Results | PROST

Summary

Q5HY64

Homolog: P14708.
Function: Involucrin.

Statistics

Total GO Annotation: 178
Unique PROST Go: 147
Unique BLAST Go: 15

Total Homologs: 227
Unique PROST Homologs: 210
Unique BLAST Homologs: 11

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P14708 (Involucrin) with a FATCAT P-Value: 0.00022 and RMSD of 4.75 angstrom. The sequence alignment identity is 25.5%.
Structural alignment shown in left. Query protein Q5HY64 colored as red in alignment, homolog P14708 colored as blue. Query protein Q5HY64 is also shown in right top, homolog P14708 showed in right bottom. They are colored based on secondary structures.

  Q5HY64 MGDQRPQDRPSSPGMDS--T-PWYCDKPP-SKYFAKRKHRRLRFPPVDTQNWVFVTEGMDDFRYGCQSPEDTLV---CRRDEFLLPKISLRGPQADP-KS 92
  P14708 --------------MSQQHTLPVTLS-PALSQELLK----TVP-PPVNTQQ-----EQM-------KQP--TPLPPPCQK----VP-VEL--PVEVPSKQ 59

  Q5HY64 RKKKLLKKAALFSK-LSPAQPARKAFVEEVEAQLMTK-------HPLAMYP--NLGED-MPPDLLLQVLKPLDPERKLEDAGSCEGQE--KTTDEPTEPG 179
  P14708 EEKHM---TAV--KGL-PEQECEQQQQEPQEQELQQQHWEQHEEHQKAENPEQQLKQEKAQRDQQLN--EQLEEEKKLLDQ-RLD-QELVK-RDE--QLG 146

  Q5HY64 --KYPCGEFSPRPPETRVSCLPPEPPKTPVSSLRPEPPETG-VSHLRPQPPKTQVSSLHLEPPETGVSHLRPEPPKTQVSSL-HLEPPETG-VSHLYLEP 274
  P14708 MKKEQLLEL-PEQQEQHLKHL--EQQEGQL-EL-PEQQE-GQLKHLEQQ--EGQLK--HLEQQE-G--QL--EVPEEQVGQLKYLEQQE-GQLKHLD-QQ 229

  Q5HY64 PGTGVSHLCPEPPKTRVSHLHREPPETGVPDLCLEPPKSRVSHLRPEPSETG-VSHLHPEPPKTLVSSLHPEPPETG-VSHLCPEPPETRVSPLRQLPPE 372
  P14708 EGQ-LKHL--DQQEGQLKHLDQQ--E-G-----------QLKHL--DQQE-GQLKHLDQQEGQ-L--EL-PEQQE-GQLKHL-----EQQEGQLKHLEHE 299

  Q5HY64 AGVSHLCPEPPKTRVPPLRPETPKNGVSPL-FPEPPKTRISNL-RSEPPKIGVSHLCLEPPKTRG--SHLRPEPPETG-VSHLRPEPPKTRVSSLHLEPP 467
  P14708 EG--QL--------------EVPEEQVGQLKYLEQQEGQLKHLDQQE----G--QLEL-PEQQEGQLKHL--EQQE-GQLKHL--EHQKGQ-----LEVP 366

  Q5HY64 E--TG-VSHLCPEPPEKDVSHLRPEPPDT--GVSHLCPEPPKTRVSHLRPEPSETG-VSHLRPEPPKILVSSLHQAPPESSVSHLR-PEPPETG-VSHLR 559
  P14708 EEQVGQLKYL--EQQEGQLKHL-----DQQEGQLEL-PEQQEGQLKHL--EQQE-GQLKHLEHQEGQLEV-------PEEQVGQLKYLEQQE-GQLKHL- 446

  Q5HY64 PEPPKTRMYSLRPEPPDT--G-VSHLCPEPPKTRVSSLPPEPPETG-VSHLCPEPPETRVSHLRPEPPETGVSHLRPEPPKTRMYSLRPEPPNTG-VSHL 654
  P14708 ----------------DQQEGQLKHL--DQQEKQL-ELPEQ--QVGQLKHL--EQQEGQL-EV-PE-EQVG--QLK--------Y-LEQQE---GQLKHL 506

  Q5HY64 CPEPPKTRVSSLPPEPPETG-VSHLCPEPPETRVSHLRPEPPETGVSRLHPEPPKTRVSSL-HAEPPESRVSHLCPEPPETG-VSHL-----RPEPPKPR 746
  P14708 --DQQEGQL-EL-PEQQE-GQLKHL--EQQEGQLKHL--EHQE-G--QL--EVPEEQVGQLKYLEQQEGQLKHL--DQQE-GQLKHLDQQEKQLELPEQQ 589

  Q5HY64 VSSLRP-EPLETRVSHLRPEPPETG-VSHL-HPE----LPKPRVSSL-HLE----PPKTRRVSSLRLEPPKTGRVSSLCPEPTKTGASHLKELFQEGTSS 834
  P14708 VGQLKHLEQQEGQLEHL--EGQE-GQLEHLEHQEGQLGLPEQQVWQLKQLEKQEGQPK-------NLEEEE-GQLKHLVQQE---G--QLEQ--QEG--- 668

  Q5HY64 TMECVSDSL-QRRHTSRKLRDFKW----AGDLGVNEESISSLFDFTPECRATYQDQKNKKANECSSG-LKYSMELDEMDEVKFFSQEKDLDGKIQNAPNS 928
  P14708 QVEHLEEQVGQLKHLEEQEGQLKYLEQQQGQLEVPEQQVGQ-----P--KHLEQEEKQLELPEQQEGQLKH---LE-----K---QEAQLE-----LP-- 743

  Q5HY64 HSAQHVKMGYGAWYLKPKLGKKLRSDEPLIDPKLVLEKPDEPD--I--LDGLYGPIAFKDFILSKGY-EMPGIIQRLFA-RRGWTYD---SVKT------ 1013
  P14708 --EQQV--G------QP---KHLEQQE-----K-QLEHPEQKDGQLKHLEQQEGQL--KNLEQQKGQLEQP-----VFAPAPGQVQDIQPALPTKGEVLL 817

  Q5HY64 PI---QRAMQVY---KYKEDVTDASEED 1035
  P14708 PVEQQQQKQEVQWPPKHK---------- 835

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:1900006	positive regulation of dendrite development
1. PB	GO:0032880	regulation of protein localization
1. PB	GO:1905168	positive regulation of double-strand break repair via homologous recombination
1. PB	GO:0098631	cell adhesion mediator activity
1. PB	GO:2000781	positive regulation of double-strand break repair
1. PB	GO:0051656	establishment of organelle localization
1. PB	GO:0007094	mitotic spindle assembly checkpoint signaling
1. PB	GO:0090307	mitotic spindle assembly
1. PB	GO:0106333	subcortical maternal complex
1. PB	GO:0045179	apical cortex
1. PB	GO:0007155	cell adhesion
1. PB	GO:0050769	positive regulation of neurogenesis
1. PB	GO:0010339	external side of cell wall
1. PB	GO:0031297	replication fork processing
1. PB	GO:0040019	positive regulation of embryonic development
1. PB	GO:0031362	anchored component of external side of plasma membrane
2. P	GO:0044853	plasma membrane raft
2. P	GO:0001515	opioid peptide activity
2. P	GO:0032039	integrator complex
2. P	GO:0043710	cell adhesion involved in multi-species biofilm formation
2. P	GO:1903573	negative regulation of response to endoplasmic reticulum stress
2. P	GO:0030844	positive regulation of intermediate filament depolymerization
2. P	GO:0034472	snRNA 3'-end processing
2. P	GO:0045095	keratin filament
2. P	GO:0005796	Golgi lumen
2. P	GO:0030315	T-tubule
2. P	GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
2. P	GO:0090281	negative regulation of calcium ion import
2. P	GO:0000128	flocculation
2. P	GO:2000179	positive regulation of neural precursor cell proliferation
2. P	GO:1990441	negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
2. P	GO:0008366	axon ensheathment
2. P	GO:0007218	neuropeptide signaling pathway
2. P	GO:0032091	negative regulation of protein binding
2. P	GO:0010514	induction of conjugation with cellular fusion
2. P	GO:0000772	mating pheromone activity
2. P	GO:0031730	CCR5 chemokine receptor binding
2. P	GO:0005576	extracellular region
2. P	GO:0090240	positive regulation of histone H4 acetylation
2. P	GO:0035308	negative regulation of protein dephosphorylation
2. P	GO:0030448	hyphal growth
2. P	GO:0050902	leukocyte adhesive activation
2. P	GO:0090606	single-species surface biofilm formation
2. P	GO:0009986	cell surface
2. P	GO:0050900	leukocyte migration
2. P	GO:0031412	gas vesicle organization
2. P	GO:0046914	transition metal ion binding
2. P	GO:0097493	structural molecule activity conferring elasticity
2. P	GO:0001533	cornified envelope
2. P	GO:1901318	negative regulation of flagellated sperm motility
2. P	GO:0000182	rDNA binding
2. P	GO:0072089	stem cell proliferation
2. P	GO:0048388	endosomal lumen acidification
2. P	GO:0007420	brain development
2. P	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
2. P	GO:0034053	modulation by symbiont of host defense-related programmed cell death
2. P	GO:0070062	extracellular exosome
2. P	GO:0033629	negative regulation of cell adhesion mediated by integrin
2. P	GO:0010466	negative regulation of peptidase activity
2. P	GO:0030097	hemopoiesis
2. P	GO:0010944	negative regulation of transcription by competitive promoter binding
2. P	GO:0034109	homotypic cell-cell adhesion
2. P	GO:1903494	response to dehydroepiandrosterone
2. P	GO:0031386	protein tag
2. P	GO:0051451	myoblast migration
2. P	GO:0001042	RNA polymerase I core binding
2. P	GO:0039503	suppression by virus of host innate immune response
2. P	GO:0036457	keratohyalin granule
2. P	GO:0001520	outer dense fiber
2. P	GO:0006612	protein targeting to membrane
2. P	GO:0035036	sperm-egg recognition
2. P	GO:0032287	peripheral nervous system myelin maintenance
2. P	GO:1900005	positive regulation of serine-type endopeptidase activity
2. P	GO:0032184	SUMO polymer binding
2. P	GO:0005537	mannose binding
2. P	GO:0001931	uropod
2. P	GO:0031154	culmination involved in sorocarp development
2. P	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
2. P	GO:0007568	aging
2. P	GO:1902310	positive regulation of peptidyl-serine dephosphorylation
2. P	GO:1990393	3M complex
2. P	GO:0042628	mating plug formation
2. P	GO:0005176	ErbB-2 class receptor binding
2. P	GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
2. P	GO:0031142	induction of conjugation upon nitrogen starvation
2. P	GO:1903912	negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P	GO:1902168	response to catechin
2. P	GO:0030216	keratinocyte differentiation
2. P	GO:0005654	nucleoplasm
2. P	GO:0048858	cell projection morphogenesis
2. P	GO:0036349	galactose-specific flocculation
2. P	GO:0043709	cell adhesion involved in single-species biofilm formation
2. P	GO:0010847	regulation of chromatin assembly
2. P	GO:0033172	gas vesicle shell
2. P	GO:0062038	positive regulation of pheromone response MAPK cascade
2. P	GO:0043086	negative regulation of catalytic activity
2. P	GO:0042633	hair cycle
2. P	GO:0009279	cell outer membrane
2. P	GO:0030445	yeast-form cell wall
2. P	GO:0031589	cell-substrate adhesion
2. P	GO:0005854	nascent polypeptide-associated complex
2. P	GO:0097656	cell-cell self recognition
2. P	GO:0000086	G2/M transition of mitotic cell cycle
2. P	GO:0048012	hepatocyte growth factor receptor signaling pathway
2. P	GO:0071502	cellular response to temperature stimulus
2. P	GO:1901385	regulation of voltage-gated calcium channel activity
2. P	GO:0005634	nucleus
2. P	GO:0031012	extracellular matrix
2. P	GO:0009530	primary cell wall
2. P	GO:0030414	peptidase inhibitor activity
2. P	GO:0050817	coagulation
2. P	GO:1902465	negative regulation of histone H3-K27 trimethylation
2. P	GO:0031640	killing of cells of another organism
2. P	GO:0042311	vasodilation
2. P	GO:0044406	adhesion of symbiont to host
2. P	GO:1903917	positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation
2. P	GO:0009277	fungal-type cell wall
2. P	GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P	GO:0005199	structural constituent of cell wall
2. P	GO:0110044	regulation of cell cycle switching, mitotic to meiotic cell cycle
2. P	GO:0050825	ice binding
2. P	GO:0035686	sperm fibrous sheath
2. P	GO:0018149	peptide cross-linking
2. P	GO:0019215	intermediate filament binding
2. P	GO:0050901	leukocyte tethering or rolling
2. P	GO:0048730	epidermis morphogenesis
2. P	GO:0060388	vitelline envelope
2. P	GO:0005618	cell wall
2. P	GO:0033234	negative regulation of protein sumoylation
2. P	GO:0050839	cell adhesion molecule binding
2. P	GO:0042631	cellular response to water deprivation
2. P	GO:0070972	protein localization to endoplasmic reticulum
2. P	GO:0031424	keratinization
2. P	GO:0031225	anchored component of membrane
2. P	GO:0009664	plant-type cell wall organization
2. P	GO:1903496	response to 11-deoxycorticosterone
2. P	GO:0019725	cellular homeostasis
2. P	GO:0018153	isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P	GO:0020016	ciliary pocket
2. P	GO:0032005	signal transduction involved in positive regulation of conjugation with cellular fusion
2. P	GO:0042025	host cell nucleus
2. P	GO:0020003	symbiont-containing vacuole
2. P	GO:0005813	centrosome
2. P	GO:0052026	modulation by symbiont of host transcription
2. P	GO:0043484	regulation of RNA splicing
2. P	GO:0007088	regulation of mitotic nuclear division
2. P	GO:0098609	cell-cell adhesion
2. P	GO:0010224	response to UV-B
2. P	GO:0005882	intermediate filament
2. P	GO:0031982	vesicle
2. P	GO:0004791	thioredoxin-disulfide reductase activity
2. P	GO:0061187	regulation of ribosomal DNA heterochromatin assembly
2. P	GO:0030197	extracellular matrix constituent, lubricant activity
2. P	GO:0036496	regulation of translational initiation by eIF2 alpha dephosphorylation
2. P	GO:0008093	cytoskeletal anchor activity
2. P	GO:0060734	regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P	GO:0005577	fibrinogen complex
2. P	GO:0036003	positive regulation of transcription from RNA polymerase II promoter in response to stress
2. P	GO:0005938	cell cortex
2. P	GO:0009877	nodulation
2. P	GO:0030017	sarcomere
2. P	GO:0031076	embryonic camera-type eye development
2. P	GO:0060491	regulation of cell projection assembly
3. B	GO:0005509	calcium ion binding
3. B	GO:0052795	exo-alpha-(2->6)-sialidase activity
3. B	GO:0008152	metabolic process
3. B	GO:0008047	enzyme activator activity
3. B	GO:0007015	actin filament organization
3. B	GO:0052794	exo-alpha-(2->3)-sialidase activity
3. B	GO:0061827	sperm head
3. B	GO:0052796	exo-alpha-(2->8)-sialidase activity
3. B	GO:0097225	sperm midpiece
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0071168	protein localization to chromatin
3. B	GO:0030177	positive regulation of Wnt signaling pathway
3. B	GO:0034401	obsolete chromatin organization involved in regulation of transcription
3. B	GO:0031062	positive regulation of histone methylation
3. B	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8NA70	Protein FAM47B	6.73e-02	4.10e-18	0.0
1. PB	Q9D9R9	Protein FAM186A	5.33e-02	1.12e-12	0.001
1. PB	Q5JRC9	Protein FAM47A	1.35e-01	3.12e-24	0.0
1. PB	Q96WV6	Uncharacterized threonine-rich GPI-anchored glycoprotein PJ4664.02	NA	2.94e-08	9.40e-10
1. PB	D3ZVV1	KH domain-containing protein 3	1.81e-02	1.06e-03	0.003
1. PB	Q5HY64	Putative protein FAM47C	0	1.11e-172	0.0
2. P	Q8WR62	Vitelline envelope sperm lysin receptor	NA	3.19e-08	NA
2. P	P24710	Involucrin	7.88e-01	4.65e-07	NA
2. P	Q9D226	Keratin-associated protein 5-3	6.02e-01	4.89e-02	NA
2. P	P08297	Early nodulin-75	8.63e-01	1.33e-04	NA
2. P	A0A1D8PQ86	Agglutinin-like protein 9	9.90e-01	1.57e-02	NA
2. P	P20469	Ice nucleation protein InaA	1.99e-01	4.13e-05	NA
2. P	Q7T3L1	Kininogen-1a	3.86e-01	6.47e-07	NA
2. P	Q86VQ3	Thioredoxin domain-containing protein 2	9.46e-01	2.77e-06	NA
2. P	P0DKJ7	Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2	9.53e-01	1.76e-02	NA
2. P	P14727	Avirulence protein AvrBs3	9.94e-01	7.09e-10	NA
2. P	P53872	Hydrophilin YNL190W	3.78e-01	3.05e-02	NA
2. P	Q1EC66	Polyubiquitin 3	9.94e-01	2.90e-02	NA
2. P	P08462	Submandibular gland secretory Glx-rich protein CB	9.45e-01	1.54e-05	NA
2. P	O88492	Perilipin-4	1.13e-03	1.05e-06	NA
2. P	P0CL30	Putative uncharacterized protein YNL339W-A	2.82e-01	7.48e-03	NA
2. P	Q8N7U7	Tetra-peptide repeat homeobox protein 1	6.85e-01	6.52e-05	NA
2. P	Q03650	Cysteine-rich, acidic integral membrane protein	3.80e-03	1.61e-08	NA
2. P	Q5XPK0	Scar-like domain-containing protein WAVE 5	9.95e-01	1.32e-03	NA
2. P	O08884	Keratin-associated protein 6-2	3.74e-01	2.73e-02	NA
2. P	P13826	Circumsporozoite protein (Fragment)	1.78e-01	1.26e-05	NA
2. P	Q9UKN1	Mucin-12	NA	5.72e-05	NA
2. P	D3YZV8	Coiled-coil domain-containing protein 8 homolog	9.33e-01	1.08e-03	NA
2. P	P17941	Involucrin	7.87e-01	1.60e-03	NA
2. P	Q6NU13	Protein SPT2 homolog	9.45e-01	1.60e-02	NA
2. P	O15069	NAC-alpha domain-containing protein 1	9.94e-01	1.21e-06	NA
2. P	E9PAV3	Nascent polypeptide-associated complex subunit alpha, muscle-specific form	9.98e-01	3.80e-05	NA
2. P	P07476	Involucrin	1.82e-01	4.12e-03	NA
2. P	P21263	Nestin	9.96e-01	5.79e-05	NA
2. P	Q4ZJY7	Mucin-like protein Glc1.8b	NA	3.46e-03	NA
2. P	Q9BYR4	Keratin-associated protein 4-3	1.29e-01	2.05e-04	NA
2. P	Q9BYQ9	Keratin-associated protein 4-8	9.95e-01	6.60e-04	NA
2. P	P0C2X8	Cell division cycle-associated protein 3	8.00e-01	9.73e-03	NA
2. P	P19228	Alpha-S1-casein	8.87e-01	3.87e-04	NA
2. P	Q8VE94	Protein FAM110C	9.26e-01	2.74e-04	NA
2. P	Q04537	Period circadian protein (Fragment)	7.26e-01	4.17e-02	NA
2. P	P18175	Involucrin	9.43e-01	1.35e-11	NA
2. P	P09413	Gas vesicle protein C	9.70e-01	1.80e-02	NA
2. P	Q1ELU5	M-zodatoxin-Lt4a	9.91e-01	4.50e-05	NA
2. P	Q03400	S-antigen protein	7.93e-03	7.99e-05	NA
2. P	Q00130	Uncharacterized protein ORF50	NA	3.81e-02	NA
2. P	P06620	Ice nucleation protein	2.48e-01	3.38e-02	NA
2. P	A1EGX6	Fibrous sheath CABYR-binding protein	9.71e-01	8.27e-04	NA
2. P	Q14242	P-selectin glycoprotein ligand 1	8.51e-01	9.67e-04	NA
2. P	E5RHQ5	Nuclear pore complex-interacting protein family member B11	4.11e-01	7.38e-07	NA
2. P	Q9BYQ5	Keratin-associated protein 4-6	9.97e-01	1.34e-04	NA
2. P	Q9URU4	Putative cell agglutination protein pfl5	4.62e-02	2.62e-09	NA
2. P	E5AV36	Burkholderia TALE-like protein 1	9.91e-01	1.18e-06	NA
2. P	Q6RY98	Long-sarafotoxin (Fragment)	8.15e-01	1.44e-03	NA
2. P	P05142	Proline-rich protein HaeIII subfamily 1	8.49e-01	3.25e-03	NA
2. P	A6NJ88	Putative SAGE1-like protein	4.02e-01	1.43e-03	NA
2. P	P0CL27	Putative uncharacterized protein YER190C-A	3.16e-01	7.48e-03	NA
2. P	Q80YD3	Protein FAM205C	9.01e-01	7.56e-03	NA
2. P	Q6GZS6	Uncharacterized protein 050L	NA	1.30e-02	NA
2. P	Q8CIT9	Suprabasin	1.35e-01	2.87e-02	NA
2. P	P08676	Circumsporozoite protein	8.87e-01	3.51e-02	NA
2. P	P24711	Involucrin	7.10e-01	3.94e-05	NA
2. P	P13492	Antigen 10-3	9.10e-01	9.94e-06	NA
2. P	P54681	Protein rtoA	2.77e-01	5.05e-03	NA
2. P	E2RYF6	Mucin-22	1.68e-03	1.18e-05	NA
2. P	Q685J3	Mucin-17	NA	5.55e-03	NA
2. P	Q9XVS4	Nucleolar protein dao-5	9.83e-01	3.53e-04	NA
2. P	A6QQF6	Suprabasin	7.01e-03	1.01e-03	NA
2. P	Q6IC83	Uncharacterized protein C22orf42	7.92e-01	1.26e-02	NA
2. P	P16112	Aggrecan core protein	2.01e-01	8.55e-04	NA
2. P	P32768	Flocculation protein FLO1	2.53e-01	1.99e-08	NA
2. P	B1B0V2	EZH inhibitory protein	9.84e-01	4.95e-05	NA
2. P	E5AW45	Burkholderia TALE-like protein 2	9.94e-01	3.44e-05	NA
2. P	A6QL64	Ankyrin repeat domain-containing protein 36A	9.86e-01	1.30e-04	NA
2. P	O46383	Sodium/potassium/calcium exchanger 1 (Fragment)	6.46e-01	2.25e-02	NA
2. P	P14708	Involucrin	2.20e-04	1.06e-03	NA
2. P	Q25060	LWamide neuropeptides	2.83e-02	2.25e-05	NA
2. P	P21138	Serine-rich 25 kDa antigen protein	9.12e-01	1.48e-02	NA
2. P	Q9H6K5	Proline-rich protein 36	9.84e-01	6.87e-03	NA
2. P	Q8N9U9	Putative uncharacterized protein SPANXA2-OT1	8.92e-01	1.45e-02	NA
2. P	Q5H9R4	Armadillo repeat-containing X-linked protein 4	7.99e-01	1.78e-02	NA
2. P	P70670	Nascent polypeptide-associated complex subunit alpha, muscle-specific form	9.98e-01	1.24e-03	NA
2. P	P08672	Circumsporozoite protein	9.56e-01	1.80e-03	NA
2. P	P81592	Acaloleptin A	9.97e-01	3.14e-03	NA
2. P	Q92617	Nuclear pore complex-interacting protein family member B3	6.36e-01	3.73e-02	NA
2. P	Q25434	Adhesive plaque matrix protein	6.10e-01	2.32e-03	NA
2. P	Q9BXM0	Periaxin	9.95e-01	4.30e-03	NA
2. P	Q8WWL7	G2/mitotic-specific cyclin-B3	9.87e-01	2.22e-03	NA
2. P	Q9NXZ1	Sarcoma antigen 1	1.99e-01	2.69e-07	NA
2. P	Q54GV8	Uncharacterized transmembrane protein DDB_G0289901	9.77e-01	6.22e-05	NA
2. P	Q9BQ66	Keratin-associated protein 4-12	9.90e-01	9.00e-05	NA
2. P	P13993	Repetitive proline-rich cell wall protein 2	9.13e-01	4.19e-04	NA
2. P	Q56830	Avirulence protein AvrXa10	9.94e-01	1.01e-09	NA
2. P	Q1ELU4	M-zodatoxin-Lt4b	9.34e-01	8.95e-04	NA
2. P	Q8N1N5	Putative protein CRIPAK	2.95e-01	8.87e-07	NA
2. P	Q09666	Neuroblast differentiation-associated protein AHNAK	NA	2.45e-05	NA
2. P	Q54G05	Putative leucine-rich repeat-containing protein DDB_G0290503	9.97e-01	8.09e-07	NA
2. P	Q95P23	Enterin neuropeptides	3.41e-01	1.06e-04	NA
2. P	O33479	Ice nucleation protein	1.96e-01	1.76e-05	NA
2. P	Q2VIS4	Filaggrin-2	9.96e-01	1.51e-07	NA
2. P	P0DKJ8	Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2	9.29e-01	5.38e-04	NA
2. P	Q4L9P0	Serine-rich adhesin for platelets	NA	1.55e-02	NA
2. P	Q03110	Circumsporozoite protein	9.65e-01	1.60e-02	NA
2. P	Q01133	Antho-RFamide neuropeptides	9.61e-01	1.82e-07	NA
2. P	Q6P902	Thioredoxin domain-containing protein 2	9.92e-01	1.76e-05	NA
2. P	P16230	Sarcoplasmic reticulum histidine-rich calcium-binding protein	9.79e-01	1.63e-03	NA
2. P	Q9NL82	Orcokinin peptides type B	9.36e-01	1.78e-03	NA
2. P	Q3V4U7	Structural protein ORF567	NA	1.19e-02	NA
2. P	O09116	Small proline-rich protein 3	2.18e-01	4.95e-05	NA
2. P	Q86X53	Glutamate-rich protein 1	6.93e-01	1.28e-02	NA
2. P	P10163	Basic salivary proline-rich protein 4	8.37e-01	2.57e-05	NA
2. P	Q62170	P-selectin glycoprotein ligand 1	8.67e-01	4.30e-02	NA
2. P	Q59L12	Agglutinin-like protein 3	9.94e-01	4.03e-03	NA
2. P	Q9QR71	Protein LANA1	NA	7.09e-03	NA
2. P	E9Q6E9	SUMO-interacting motif-containing protein 1	3.21e-01	3.92e-09	NA
2. P	Q8MKD1	Polyubiquitin-B	9.92e-01	2.76e-02	NA
2. P	Q2KI51	Protein phosphatase 1 regulatory subunit 15A	9.32e-01	2.01e-05	NA
2. P	P08640	Flocculation protein FLO11	9.88e-01	2.91e-03	NA
2. P	B2SU53	TAL effector protein PthXo1	9.96e-01	3.30e-09	NA
2. P	P17564	Protein phosphatase 1 regulatory subunit 15A	9.62e-01	1.43e-05	NA
2. P	O93456	Dermorphin peptides	9.00e-01	1.69e-03	NA
2. P	Q16992	LWamide neuropeptides	1.26e-01	1.69e-02	NA
2. P	P0C8Z4	RNA-binding motif protein, X-linked-like-3	NA	4.56e-02	NA
2. P	Q9FS16	Extensin-3	3.78e-01	3.45e-04	NA
2. P	P05143	Proline-rich protein 2	9.17e-01	5.59e-07	NA
2. P	Q6XPR3	Repetin	1.74e-01	6.65e-03	NA
2. P	P15941	Mucin-1	1.02e-01	2.43e-09	NA
2. P	P20481	Buccalin	7.51e-03	3.04e-03	NA
2. P	P16239	Ice nucleation protein	1.85e-01	6.93e-05	NA
2. P	P04280	Basic salivary proline-rich protein 1	7.92e-01	3.84e-05	NA
2. P	Q9QJ16	Immediate-early protein 2	NA	4.39e-04	NA
2. P	Q86MA7	Protein PRQFV-amide	4.92e-02	4.41e-10	NA
2. P	P11976	Prestalk protein	9.91e-01	2.98e-03	NA
2. P	Q8N7X1	RNA-binding motif protein, X-linked-like-3	9.81e-01	2.07e-02	NA
2. P	P0DKL2	Protein OPAQUE10	9.89e-01	5.57e-04	NA
2. P	P39801	Spore coat protein G	3.81e-01	6.31e-04	NA
2. P	Q47879	Ice nucleation protein InaU	1.50e-01	7.39e-04	NA
2. P	Q5SSG8	Mucin-21	2.59e-03	1.30e-08	NA
2. P	Q95337	Involucrin	9.51e-01	1.67e-03	NA
2. P	Q40375	Repetitive proline-rich cell wall protein 2	8.42e-01	3.25e-03	NA
2. P	Q8N307	Mucin-20	2.66e-01	2.00e-04	NA
2. P	P08012	Repetitive proline-rich cell wall protein 1	8.31e-01	1.30e-02	NA
2. P	A0A1D8PQB9	Agglutinin-like protein 4	9.88e-02	6.91e-06	NA
2. P	A5D7L8	PGC-1 and ERR-induced regulator in muscle protein 1	8.30e-01	2.54e-02	NA
2. P	O36421	Uncharacterized gene 73 protein	NA	1.68e-04	NA
2. P	P21733	Uncharacterized 29.1 kDa protein in cryB1 5'region	2.54e-02	5.01e-05	NA
2. P	P14591	Involucrin	8.45e-01	4.07e-03	NA
2. P	Q6UWP8	Suprabasin	3.74e-02	5.98e-03	NA
2. P	Q99102	Mucin-4	9.96e-01	2.53e-10	NA
2. P	P13821	S-antigen protein	9.78e-01	1.48e-03	NA
2. P	P04672	Nodulin-44	8.20e-01	1.49e-03	NA
2. P	P60014	Keratin-associated protein 10-10	9.69e-01	1.74e-02	NA
2. P	Q9JJL0	Testis-specific gene A8 protein	9.70e-01	3.57e-04	NA
2. P	P0CL28	Putative uncharacterized protein YGR296C-A	3.13e-01	7.48e-03	NA
2. P	Q9C0Y2	Putative cell agglutination protein SPAPB2C8.01	4.26e-02	3.29e-07	NA
2. P	P05227	Histidine-rich protein PFHRP-II	2.25e-01	3.01e-03	NA
2. P	Q8TFG4	Uncharacterized protein PB18E9.04c	4.73e-04	1.03e-03	NA
2. P	P0C728	Uncharacterized protein LF3	NA	3.44e-05	NA
2. P	P02674	Fibrinogen alpha-1 chain (Fragment)	1.67e-02	1.36e-05	NA
2. P	A8YPR9	Snake venom metalloprotease inhibitor 02A10	9.75e-01	1.35e-07	NA
2. P	P0C727	Uncharacterized protein LF3	NA	3.44e-05	NA
2. P	O60732	Melanoma-associated antigen C1	9.51e-02	5.93e-05	NA
2. P	Q767L8	Mediator of DNA damage checkpoint protein 1	9.98e-01	9.04e-03	NA
2. P	Q9CWU5	KH domain-containing protein 3	3.00e-01	3.96e-02	NA
2. P	P48998	Involucrin	7.45e-01	3.72e-08	NA
2. P	B4DH59	Neuroblastoma breakpoint family member 26	9.38e-01	5.58e-06	NA
2. P	A6NJU9	Nuclear pore complex-interacting protein family member B13	8.59e-01	9.57e-04	NA
2. P	Q5UP72	Uncharacterized protein R604	NA	4.83e-05	NA
2. P	P39712	Flocculation protein FLO9	2.98e-01	2.66e-08	NA
2. P	Q0P6D6	Coiled-coil domain-containing protein 15	9.26e-01	1.92e-05	NA
2. P	F1LWT0	SUMO-interacting motif-containing protein 1	1.78e-01	5.44e-06	NA
2. P	P02812	Basic salivary proline-rich protein 2	8.05e-01	3.91e-06	NA
2. P	P14918	Extensin	9.05e-01	2.29e-03	NA
2. P	P0CL29	Putative uncharacterized protein YML133W-A	3.33e-01	7.48e-03	NA
2. P	P0CL31	Putative uncharacterized protein YPL283W-A	5.84e-01	7.48e-03	NA
2. P	P19597	Circumsporozoite protein	9.59e-01	1.46e-02	NA
2. P	P09815	Ice nucleation protein	2.33e-01	9.72e-07	NA
2. P	P22006	Seminal vesicle secretory protein 2	3.36e-01	4.94e-03	NA
2. P	P05691	Circumsporozoite protein (Fragment)	9.17e-01	2.49e-02	NA
2. P	P97347	Repetin	9.65e-01	3.47e-10	NA
2. P	P04701	Zein-alpha Z4	9.55e-01	4.16e-03	NA
2. P	P14590	Involucrin	2.86e-01	9.33e-05	NA
2. P	Q874R4	Putative cell agglutination protein pfl3	5.69e-02	3.28e-05	NA
2. P	Q9BYQ8	Keratin-associated protein 4-9	9.97e-01	2.59e-02	NA
2. P	P21259	Pol-RFamide neuropeptides	9.47e-01	9.52e-03	NA
2. P	P62521	Coiled-coil domain-containing protein 8	9.07e-01	2.77e-04	NA
2. P	Q04118	Basic salivary proline-rich protein 3	8.68e-01	9.22e-06	NA
2. P	Q77Z83	Immediate-early protein 2	NA	1.37e-05	NA
2. P	A8MRT5	Nuclear pore complex-interacting protein family member B5	5.27e-01	1.37e-03	NA
2. P	Q27905	Probable antibacterial peptide polyprotein	5.05e-02	1.55e-06	NA
2. P	Q8XYE3	TAL effector protein Brg11	9.80e-01	2.77e-06	NA
2. P	Q6H236	Paternally-expressed gene 3 protein	9.96e-01	2.84e-05	NA
2. P	Q9FKA5	Uncharacterized protein At5g39570	9.64e-01	1.81e-02	NA
2. P	P13814	Circumsporozoite protein	9.32e-01	2.76e-02	NA
2. P	Q09180	Pro-P-factor	9.86e-01	6.68e-04	NA
2. P	P08675	Circumsporozoite protein	9.79e-01	4.16e-03	NA
2. P	Q54YG2	Extracellular matrix protein A	9.98e-01	2.28e-10	NA
2. P	P38894	Flocculation protein FLO5	7.51e-01	2.62e-07	NA
2. P	A0A0U1RQI7	Kruppel-like factor 18	7.27e-02	4.97e-11	NA
2. P	Q4ZJZ0	Mucin-like protein Glc1.8a	NA	2.87e-02	NA
2. P	P60413	Keratin-associated protein 10-12	9.86e-01	6.73e-03	NA
2. P	B8NM66	Ribosomally synthesized cyclic peptide ustiloxin B precursosr	7.87e-02	1.25e-04	NA
2. P	P0CU38	Agglutinin-like protein 2	2.79e-01	5.65e-06	NA
2. P	Q6P5H2	Nestin	9.68e-01	2.45e-05	NA
2. P	P48997	Involucrin	8.87e-01	1.53e-03	NA
2. P	P18305	Uncharacterized protein 443R	NA	8.94e-03	NA
2. P	P0CG54	Polyubiquitin-B	9.90e-01	2.09e-02	NA
2. P	P18127	Ice nucleation protein	2.38e-01	1.26e-07	NA
2. P	Q52118	Uncharacterized protein in mobD 3'region	7.01e-01	3.11e-02	NA
2. P	Q9P6S0	Galactose-specific cell agglutination protein gsf2	6.75e-01	4.97e-04	NA
2. P	Q38913	Extensin-1	9.34e-01	9.58e-06	NA
2. P	C9JG80	Nuclear pore complex-interacting protein family member B4	6.36e-01	3.24e-05	NA
2. P	Q9Z1Q1	Nestin (Fragments)	9.80e-01	2.77e-04	NA
2. P	Q8IVF2	Protein AHNAK2	NA	6.49e-06	NA
2. P	Q6AZ54	Hemogen	9.11e-01	2.12e-03	NA
2. P	P43537	Uncharacterized membrane protein YFL067W	9.35e-01	2.01e-03	NA
3. B	Q6WXV7	Protocadherin-11 X-linked	9.88e-01	NA	6.78e-06
3. B	Q9BZA7	Protocadherin-11 X-linked	9.96e-01	NA	5.67e-06
3. B	P23253	Sialidase	6.76e-02	NA	1.84e-08
3. B	Q6ZV65	Protein FAM47E	2.66e-01	NA	7.27e-27
3. B	Q71M42	Protocadherin-11 X-linked	9.95e-01	NA	7.89e-07
3. B	P12255	Filamentous hemagglutinin	NA	NA	7.70e-06
3. B	P08116	Processed variable antigen (Fragment)	9.90e-01	NA	1.52e-04
3. B	A6NHR8	Putative protein FAM47D	1.64e-01	NA	4.33e-99
3. B	Q6WYY1	Protocadherin-11 X-linked	9.91e-01	NA	8.37e-07
3. B	Q6X862	Protocadherin-11 X-linked	9.91e-01	NA	4.15e-06
3. B	Q9BZA8	Protocadherin-11 Y-linked	9.92e-01	NA	1.27e-05