Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
P14708
(Involucrin) with a FATCAT P-Value: 0.00022 and RMSD of 4.75 angstrom. The sequence alignment identity is 25.5%.
Structural alignment shown in left. Query protein Q5HY64 colored as red in alignment, homolog P14708 colored as blue.
Query protein Q5HY64 is also shown in right top, homolog P14708 showed in right bottom. They are colored based on secondary structures.
Q5HY64 MGDQRPQDRPSSPGMDS--T-PWYCDKPP-SKYFAKRKHRRLRFPPVDTQNWVFVTEGMDDFRYGCQSPEDTLV---CRRDEFLLPKISLRGPQADP-KS 92 P14708 --------------MSQQHTLPVTLS-PALSQELLK----TVP-PPVNTQQ-----EQM-------KQP--TPLPPPCQK----VP-VEL--PVEVPSKQ 59 Q5HY64 RKKKLLKKAALFSK-LSPAQPARKAFVEEVEAQLMTK-------HPLAMYP--NLGED-MPPDLLLQVLKPLDPERKLEDAGSCEGQE--KTTDEPTEPG 179 P14708 EEKHM---TAV--KGL-PEQECEQQQQEPQEQELQQQHWEQHEEHQKAENPEQQLKQEKAQRDQQLN--EQLEEEKKLLDQ-RLD-QELVK-RDE--QLG 146 Q5HY64 --KYPCGEFSPRPPETRVSCLPPEPPKTPVSSLRPEPPETG-VSHLRPQPPKTQVSSLHLEPPETGVSHLRPEPPKTQVSSL-HLEPPETG-VSHLYLEP 274 P14708 MKKEQLLEL-PEQQEQHLKHL--EQQEGQL-EL-PEQQE-GQLKHLEQQ--EGQLK--HLEQQE-G--QL--EVPEEQVGQLKYLEQQE-GQLKHLD-QQ 229 Q5HY64 PGTGVSHLCPEPPKTRVSHLHREPPETGVPDLCLEPPKSRVSHLRPEPSETG-VSHLHPEPPKTLVSSLHPEPPETG-VSHLCPEPPETRVSPLRQLPPE 372 P14708 EGQ-LKHL--DQQEGQLKHLDQQ--E-G-----------QLKHL--DQQE-GQLKHLDQQEGQ-L--EL-PEQQE-GQLKHL-----EQQEGQLKHLEHE 299 Q5HY64 AGVSHLCPEPPKTRVPPLRPETPKNGVSPL-FPEPPKTRISNL-RSEPPKIGVSHLCLEPPKTRG--SHLRPEPPETG-VSHLRPEPPKTRVSSLHLEPP 467 P14708 EG--QL--------------EVPEEQVGQLKYLEQQEGQLKHLDQQE----G--QLEL-PEQQEGQLKHL--EQQE-GQLKHL--EHQKGQ-----LEVP 366 Q5HY64 E--TG-VSHLCPEPPEKDVSHLRPEPPDT--GVSHLCPEPPKTRVSHLRPEPSETG-VSHLRPEPPKILVSSLHQAPPESSVSHLR-PEPPETG-VSHLR 559 P14708 EEQVGQLKYL--EQQEGQLKHL-----DQQEGQLEL-PEQQEGQLKHL--EQQE-GQLKHLEHQEGQLEV-------PEEQVGQLKYLEQQE-GQLKHL- 446 Q5HY64 PEPPKTRMYSLRPEPPDT--G-VSHLCPEPPKTRVSSLPPEPPETG-VSHLCPEPPETRVSHLRPEPPETGVSHLRPEPPKTRMYSLRPEPPNTG-VSHL 654 P14708 ----------------DQQEGQLKHL--DQQEKQL-ELPEQ--QVGQLKHL--EQQEGQL-EV-PE-EQVG--QLK--------Y-LEQQE---GQLKHL 506 Q5HY64 CPEPPKTRVSSLPPEPPETG-VSHLCPEPPETRVSHLRPEPPETGVSRLHPEPPKTRVSSL-HAEPPESRVSHLCPEPPETG-VSHL-----RPEPPKPR 746 P14708 --DQQEGQL-EL-PEQQE-GQLKHL--EQQEGQLKHL--EHQE-G--QL--EVPEEQVGQLKYLEQQEGQLKHL--DQQE-GQLKHLDQQEKQLELPEQQ 589 Q5HY64 VSSLRP-EPLETRVSHLRPEPPETG-VSHL-HPE----LPKPRVSSL-HLE----PPKTRRVSSLRLEPPKTGRVSSLCPEPTKTGASHLKELFQEGTSS 834 P14708 VGQLKHLEQQEGQLEHL--EGQE-GQLEHLEHQEGQLGLPEQQVWQLKQLEKQEGQPK-------NLEEEE-GQLKHLVQQE---G--QLEQ--QEG--- 668 Q5HY64 TMECVSDSL-QRRHTSRKLRDFKW----AGDLGVNEESISSLFDFTPECRATYQDQKNKKANECSSG-LKYSMELDEMDEVKFFSQEKDLDGKIQNAPNS 928 P14708 QVEHLEEQVGQLKHLEEQEGQLKYLEQQQGQLEVPEQQVGQ-----P--KHLEQEEKQLELPEQQEGQLKH---LE-----K---QEAQLE-----LP-- 743 Q5HY64 HSAQHVKMGYGAWYLKPKLGKKLRSDEPLIDPKLVLEKPDEPD--I--LDGLYGPIAFKDFILSKGY-EMPGIIQRLFA-RRGWTYD---SVKT------ 1013 P14708 --EQQV--G------QP---KHLEQQE-----K-QLEHPEQKDGQLKHLEQQEGQL--KNLEQQKGQLEQP-----VFAPAPGQVQDIQPALPTKGEVLL 817 Q5HY64 PI---QRAMQVY---KYKEDVTDASEED 1035 P14708 PVEQQQQKQEVQWPPKHK---------- 835
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1900006 | positive regulation of dendrite development |
| 1. PB | GO:0032880 | regulation of protein localization |
| 1. PB | GO:1905168 | positive regulation of double-strand break repair via homologous recombination |
| 1. PB | GO:0098631 | cell adhesion mediator activity |
| 1. PB | GO:2000781 | positive regulation of double-strand break repair |
| 1. PB | GO:0051656 | establishment of organelle localization |
| 1. PB | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 1. PB | GO:0090307 | mitotic spindle assembly |
| 1. PB | GO:0106333 | subcortical maternal complex |
| 1. PB | GO:0045179 | apical cortex |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:0050769 | positive regulation of neurogenesis |
| 1. PB | GO:0010339 | external side of cell wall |
| 1. PB | GO:0031297 | replication fork processing |
| 1. PB | GO:0040019 | positive regulation of embryonic development |
| 1. PB | GO:0031362 | anchored component of external side of plasma membrane |
| 2. P | GO:0044853 | plasma membrane raft |
| 2. P | GO:0001515 | opioid peptide activity |
| 2. P | GO:0032039 | integrator complex |
| 2. P | GO:0043710 | cell adhesion involved in multi-species biofilm formation |
| 2. P | GO:1903573 | negative regulation of response to endoplasmic reticulum stress |
| 2. P | GO:0030844 | positive regulation of intermediate filament depolymerization |
| 2. P | GO:0034472 | snRNA 3'-end processing |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0030315 | T-tubule |
| 2. P | GO:0042790 | nucleolar large rRNA transcription by RNA polymerase I |
| 2. P | GO:0090281 | negative regulation of calcium ion import |
| 2. P | GO:0000128 | flocculation |
| 2. P | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 2. P | GO:1990441 | negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress |
| 2. P | GO:0008366 | axon ensheathment |
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:0010514 | induction of conjugation with cellular fusion |
| 2. P | GO:0000772 | mating pheromone activity |
| 2. P | GO:0031730 | CCR5 chemokine receptor binding |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0090240 | positive regulation of histone H4 acetylation |
| 2. P | GO:0035308 | negative regulation of protein dephosphorylation |
| 2. P | GO:0030448 | hyphal growth |
| 2. P | GO:0050902 | leukocyte adhesive activation |
| 2. P | GO:0090606 | single-species surface biofilm formation |
| 2. P | GO:0009986 | cell surface |
| 2. P | GO:0050900 | leukocyte migration |
| 2. P | GO:0031412 | gas vesicle organization |
| 2. P | GO:0046914 | transition metal ion binding |
| 2. P | GO:0097493 | structural molecule activity conferring elasticity |
| 2. P | GO:0001533 | cornified envelope |
| 2. P | GO:1901318 | negative regulation of flagellated sperm motility |
| 2. P | GO:0000182 | rDNA binding |
| 2. P | GO:0072089 | stem cell proliferation |
| 2. P | GO:0048388 | endosomal lumen acidification |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest |
| 2. P | GO:0034053 | modulation by symbiont of host defense-related programmed cell death |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0033629 | negative regulation of cell adhesion mediated by integrin |
| 2. P | GO:0010466 | negative regulation of peptidase activity |
| 2. P | GO:0030097 | hemopoiesis |
| 2. P | GO:0010944 | negative regulation of transcription by competitive promoter binding |
| 2. P | GO:0034109 | homotypic cell-cell adhesion |
| 2. P | GO:1903494 | response to dehydroepiandrosterone |
| 2. P | GO:0031386 | protein tag |
| 2. P | GO:0051451 | myoblast migration |
| 2. P | GO:0001042 | RNA polymerase I core binding |
| 2. P | GO:0039503 | suppression by virus of host innate immune response |
| 2. P | GO:0036457 | keratohyalin granule |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0006612 | protein targeting to membrane |
| 2. P | GO:0035036 | sperm-egg recognition |
| 2. P | GO:0032287 | peripheral nervous system myelin maintenance |
| 2. P | GO:1900005 | positive regulation of serine-type endopeptidase activity |
| 2. P | GO:0032184 | SUMO polymer binding |
| 2. P | GO:0005537 | mannose binding |
| 2. P | GO:0001931 | uropod |
| 2. P | GO:0031154 | culmination involved in sorocarp development |
| 2. P | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 2. P | GO:0007568 | aging |
| 2. P | GO:1902310 | positive regulation of peptidyl-serine dephosphorylation |
| 2. P | GO:1990393 | 3M complex |
| 2. P | GO:0042628 | mating plug formation |
| 2. P | GO:0005176 | ErbB-2 class receptor binding |
| 2. P | GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator |
| 2. P | GO:0031142 | induction of conjugation upon nitrogen starvation |
| 2. P | GO:1903912 | negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:1902168 | response to catechin |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0005654 | nucleoplasm |
| 2. P | GO:0048858 | cell projection morphogenesis |
| 2. P | GO:0036349 | galactose-specific flocculation |
| 2. P | GO:0043709 | cell adhesion involved in single-species biofilm formation |
| 2. P | GO:0010847 | regulation of chromatin assembly |
| 2. P | GO:0033172 | gas vesicle shell |
| 2. P | GO:0062038 | positive regulation of pheromone response MAPK cascade |
| 2. P | GO:0043086 | negative regulation of catalytic activity |
| 2. P | GO:0042633 | hair cycle |
| 2. P | GO:0009279 | cell outer membrane |
| 2. P | GO:0030445 | yeast-form cell wall |
| 2. P | GO:0031589 | cell-substrate adhesion |
| 2. P | GO:0005854 | nascent polypeptide-associated complex |
| 2. P | GO:0097656 | cell-cell self recognition |
| 2. P | GO:0000086 | G2/M transition of mitotic cell cycle |
| 2. P | GO:0048012 | hepatocyte growth factor receptor signaling pathway |
| 2. P | GO:0071502 | cellular response to temperature stimulus |
| 2. P | GO:1901385 | regulation of voltage-gated calcium channel activity |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0031012 | extracellular matrix |
| 2. P | GO:0009530 | primary cell wall |
| 2. P | GO:0030414 | peptidase inhibitor activity |
| 2. P | GO:0050817 | coagulation |
| 2. P | GO:1902465 | negative regulation of histone H3-K27 trimethylation |
| 2. P | GO:0031640 | killing of cells of another organism |
| 2. P | GO:0042311 | vasodilation |
| 2. P | GO:0044406 | adhesion of symbiont to host |
| 2. P | GO:1903917 | positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation |
| 2. P | GO:0009277 | fungal-type cell wall |
| 2. P | GO:1902166 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0005199 | structural constituent of cell wall |
| 2. P | GO:0110044 | regulation of cell cycle switching, mitotic to meiotic cell cycle |
| 2. P | GO:0050825 | ice binding |
| 2. P | GO:0035686 | sperm fibrous sheath |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0019215 | intermediate filament binding |
| 2. P | GO:0050901 | leukocyte tethering or rolling |
| 2. P | GO:0048730 | epidermis morphogenesis |
| 2. P | GO:0060388 | vitelline envelope |
| 2. P | GO:0005618 | cell wall |
| 2. P | GO:0033234 | negative regulation of protein sumoylation |
| 2. P | GO:0050839 | cell adhesion molecule binding |
| 2. P | GO:0042631 | cellular response to water deprivation |
| 2. P | GO:0070972 | protein localization to endoplasmic reticulum |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0009664 | plant-type cell wall organization |
| 2. P | GO:1903496 | response to 11-deoxycorticosterone |
| 2. P | GO:0019725 | cellular homeostasis |
| 2. P | GO:0018153 | isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine |
| 2. P | GO:0020016 | ciliary pocket |
| 2. P | GO:0032005 | signal transduction involved in positive regulation of conjugation with cellular fusion |
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0020003 | symbiont-containing vacuole |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0052026 | modulation by symbiont of host transcription |
| 2. P | GO:0043484 | regulation of RNA splicing |
| 2. P | GO:0007088 | regulation of mitotic nuclear division |
| 2. P | GO:0098609 | cell-cell adhesion |
| 2. P | GO:0010224 | response to UV-B |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0031982 | vesicle |
| 2. P | GO:0004791 | thioredoxin-disulfide reductase activity |
| 2. P | GO:0061187 | regulation of ribosomal DNA heterochromatin assembly |
| 2. P | GO:0030197 | extracellular matrix constituent, lubricant activity |
| 2. P | GO:0036496 | regulation of translational initiation by eIF2 alpha dephosphorylation |
| 2. P | GO:0008093 | cytoskeletal anchor activity |
| 2. P | GO:0060734 | regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:0005577 | fibrinogen complex |
| 2. P | GO:0036003 | positive regulation of transcription from RNA polymerase II promoter in response to stress |
| 2. P | GO:0005938 | cell cortex |
| 2. P | GO:0009877 | nodulation |
| 2. P | GO:0030017 | sarcomere |
| 2. P | GO:0031076 | embryonic camera-type eye development |
| 2. P | GO:0060491 | regulation of cell projection assembly |
| 3. B | GO:0005509 | calcium ion binding |
| 3. B | GO:0052795 | exo-alpha-(2->6)-sialidase activity |
| 3. B | GO:0008152 | metabolic process |
| 3. B | GO:0008047 | enzyme activator activity |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0052794 | exo-alpha-(2->3)-sialidase activity |
| 3. B | GO:0061827 | sperm head |
| 3. B | GO:0052796 | exo-alpha-(2->8)-sialidase activity |
| 3. B | GO:0097225 | sperm midpiece |
| 3. B | GO:0005887 | integral component of plasma membrane |
| 3. B | GO:0071168 | protein localization to chromatin |
| 3. B | GO:0030177 | positive regulation of Wnt signaling pathway |
| 3. B | GO:0034401 | obsolete chromatin organization involved in regulation of transcription |
| 3. B | GO:0031062 | positive regulation of histone methylation |
| 3. B | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8NA70 | Protein FAM47B | 6.73e-02 | 4.10e-18 | 0.0 |
| 1. PB | Q9D9R9 | Protein FAM186A | 5.33e-02 | 1.12e-12 | 0.001 |
| 1. PB | Q5JRC9 | Protein FAM47A | 1.35e-01 | 3.12e-24 | 0.0 |
| 1. PB | Q96WV6 | Uncharacterized threonine-rich GPI-anchored glycoprotein PJ4664.02 | NA | 2.94e-08 | 9.40e-10 |
| 1. PB | D3ZVV1 | KH domain-containing protein 3 | 1.81e-02 | 1.06e-03 | 0.003 |
| 1. PB | Q5HY64 | Putative protein FAM47C | 0 | 1.11e-172 | 0.0 |
| 2. P | Q8WR62 | Vitelline envelope sperm lysin receptor | NA | 3.19e-08 | NA |
| 2. P | P24710 | Involucrin | 7.88e-01 | 4.65e-07 | NA |
| 2. P | Q9D226 | Keratin-associated protein 5-3 | 6.02e-01 | 4.89e-02 | NA |
| 2. P | P08297 | Early nodulin-75 | 8.63e-01 | 1.33e-04 | NA |
| 2. P | A0A1D8PQ86 | Agglutinin-like protein 9 | 9.90e-01 | 1.57e-02 | NA |
| 2. P | P20469 | Ice nucleation protein InaA | 1.99e-01 | 4.13e-05 | NA |
| 2. P | Q7T3L1 | Kininogen-1a | 3.86e-01 | 6.47e-07 | NA |
| 2. P | Q86VQ3 | Thioredoxin domain-containing protein 2 | 9.46e-01 | 2.77e-06 | NA |
| 2. P | P0DKJ7 | Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2 | 9.53e-01 | 1.76e-02 | NA |
| 2. P | P14727 | Avirulence protein AvrBs3 | 9.94e-01 | 7.09e-10 | NA |
| 2. P | P53872 | Hydrophilin YNL190W | 3.78e-01 | 3.05e-02 | NA |
| 2. P | Q1EC66 | Polyubiquitin 3 | 9.94e-01 | 2.90e-02 | NA |
| 2. P | P08462 | Submandibular gland secretory Glx-rich protein CB | 9.45e-01 | 1.54e-05 | NA |
| 2. P | O88492 | Perilipin-4 | 1.13e-03 | 1.05e-06 | NA |
| 2. P | P0CL30 | Putative uncharacterized protein YNL339W-A | 2.82e-01 | 7.48e-03 | NA |
| 2. P | Q8N7U7 | Tetra-peptide repeat homeobox protein 1 | 6.85e-01 | 6.52e-05 | NA |
| 2. P | Q03650 | Cysteine-rich, acidic integral membrane protein | 3.80e-03 | 1.61e-08 | NA |
| 2. P | Q5XPK0 | Scar-like domain-containing protein WAVE 5 | 9.95e-01 | 1.32e-03 | NA |
| 2. P | O08884 | Keratin-associated protein 6-2 | 3.74e-01 | 2.73e-02 | NA |
| 2. P | P13826 | Circumsporozoite protein (Fragment) | 1.78e-01 | 1.26e-05 | NA |
| 2. P | Q9UKN1 | Mucin-12 | NA | 5.72e-05 | NA |
| 2. P | D3YZV8 | Coiled-coil domain-containing protein 8 homolog | 9.33e-01 | 1.08e-03 | NA |
| 2. P | P17941 | Involucrin | 7.87e-01 | 1.60e-03 | NA |
| 2. P | Q6NU13 | Protein SPT2 homolog | 9.45e-01 | 1.60e-02 | NA |
| 2. P | O15069 | NAC-alpha domain-containing protein 1 | 9.94e-01 | 1.21e-06 | NA |
| 2. P | E9PAV3 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form | 9.98e-01 | 3.80e-05 | NA |
| 2. P | P07476 | Involucrin | 1.82e-01 | 4.12e-03 | NA |
| 2. P | P21263 | Nestin | 9.96e-01 | 5.79e-05 | NA |
| 2. P | Q4ZJY7 | Mucin-like protein Glc1.8b | NA | 3.46e-03 | NA |
| 2. P | Q9BYR4 | Keratin-associated protein 4-3 | 1.29e-01 | 2.05e-04 | NA |
| 2. P | Q9BYQ9 | Keratin-associated protein 4-8 | 9.95e-01 | 6.60e-04 | NA |
| 2. P | P0C2X8 | Cell division cycle-associated protein 3 | 8.00e-01 | 9.73e-03 | NA |
| 2. P | P19228 | Alpha-S1-casein | 8.87e-01 | 3.87e-04 | NA |
| 2. P | Q8VE94 | Protein FAM110C | 9.26e-01 | 2.74e-04 | NA |
| 2. P | Q04537 | Period circadian protein (Fragment) | 7.26e-01 | 4.17e-02 | NA |
| 2. P | P18175 | Involucrin | 9.43e-01 | 1.35e-11 | NA |
| 2. P | P09413 | Gas vesicle protein C | 9.70e-01 | 1.80e-02 | NA |
| 2. P | Q1ELU5 | M-zodatoxin-Lt4a | 9.91e-01 | 4.50e-05 | NA |
| 2. P | Q03400 | S-antigen protein | 7.93e-03 | 7.99e-05 | NA |
| 2. P | Q00130 | Uncharacterized protein ORF50 | NA | 3.81e-02 | NA |
| 2. P | P06620 | Ice nucleation protein | 2.48e-01 | 3.38e-02 | NA |
| 2. P | A1EGX6 | Fibrous sheath CABYR-binding protein | 9.71e-01 | 8.27e-04 | NA |
| 2. P | Q14242 | P-selectin glycoprotein ligand 1 | 8.51e-01 | 9.67e-04 | NA |
| 2. P | E5RHQ5 | Nuclear pore complex-interacting protein family member B11 | 4.11e-01 | 7.38e-07 | NA |
| 2. P | Q9BYQ5 | Keratin-associated protein 4-6 | 9.97e-01 | 1.34e-04 | NA |
| 2. P | Q9URU4 | Putative cell agglutination protein pfl5 | 4.62e-02 | 2.62e-09 | NA |
| 2. P | E5AV36 | Burkholderia TALE-like protein 1 | 9.91e-01 | 1.18e-06 | NA |
| 2. P | Q6RY98 | Long-sarafotoxin (Fragment) | 8.15e-01 | 1.44e-03 | NA |
| 2. P | P05142 | Proline-rich protein HaeIII subfamily 1 | 8.49e-01 | 3.25e-03 | NA |
| 2. P | A6NJ88 | Putative SAGE1-like protein | 4.02e-01 | 1.43e-03 | NA |
| 2. P | P0CL27 | Putative uncharacterized protein YER190C-A | 3.16e-01 | 7.48e-03 | NA |
| 2. P | Q80YD3 | Protein FAM205C | 9.01e-01 | 7.56e-03 | NA |
| 2. P | Q6GZS6 | Uncharacterized protein 050L | NA | 1.30e-02 | NA |
| 2. P | Q8CIT9 | Suprabasin | 1.35e-01 | 2.87e-02 | NA |
| 2. P | P08676 | Circumsporozoite protein | 8.87e-01 | 3.51e-02 | NA |
| 2. P | P24711 | Involucrin | 7.10e-01 | 3.94e-05 | NA |
| 2. P | P13492 | Antigen 10-3 | 9.10e-01 | 9.94e-06 | NA |
| 2. P | P54681 | Protein rtoA | 2.77e-01 | 5.05e-03 | NA |
| 2. P | E2RYF6 | Mucin-22 | 1.68e-03 | 1.18e-05 | NA |
| 2. P | Q685J3 | Mucin-17 | NA | 5.55e-03 | NA |
| 2. P | Q9XVS4 | Nucleolar protein dao-5 | 9.83e-01 | 3.53e-04 | NA |
| 2. P | A6QQF6 | Suprabasin | 7.01e-03 | 1.01e-03 | NA |
| 2. P | Q6IC83 | Uncharacterized protein C22orf42 | 7.92e-01 | 1.26e-02 | NA |
| 2. P | P16112 | Aggrecan core protein | 2.01e-01 | 8.55e-04 | NA |
| 2. P | P32768 | Flocculation protein FLO1 | 2.53e-01 | 1.99e-08 | NA |
| 2. P | B1B0V2 | EZH inhibitory protein | 9.84e-01 | 4.95e-05 | NA |
| 2. P | E5AW45 | Burkholderia TALE-like protein 2 | 9.94e-01 | 3.44e-05 | NA |
| 2. P | A6QL64 | Ankyrin repeat domain-containing protein 36A | 9.86e-01 | 1.30e-04 | NA |
| 2. P | O46383 | Sodium/potassium/calcium exchanger 1 (Fragment) | 6.46e-01 | 2.25e-02 | NA |
| 2. P | P14708 | Involucrin | 2.20e-04 | 1.06e-03 | NA |
| 2. P | Q25060 | LWamide neuropeptides | 2.83e-02 | 2.25e-05 | NA |
| 2. P | P21138 | Serine-rich 25 kDa antigen protein | 9.12e-01 | 1.48e-02 | NA |
| 2. P | Q9H6K5 | Proline-rich protein 36 | 9.84e-01 | 6.87e-03 | NA |
| 2. P | Q8N9U9 | Putative uncharacterized protein SPANXA2-OT1 | 8.92e-01 | 1.45e-02 | NA |
| 2. P | Q5H9R4 | Armadillo repeat-containing X-linked protein 4 | 7.99e-01 | 1.78e-02 | NA |
| 2. P | P70670 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form | 9.98e-01 | 1.24e-03 | NA |
| 2. P | P08672 | Circumsporozoite protein | 9.56e-01 | 1.80e-03 | NA |
| 2. P | P81592 | Acaloleptin A | 9.97e-01 | 3.14e-03 | NA |
| 2. P | Q92617 | Nuclear pore complex-interacting protein family member B3 | 6.36e-01 | 3.73e-02 | NA |
| 2. P | Q25434 | Adhesive plaque matrix protein | 6.10e-01 | 2.32e-03 | NA |
| 2. P | Q9BXM0 | Periaxin | 9.95e-01 | 4.30e-03 | NA |
| 2. P | Q8WWL7 | G2/mitotic-specific cyclin-B3 | 9.87e-01 | 2.22e-03 | NA |
| 2. P | Q9NXZ1 | Sarcoma antigen 1 | 1.99e-01 | 2.69e-07 | NA |
| 2. P | Q54GV8 | Uncharacterized transmembrane protein DDB_G0289901 | 9.77e-01 | 6.22e-05 | NA |
| 2. P | Q9BQ66 | Keratin-associated protein 4-12 | 9.90e-01 | 9.00e-05 | NA |
| 2. P | P13993 | Repetitive proline-rich cell wall protein 2 | 9.13e-01 | 4.19e-04 | NA |
| 2. P | Q56830 | Avirulence protein AvrXa10 | 9.94e-01 | 1.01e-09 | NA |
| 2. P | Q1ELU4 | M-zodatoxin-Lt4b | 9.34e-01 | 8.95e-04 | NA |
| 2. P | Q8N1N5 | Putative protein CRIPAK | 2.95e-01 | 8.87e-07 | NA |
| 2. P | Q09666 | Neuroblast differentiation-associated protein AHNAK | NA | 2.45e-05 | NA |
| 2. P | Q54G05 | Putative leucine-rich repeat-containing protein DDB_G0290503 | 9.97e-01 | 8.09e-07 | NA |
| 2. P | Q95P23 | Enterin neuropeptides | 3.41e-01 | 1.06e-04 | NA |
| 2. P | O33479 | Ice nucleation protein | 1.96e-01 | 1.76e-05 | NA |
| 2. P | Q2VIS4 | Filaggrin-2 | 9.96e-01 | 1.51e-07 | NA |
| 2. P | P0DKJ8 | Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2 | 9.29e-01 | 5.38e-04 | NA |
| 2. P | Q4L9P0 | Serine-rich adhesin for platelets | NA | 1.55e-02 | NA |
| 2. P | Q03110 | Circumsporozoite protein | 9.65e-01 | 1.60e-02 | NA |
| 2. P | Q01133 | Antho-RFamide neuropeptides | 9.61e-01 | 1.82e-07 | NA |
| 2. P | Q6P902 | Thioredoxin domain-containing protein 2 | 9.92e-01 | 1.76e-05 | NA |
| 2. P | P16230 | Sarcoplasmic reticulum histidine-rich calcium-binding protein | 9.79e-01 | 1.63e-03 | NA |
| 2. P | Q9NL82 | Orcokinin peptides type B | 9.36e-01 | 1.78e-03 | NA |
| 2. P | Q3V4U7 | Structural protein ORF567 | NA | 1.19e-02 | NA |
| 2. P | O09116 | Small proline-rich protein 3 | 2.18e-01 | 4.95e-05 | NA |
| 2. P | Q86X53 | Glutamate-rich protein 1 | 6.93e-01 | 1.28e-02 | NA |
| 2. P | P10163 | Basic salivary proline-rich protein 4 | 8.37e-01 | 2.57e-05 | NA |
| 2. P | Q62170 | P-selectin glycoprotein ligand 1 | 8.67e-01 | 4.30e-02 | NA |
| 2. P | Q59L12 | Agglutinin-like protein 3 | 9.94e-01 | 4.03e-03 | NA |
| 2. P | Q9QR71 | Protein LANA1 | NA | 7.09e-03 | NA |
| 2. P | E9Q6E9 | SUMO-interacting motif-containing protein 1 | 3.21e-01 | 3.92e-09 | NA |
| 2. P | Q8MKD1 | Polyubiquitin-B | 9.92e-01 | 2.76e-02 | NA |
| 2. P | Q2KI51 | Protein phosphatase 1 regulatory subunit 15A | 9.32e-01 | 2.01e-05 | NA |
| 2. P | P08640 | Flocculation protein FLO11 | 9.88e-01 | 2.91e-03 | NA |
| 2. P | B2SU53 | TAL effector protein PthXo1 | 9.96e-01 | 3.30e-09 | NA |
| 2. P | P17564 | Protein phosphatase 1 regulatory subunit 15A | 9.62e-01 | 1.43e-05 | NA |
| 2. P | O93456 | Dermorphin peptides | 9.00e-01 | 1.69e-03 | NA |
| 2. P | Q16992 | LWamide neuropeptides | 1.26e-01 | 1.69e-02 | NA |
| 2. P | P0C8Z4 | RNA-binding motif protein, X-linked-like-3 | NA | 4.56e-02 | NA |
| 2. P | Q9FS16 | Extensin-3 | 3.78e-01 | 3.45e-04 | NA |
| 2. P | P05143 | Proline-rich protein 2 | 9.17e-01 | 5.59e-07 | NA |
| 2. P | Q6XPR3 | Repetin | 1.74e-01 | 6.65e-03 | NA |
| 2. P | P15941 | Mucin-1 | 1.02e-01 | 2.43e-09 | NA |
| 2. P | P20481 | Buccalin | 7.51e-03 | 3.04e-03 | NA |
| 2. P | P16239 | Ice nucleation protein | 1.85e-01 | 6.93e-05 | NA |
| 2. P | P04280 | Basic salivary proline-rich protein 1 | 7.92e-01 | 3.84e-05 | NA |
| 2. P | Q9QJ16 | Immediate-early protein 2 | NA | 4.39e-04 | NA |
| 2. P | Q86MA7 | Protein PRQFV-amide | 4.92e-02 | 4.41e-10 | NA |
| 2. P | P11976 | Prestalk protein | 9.91e-01 | 2.98e-03 | NA |
| 2. P | Q8N7X1 | RNA-binding motif protein, X-linked-like-3 | 9.81e-01 | 2.07e-02 | NA |
| 2. P | P0DKL2 | Protein OPAQUE10 | 9.89e-01 | 5.57e-04 | NA |
| 2. P | P39801 | Spore coat protein G | 3.81e-01 | 6.31e-04 | NA |
| 2. P | Q47879 | Ice nucleation protein InaU | 1.50e-01 | 7.39e-04 | NA |
| 2. P | Q5SSG8 | Mucin-21 | 2.59e-03 | 1.30e-08 | NA |
| 2. P | Q95337 | Involucrin | 9.51e-01 | 1.67e-03 | NA |
| 2. P | Q40375 | Repetitive proline-rich cell wall protein 2 | 8.42e-01 | 3.25e-03 | NA |
| 2. P | Q8N307 | Mucin-20 | 2.66e-01 | 2.00e-04 | NA |
| 2. P | P08012 | Repetitive proline-rich cell wall protein 1 | 8.31e-01 | 1.30e-02 | NA |
| 2. P | A0A1D8PQB9 | Agglutinin-like protein 4 | 9.88e-02 | 6.91e-06 | NA |
| 2. P | A5D7L8 | PGC-1 and ERR-induced regulator in muscle protein 1 | 8.30e-01 | 2.54e-02 | NA |
| 2. P | O36421 | Uncharacterized gene 73 protein | NA | 1.68e-04 | NA |
| 2. P | P21733 | Uncharacterized 29.1 kDa protein in cryB1 5'region | 2.54e-02 | 5.01e-05 | NA |
| 2. P | P14591 | Involucrin | 8.45e-01 | 4.07e-03 | NA |
| 2. P | Q6UWP8 | Suprabasin | 3.74e-02 | 5.98e-03 | NA |
| 2. P | Q99102 | Mucin-4 | 9.96e-01 | 2.53e-10 | NA |
| 2. P | P13821 | S-antigen protein | 9.78e-01 | 1.48e-03 | NA |
| 2. P | P04672 | Nodulin-44 | 8.20e-01 | 1.49e-03 | NA |
| 2. P | P60014 | Keratin-associated protein 10-10 | 9.69e-01 | 1.74e-02 | NA |
| 2. P | Q9JJL0 | Testis-specific gene A8 protein | 9.70e-01 | 3.57e-04 | NA |
| 2. P | P0CL28 | Putative uncharacterized protein YGR296C-A | 3.13e-01 | 7.48e-03 | NA |
| 2. P | Q9C0Y2 | Putative cell agglutination protein SPAPB2C8.01 | 4.26e-02 | 3.29e-07 | NA |
| 2. P | P05227 | Histidine-rich protein PFHRP-II | 2.25e-01 | 3.01e-03 | NA |
| 2. P | Q8TFG4 | Uncharacterized protein PB18E9.04c | 4.73e-04 | 1.03e-03 | NA |
| 2. P | P0C728 | Uncharacterized protein LF3 | NA | 3.44e-05 | NA |
| 2. P | P02674 | Fibrinogen alpha-1 chain (Fragment) | 1.67e-02 | 1.36e-05 | NA |
| 2. P | A8YPR9 | Snake venom metalloprotease inhibitor 02A10 | 9.75e-01 | 1.35e-07 | NA |
| 2. P | P0C727 | Uncharacterized protein LF3 | NA | 3.44e-05 | NA |
| 2. P | O60732 | Melanoma-associated antigen C1 | 9.51e-02 | 5.93e-05 | NA |
| 2. P | Q767L8 | Mediator of DNA damage checkpoint protein 1 | 9.98e-01 | 9.04e-03 | NA |
| 2. P | Q9CWU5 | KH domain-containing protein 3 | 3.00e-01 | 3.96e-02 | NA |
| 2. P | P48998 | Involucrin | 7.45e-01 | 3.72e-08 | NA |
| 2. P | B4DH59 | Neuroblastoma breakpoint family member 26 | 9.38e-01 | 5.58e-06 | NA |
| 2. P | A6NJU9 | Nuclear pore complex-interacting protein family member B13 | 8.59e-01 | 9.57e-04 | NA |
| 2. P | Q5UP72 | Uncharacterized protein R604 | NA | 4.83e-05 | NA |
| 2. P | P39712 | Flocculation protein FLO9 | 2.98e-01 | 2.66e-08 | NA |
| 2. P | Q0P6D6 | Coiled-coil domain-containing protein 15 | 9.26e-01 | 1.92e-05 | NA |
| 2. P | F1LWT0 | SUMO-interacting motif-containing protein 1 | 1.78e-01 | 5.44e-06 | NA |
| 2. P | P02812 | Basic salivary proline-rich protein 2 | 8.05e-01 | 3.91e-06 | NA |
| 2. P | P14918 | Extensin | 9.05e-01 | 2.29e-03 | NA |
| 2. P | P0CL29 | Putative uncharacterized protein YML133W-A | 3.33e-01 | 7.48e-03 | NA |
| 2. P | P0CL31 | Putative uncharacterized protein YPL283W-A | 5.84e-01 | 7.48e-03 | NA |
| 2. P | P19597 | Circumsporozoite protein | 9.59e-01 | 1.46e-02 | NA |
| 2. P | P09815 | Ice nucleation protein | 2.33e-01 | 9.72e-07 | NA |
| 2. P | P22006 | Seminal vesicle secretory protein 2 | 3.36e-01 | 4.94e-03 | NA |
| 2. P | P05691 | Circumsporozoite protein (Fragment) | 9.17e-01 | 2.49e-02 | NA |
| 2. P | P97347 | Repetin | 9.65e-01 | 3.47e-10 | NA |
| 2. P | P04701 | Zein-alpha Z4 | 9.55e-01 | 4.16e-03 | NA |
| 2. P | P14590 | Involucrin | 2.86e-01 | 9.33e-05 | NA |
| 2. P | Q874R4 | Putative cell agglutination protein pfl3 | 5.69e-02 | 3.28e-05 | NA |
| 2. P | Q9BYQ8 | Keratin-associated protein 4-9 | 9.97e-01 | 2.59e-02 | NA |
| 2. P | P21259 | Pol-RFamide neuropeptides | 9.47e-01 | 9.52e-03 | NA |
| 2. P | P62521 | Coiled-coil domain-containing protein 8 | 9.07e-01 | 2.77e-04 | NA |
| 2. P | Q04118 | Basic salivary proline-rich protein 3 | 8.68e-01 | 9.22e-06 | NA |
| 2. P | Q77Z83 | Immediate-early protein 2 | NA | 1.37e-05 | NA |
| 2. P | A8MRT5 | Nuclear pore complex-interacting protein family member B5 | 5.27e-01 | 1.37e-03 | NA |
| 2. P | Q27905 | Probable antibacterial peptide polyprotein | 5.05e-02 | 1.55e-06 | NA |
| 2. P | Q8XYE3 | TAL effector protein Brg11 | 9.80e-01 | 2.77e-06 | NA |
| 2. P | Q6H236 | Paternally-expressed gene 3 protein | 9.96e-01 | 2.84e-05 | NA |
| 2. P | Q9FKA5 | Uncharacterized protein At5g39570 | 9.64e-01 | 1.81e-02 | NA |
| 2. P | P13814 | Circumsporozoite protein | 9.32e-01 | 2.76e-02 | NA |
| 2. P | Q09180 | Pro-P-factor | 9.86e-01 | 6.68e-04 | NA |
| 2. P | P08675 | Circumsporozoite protein | 9.79e-01 | 4.16e-03 | NA |
| 2. P | Q54YG2 | Extracellular matrix protein A | 9.98e-01 | 2.28e-10 | NA |
| 2. P | P38894 | Flocculation protein FLO5 | 7.51e-01 | 2.62e-07 | NA |
| 2. P | A0A0U1RQI7 | Kruppel-like factor 18 | 7.27e-02 | 4.97e-11 | NA |
| 2. P | Q4ZJZ0 | Mucin-like protein Glc1.8a | NA | 2.87e-02 | NA |
| 2. P | P60413 | Keratin-associated protein 10-12 | 9.86e-01 | 6.73e-03 | NA |
| 2. P | B8NM66 | Ribosomally synthesized cyclic peptide ustiloxin B precursosr | 7.87e-02 | 1.25e-04 | NA |
| 2. P | P0CU38 | Agglutinin-like protein 2 | 2.79e-01 | 5.65e-06 | NA |
| 2. P | Q6P5H2 | Nestin | 9.68e-01 | 2.45e-05 | NA |
| 2. P | P48997 | Involucrin | 8.87e-01 | 1.53e-03 | NA |
| 2. P | P18305 | Uncharacterized protein 443R | NA | 8.94e-03 | NA |
| 2. P | P0CG54 | Polyubiquitin-B | 9.90e-01 | 2.09e-02 | NA |
| 2. P | P18127 | Ice nucleation protein | 2.38e-01 | 1.26e-07 | NA |
| 2. P | Q52118 | Uncharacterized protein in mobD 3'region | 7.01e-01 | 3.11e-02 | NA |
| 2. P | Q9P6S0 | Galactose-specific cell agglutination protein gsf2 | 6.75e-01 | 4.97e-04 | NA |
| 2. P | Q38913 | Extensin-1 | 9.34e-01 | 9.58e-06 | NA |
| 2. P | C9JG80 | Nuclear pore complex-interacting protein family member B4 | 6.36e-01 | 3.24e-05 | NA |
| 2. P | Q9Z1Q1 | Nestin (Fragments) | 9.80e-01 | 2.77e-04 | NA |
| 2. P | Q8IVF2 | Protein AHNAK2 | NA | 6.49e-06 | NA |
| 2. P | Q6AZ54 | Hemogen | 9.11e-01 | 2.12e-03 | NA |
| 2. P | P43537 | Uncharacterized membrane protein YFL067W | 9.35e-01 | 2.01e-03 | NA |
| 3. B | Q6WXV7 | Protocadherin-11 X-linked | 9.88e-01 | NA | 6.78e-06 |
| 3. B | Q9BZA7 | Protocadherin-11 X-linked | 9.96e-01 | NA | 5.67e-06 |
| 3. B | P23253 | Sialidase | 6.76e-02 | NA | 1.84e-08 |
| 3. B | Q6ZV65 | Protein FAM47E | 2.66e-01 | NA | 7.27e-27 |
| 3. B | Q71M42 | Protocadherin-11 X-linked | 9.95e-01 | NA | 7.89e-07 |
| 3. B | P12255 | Filamentous hemagglutinin | NA | NA | 7.70e-06 |
| 3. B | P08116 | Processed variable antigen (Fragment) | 9.90e-01 | NA | 1.52e-04 |
| 3. B | A6NHR8 | Putative protein FAM47D | 1.64e-01 | NA | 4.33e-99 |
| 3. B | Q6WYY1 | Protocadherin-11 X-linked | 9.91e-01 | NA | 8.37e-07 |
| 3. B | Q6X862 | Protocadherin-11 X-linked | 9.91e-01 | NA | 4.15e-06 |
| 3. B | Q9BZA8 | Protocadherin-11 Y-linked | 9.92e-01 | NA | 1.27e-05 |