Summary

Q5BKX5

Homolog: Q8BZI6.
Function: Protein GUCD1.

Statistics

Total GO Annotation: 64
Unique PROST Go: 58
Unique BLAST Go: 6

Total Homologs: 95
Unique PROST Homologs: 88
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q8BZI6 (Protein GUCD1) with a FATCAT P-Value: 5.58e-07 and RMSD of 3.03 angstrom. The sequence alignment identity is 16.7%.
Structural alignment shown in left. Query protein Q5BKX5 colored as red in alignment, homolog Q8BZI6 colored as blue. Query protein Q5BKX5 is also shown in right top, homolog Q8BZI6 showed in right bottom. They are colored based on secondary structures. 

  Q5BKX5 MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQTPVPPPLPLPPPPAATGPAPRH-VFGLEKSQ-LLKEAFDKAGPVPKGR-ED 97
  Q8BZI6 ---------------MRTEAEAAGQ----PLEPG--DFVQLP-------VPIIQQL-------------YHWDCGLACSRMVLR--Y--LGQLDDGEFEN 55

  Q5BKX5 VKRLLKLHKDRFRGDLRWILFCADLPSLIQEGPQCGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQG---EMFSVAD--MGRLAQEVLGCQAKL-- 190
  Q8BZI6 ALQELQLTR-----SI-WTI---DLAYLMR---HFGVRHRFCTQTL-----GV----------DKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEK 128

  Q5BKX5 --LSGGLGGPNRDLVLQHLVTGH--PLLIP---YDEDFNHEP---C--QRKGHKAHWAVS---AGVLLGVRAVPSLGYTEDPELPG-LFH--PVLG-TPC 271
  Q8BZI6 CTVS--V----QDIQV-HLAQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRC-FCRTPDYQGHFIVLR-----GYN---RATGCIFYNNPAYADRMC 212

  Q5BKX5 QPPSLP--EEG--SPGA------VYLLSKQGKSWHYQLWDYDQVRESNLQLTDFSPSRATDGRVYVVPVGGVRAGLCGQALLLTPQDCSH 351
  Q8BZI6 S-TSISNFEEARTSYGTDEDILFVYLDS-------------------------------------------------------------- 239

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0055001 muscle cell development
2. P GO:0050905 neuromuscular process
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0070647 protein modification by small protein conjugation or removal
2. P GO:0044306 neuron projection terminus
2. P GO:0030430 host cell cytoplasm
2. P GO:0004383 guanylate cyclase activity
2. P GO:0034053 modulation by symbiont of host defense-related programmed cell death
2. P GO:0008283 cell population proliferation
2. P GO:0019896 axonal transport of mitochondrion
2. P GO:0004843 thiol-dependent deubiquitinase
2. P GO:0016579 protein deubiquitination
2. P GO:0006511 ubiquitin-dependent protein catabolic process
2. P GO:0006501 C-terminal protein lipidation
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0043130 ubiquitin binding
2. P GO:0044201 host cell nuclear inner membrane
2. P GO:0002931 response to ischemia
2. P GO:0035690
2. P GO:0051697 protein delipidation
2. P GO:0071944 cell periphery
2. P GO:0016874 ligase activity
2. P GO:0019233 sensory perception of pain
2. P GO:0016807 cysteine-type carboxypeptidase activity
2. P GO:0019079 viral genome replication
2. P GO:0016817 hydrolase activity, acting on acid anhydrides
2. P GO:0043025 neuronal cell body
2. P GO:1904115 axon cytoplasm
2. P GO:0007409 axonogenesis
2. P GO:0004197 cysteine-type endopeptidase activity
2. P GO:0036435 K48-linked polyubiquitin modification-dependent protein binding
2. P GO:0071796 K6-linked polyubiquitin modification-dependent protein binding
2. P GO:0008242 omega peptidase activity
2. P GO:0005829 cytosol
2. P GO:0015031 protein transport
2. P GO:0071795 K11-linked polyubiquitin modification-dependent protein binding
2. P GO:0042755 eating behavior
2. P GO:0008234 cysteine-type peptidase activity
2. P GO:0019786 Atg8-specific protease activity
2. P GO:0016790 thiolester hydrolase activity
2. P GO:0005634 nucleus
2. P GO:1990380 Lys48-specific deubiquitinase activity
2. P GO:0019082 viral protein processing
2. P GO:0019784 NEDD8-specific protease activity
2. P GO:0016604 nuclear body
2. P GO:0007412 axon target recognition
2. P GO:0071108 protein K48-linked deubiquitination
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0046765 viral budding from nuclear membrane
2. P GO:0007628 adult walking behavior
2. P GO:0016241 regulation of macroautophagy
2. P GO:0000338 protein deneddylation
2. P GO:0006182 cGMP biosynthetic process
2. P GO:0031694 alpha-2A adrenergic receptor binding
2. P GO:0006914 autophagy
2. P GO:0043407 negative regulation of MAP kinase activity
2. P GO:0071567 UFM1 hydrolase activity
2. P GO:0005654 nucleoplasm
3. B GO:0006357 regulation of transcription by RNA polymerase II
3. B GO:0003729 mRNA binding
3. B GO:0006397 mRNA processing
3. B GO:0032784 regulation of DNA-templated transcription, elongation
3. B GO:0006368 transcription elongation from RNA polymerase II promoter
3. B GO:0032044 DSIF complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB B0BM95 UPF0692 protein C19orf54 homolog 5.28e-14 1.49e-41 2.61e-99
1. PB Q9VCE8 UPF0692 protein CG33108 1.56e-08 9.44e-30 7.81e-17
1. PB Q5BKX5 UPF0692 protein C19orf54 0 6.44e-133 0.0
1. PB B0V3H4 UPF0692 protein C19orf54 homolog 8.22e-15 4.54e-31 3.97e-80
1. PB A6QQD2 UPF0692 protein C19orf54 homolog 0.00e+00 3.88e-80 0.0
2. P P9WM47 Uncharacterized protein Rv1268c 1.12e-05 5.73e-06 NA
2. P Q6LAD6 Cysteine protease avirulence protein AvrRpt2 8.92e-04 3.11e-02 NA
2. P Q7S3X7 Cysteine protease 1 1.22e-01 3.73e-04 NA
2. P P03538 Non-structural protein 2 NA 1.74e-02 NA
2. P A5DEF7 Probable cysteine protease ATG4 2.20e-02 2.46e-05 NA
2. P Q6PDI6 Ubiquitin carboxyl-terminal hydrolase MINDY-2 4.48e-01 6.43e-04 NA
2. P Q5R7G8 Ubiquitin carboxyl-terminal hydrolase MINDY-1 2.30e-01 1.51e-03 NA
2. P Q8Z550 Deubiquitinase SseL 4.47e-01 3.26e-03 NA
2. P Q6SEG5 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.04e-01 2.37e-02 NA
2. P Q8NBR6 Ubiquitin carboxyl-terminal hydrolase MINDY-2 5.38e-01 9.84e-04 NA
2. P O13979 Ubiquitin carboxyl-terminal hydrolase mug105 1.25e-03 2.09e-06 NA
2. P P0C9B9 Cysteine protease S273R NA 6.76e-03 NA
2. P Q8S929 Cysteine protease ATG4a 2.21e-01 1.10e-02 NA
2. P Q9DBJ6 Josephin-1 1.20e-01 7.00e-09 NA
2. P P14518 Stem bromelain 9.56e-04 1.57e-02 NA
2. P Q684M2 Cysteine protease ATG4D 5.74e-02 2.25e-03 NA
2. P Q86UB2 Basic immunoglobulin-like variable motif-containing protein 2.62e-02 1.58e-14 NA
2. P P0C2N1 Cysteine protease yopT1 1.17e-01 3.03e-02 NA
2. P Q89T99 Putative cysteine protease YopT-like blr2140 2.04e-01 6.11e-04 NA
2. P P09936 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.89e-01 3.93e-02 NA
2. P Q00946 Cysteine protease S273R NA 4.09e-03 NA
2. P Q52430 Cysteine protease avirulence protein AvrPphB 1.36e-01 4.83e-09 NA
2. P P64792 Uncharacterized protein Mb1299c 4.30e-04 5.73e-06 NA
2. P Q9U1N6 Cysteine protease atg-4.2 3.53e-01 4.80e-04 NA
2. P A6SDQ3 Probable cysteine protease atg4 7.92e-02 9.50e-03 NA
2. P Q8BZI6 Protein GUCD1 5.58e-07 6.38e-09 NA
2. P Q5BJQ2 Ubiquitin carboxyl-terminal hydrolase MINDY-1 4.51e-01 1.44e-06 NA
2. P Q8TAC2 Josephin-2 4.78e-02 3.64e-05 NA
2. P Q2KJ22 Ubiquitin carboxyl-terminal hydrolase MINDY-1 4.24e-01 1.77e-05 NA
2. P A9N5C6 Deubiquitinase SseL 4.79e-01 9.69e-03 NA
2. P Q4V6M7 Probable Ufm1-specific protease 1 6.22e-04 5.02e-05 NA
2. P Q96NT3 Protein GUCD1 7.76e-07 1.22e-09 NA
2. P Q0V9T8 Basic immunoglobulin-like variable motif-containing protein 1.64e-02 6.30e-12 NA
2. P P0A2N3 Virulence protein SpvD 1.87e-01 2.16e-06 NA
2. P Q9M1Y0 Cysteine protease ATG4b 3.93e-01 4.27e-02 NA
2. P Q2KI23 Ubiquitin carboxyl-terminal hydrolase MINDY-2 4.62e-01 8.97e-03 NA
2. P Q54150 Cysteine protease IpaJ 1.36e-01 1.48e-06 NA
2. P Q9F3T4 Probable cysteine protease avirulence protein AvrPpiC2 2.70e-01 3.04e-05 NA
2. P Q0U199 Probable cysteine protease ATG4 2.63e-01 1.05e-02 NA
2. P Q10171 Probable ubiquitin carboxyl-terminal hydrolase 1 5.32e-01 2.35e-02 NA
2. P O34735 Uncharacterized protein YvpB 8.88e-05 4.32e-04 NA
2. P B3SRS2 Non-structural protein 2 NA 4.08e-02 NA
2. P P55730 Putative cysteine protease YopT-like y4zC 6.08e-02 1.46e-02 NA
2. P P32668 Uncharacterized protein YijF 2.85e-01 5.67e-03 NA
2. P Q2HH40 Probable cysteine protease ATG4 1.31e-01 1.09e-03 NA
2. P Q60HC8 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.85e-01 2.92e-02 NA
2. P A0A098DRK7 Cysteine protease ATG4 6.38e-02 4.27e-04 NA
2. P Q03241 Non-structural protein 2 NA 3.86e-02 NA
2. P Q9CZP0 Ufm1-specific protease 1 2.81e-04 1.50e-04 NA
2. P A3DSK8 Non-structural protein 2 NA 1.82e-03 NA
2. P Q9R0P9 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.85e-01 3.72e-02 NA
2. P Q9AMW4 Putative cysteine protease YopT-like blr2058 2.24e-01 3.27e-10 NA
2. P Q93RN4 Cysteine protease YopT 2.85e-01 3.16e-03 NA
2. P P0A2N2 Virulence protein vsdE 1.82e-01 2.16e-06 NA
2. P A7F045 Probable cysteine protease atg4 4.76e-02 7.44e-04 NA
2. P Q3KPR5 Basic immunoglobulin-like variable motif-containing protein 7.73e-03 3.92e-16 NA
2. P Q8N5J2 Ubiquitin carboxyl-terminal hydrolase MINDY-1 2.11e-01 9.06e-04 NA
2. P Q86TL0 Cysteine protease ATG4D 4.15e-02 1.40e-02 NA
2. P P0C9B8 Cysteine protease S273R NA 7.17e-03 NA
2. P Q9W422 Josephin-like protein 5.82e-02 1.73e-09 NA
2. P A5DSB4 Probable cysteine protease ATG4 7.59e-02 1.89e-05 NA
2. P Q54T48 Probable ubiquitin carboxyl-terminal hydrolase 3.22e-01 6.37e-04 NA
2. P A1JU65 Cysteine protease yopT1 1.50e-01 6.31e-03 NA
2. P P0C9B7 Cysteine protease S273R NA 6.01e-03 NA
2. P Q9GM50 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.03e-01 1.48e-02 NA
2. P P9WM46 Uncharacterized protein MT1306 8.27e-06 5.73e-06 NA
2. P Q65228 Cysteine protease S273R NA 6.19e-03 NA
2. P Q4U3V5 Probable cysteine protease ATG4 3.97e-02 4.11e-02 NA
2. P Q76LS9 Ubiquitin carboxyl-terminal hydrolase MINDY-1 5.07e-01 8.51e-04 NA
2. P Q86ZL5 Probable cysteine protease ATG4 3.73e-02 1.63e-02 NA
2. P Q75E61 Probable cysteine protease ATG4 9.08e-02 1.08e-03 NA
2. P A3KQS4 Ubiquitin carboxyl-terminal hydrolase MINDY-1 2.63e-01 4.28e-06 NA
2. P Q03240 Non-structural protein 2 NA 1.14e-02 NA
2. P O68703 Cysteine protease YopT 2.32e-01 1.74e-03 NA
2. P Q9CR30 Josephin-2 5.27e-02 8.81e-05 NA
2. P Q5PI48 Deubiquitinase SseL 3.53e-01 4.39e-02 NA
2. P Q8IKM8 Ubiquitin carboxyl-terminal hydrolase UCHL3 5.10e-01 4.49e-05 NA
2. P P27475 Cysteine protease YopT 1.67e-01 1.79e-02 NA
2. P Q5EAE5 Josephin-1 8.70e-02 3.33e-08 NA
2. P Q6UDK0 Nuclear egress protein 1 NA 2.18e-03 NA
2. P Q8CBX9 Basic immunoglobulin-like variable motif-containing protein 2.16e-02 3.10e-10 NA
2. P Q5R739 Josephin-1 8.99e-02 1.25e-08 NA
2. P Q8L870 Guanylyl cyclase 1 2.17e-03 2.41e-15 NA
2. P Q15040 Josephin-1 1.15e-01 1.25e-08 NA
2. P Q59UG3 Cysteine protease ATG4 5.15e-02 6.07e-03 NA
2. P Q00981 Ubiquitin carboxyl-terminal hydrolase isozyme L1 3.85e-01 3.72e-02 NA
2. P Q5BJY4 Josephin-1 8.24e-02 7.28e-09 NA
2. P Q86505 Non-structural protein 2 NA 1.77e-02 NA
3. B P0CR70 Transcription elongation factor SPT5 7.92e-01 NA 0.034
3. B P0CR71 Transcription elongation factor SPT5 8.61e-01 NA 0.034