate dehydrogenase assembly factor 4, mitochondrial 9.30e-02 3.76e-02 NA
2. P Q5RBH2 Diablo homolog, mitochondrial 9.47e-02 6.56e-03 NA
2. P Q02380 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 5.99e-01 2.28e-03 NA
2. P Q42823 Ribulose bisphosphate carboxylase small subunit, chloroplastic 1.01e-01 4.48e-02 NA
2. P Q96I23 Protein preY, mitochondrial 2.82e-01 6.26e-03 NA
2. P Q5TKD8 Thioredoxin-like 2, chloroplastic 2.11e-02 2.82e-03 NA
2. P P17605 ATP synthase F(0) complex subunit C1, mitochondrial 4.01e-02 1.60e-03 NA
2. P Q9LFV0 30S ribosomal protein 3-2, chloroplastic 2.67e-02 2.96e-07 NA
2. P Q6P161 39S ribosomal protein L54, mitochondrial 1.91e-01 1.48e-04 NA
2. P Q4QQV3 Protein FAM162A 1.01e-01 2.69e-02 NA
2. P Q4P8D2 Mitochondrial intermembrane space import and assembly protein 40 2.26e-01 1.64e-07 NA
2. P Q7SEE1 Presequence translocated-associated motor subunit pam17, mitochondrial 2.98e-01 2.86e-04 NA
2. P B0VYX7 Cytochrome c oxidase subunit 5A, mitochondrial 2.21e-02 6.37e-04 NA
2. P O22591 Oxygen-evolving enhancer protein 3, chloroplastic 4.29e-02 1.46e-02 NA
2. P Q5ZBY9 Photosystem II reaction center W protein, chloroplastic 5.16e-01 1.42e-03 NA
2. P E9QBI7 Metalloendopeptidase OMA1, mitochondrial 4.52e-01 3.83e-02 NA
2. P Q99757 Thioredoxin, mitochondrial 2.84e-01 1.96e-07 NA
2. P Q8LBK6 Monothiol glutaredoxin-S15, mitochondrial 8.40e-02 1.26e-02 NA
2. P Q9U616 Glycine cleavage system H protein, mitochondrial 3.02e-01 6.25e-04 NA
2. P F4JV80 Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial 1.25e-01 3.62e-07 NA
2. P Q9LF68 Protein BOLA4, chloroplastic/mitochondrial 5.00e-02 1.64e-04 NA
2. P Q5T6X4 Protein FAM162B 3.14e-02 7.53e-06 NA
2. P O23344 Ferredoxin C 1, chloroplastic 1.45e-01 6.32e-03 NA
2. P Q9SUI5 Photosystem I reaction center subunit psaK, chloroplastic 3.06e-01 2.04e-02 NA
2. P P27626 Senescence-associated protein DIN1 7.11e-02 2.05e-05 NA
2. P Q9XI73 Photosynthetic NDH subunit of lumenal location 2, chloroplastic 2.62e-02 8.08e-04 NA
2. P Q2M2S2 Essential MCU regulator, mitochondrial 7.67e-02 2.82e-05 NA
2. P Q39084 Late embryogenis abundant protein 41 1.27e-01 2.98e-05 NA
2. P Q54P40 Iron-sulfur cluster assembly 2 homolog, mitochondrial 2.40e-01 1.73e-02 NA
2. P A6ZSH0 Mitochondrial protein import protein ZIM17 8.51e-02 2.76e-05 NA
2. P P80971 Cytochrome c oxidase subunit 4 isoform 2, mitochondrial 4.49e-02 4.03e-03 NA
2. P O80429 Ferredoxin-2, chloroplastic 2.08e-01 1.53e-05 NA
2. P Q39194 Photosystem II reaction center W protein, chloroplastic 1.79e-01 7.47e-04 NA
2. P A6NNL5 Uncharacterized protein C15orf61 5.79e-01 1.74e-03 NA
2. P P97450 ATP synthase-coupling factor 6, mitochondrial 1.45e-01 1.01e-04 NA
2. P O35658 Complement component 1 Q subcomponent-binding protein, mitochondrial 2.52e-01 1.29e-04 NA
2. P P00426 Cytochrome c oxidase subunit 5A, mitochondrial 2.13e-02 4.56e-03 NA
2. P P0C2B7 39S ribosomal protein L52, mitochondrial 1.73e-01 1.23e-02 NA
2. P Q8LBS4 Monothiol glutaredoxin-S12, chloroplastic 1.42e-01 3.33e-04 NA
2. P Q7Z7F7 39S ribosomal protein L55, mitochondrial 1.41e-01 3.69e-02 NA
2. P B0VYX8 Cytochrome c oxidase subunit 5A, mitochondrial 1.47e-02 1.21e-03 NA
2. P Q0JM76 Monothiol glutaredoxin-S4, mitochondrial 2.45e-01 2.74e-03 NA
2. P B0VYX1 Cytochrome c oxidase subunit 5A, mitochondrial 1.65e-02 4.83e-04 NA
2. P O82230 Nucleoid-associated protein At2g24020, chloroplastic 4.55e-02 1.46e-02 NA
2. P D3ZS74 Metalloendopeptidase OMA1, mitochondrial 3.58e-01 3.21e-02 NA
2. P Q5RBY3 ATP synthase-coupling factor 6, mitochondrial 8.95e-02 1.54e-03 NA
2. P Q4R4E0 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial 1.44e-01 1.64e-02 NA
2. P P82162 30S ribosomal protein S10 alpha, chloroplastic 7.44e-02 2.88e-02 NA
2. P Q9SWI6 50S ribosomal protein L29, chloroplastic 9.48e-03 1.60e-06 NA
2. P O95178 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 9.10e-01 2.79e-05 NA
2. P Q08C57 Ferredoxin-2, mitochondrial 1.77e-01 5.44e-04 NA
2. P P10109 Adrenodoxin, mitochondrial 2.98e-01 9.79e-06 NA
2. P P83565 39S ribosomal protein L40, mitochondrial 1.94e-01 1.28e-02 NA
2. P O43045 Iron-sulfur assembly protein 2 5.95e-01 5.33e-04 NA
2. P P16137 Ribulose bisphosphate carboxylase small subunit, chloroplastic 4 8.17e-02 2.27e-02 NA
2. P Q9DCI9 39S ribosomal protein L32, mitochondrial 7.93e-01 7.39e-04 NA
2. P Q2UF33 Required for respiratory growth protein 9, mitochondrial 6.66e-02 1.76e-02 NA
2. P Q05B51 Ferredoxin-2, mitochondrial 6.14e-01 1.70e-02 NA
2. P A8JGV8 ATP-dependent Clp protease adapter protein CLPS2, chloroplastic 7.14e-02 4.07e-02 NA
2. P Q9CPW3 39S ribosomal protein L54, mitochondrial 2.22e-01 6.19e-04 NA
2. P Q9M812 Protein CURVATURE THYLAKOID 1C, chloroplastic 1.51e-02 8.45e-05 NA
3. B Q02873 UPF0651 protein YPL107W, mitochondrial 3.52e-02 NA 5.11e-04
3. B Q9USH2 UPF0651 protein P31B10.02, mitochondrial 5.97e-02 NA 2.30e-04