Summary

Q5HYW3

Homolog: Q5DTT4.
Function: Retrotransposon Gag-like protein 5.

Statistics

Total GO Annotation: 58
Unique PROST Go: 21
Unique BLAST Go: 33

Total Homologs: 53
Unique PROST Homologs: 25
Unique BLAST Homologs: 25

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5DTT4 (Retrotransposon Gag-like protein 5) with a FATCAT P-Value: 8.06e-08 and RMSD of 7.42 angstrom. The sequence alignment identity is 67.2%.
Structural alignment shown in left. Query protein Q5HYW3 colored as red in alignment, homolog Q5DTT4 colored as blue. Query protein Q5HYW3 is also shown in right top, homolog Q5DTT4 showed in right bottom. They are colored based on secondary structures. 

  Q5HYW3 MSEASGNLNSLRMANVALREELNALRGENANLGLQLGRALAEVNSLRGNVSSYIRWPVPIVPVLAEENLEFALSEIEVIP------GGELPFLCRPPPRA 94
  Q5DTT4 MSEAAGNLNSLRLANVALREELNALRGENVQLGLQLGRALAEVNSLRGNVSSYIRWPMPIVPVLAEENFEFLLNETDPTPEEEEEEEEEVPFLCWPPPRT 100

  Q5HYW3 EPDCISDDLLINVIQDRSTPDGPADPPLLPIPPPPALPPPASKEPPPQPPLAPLERPEIEPFSGDPVYLAEFLMQLETFIADHEVHFPGGAERVAFLISF 194
  Q5DTT4 DPEYVSDDLLINVVQDYTNPDGSSDPPLSPSPSQPELHSPMLKEPTFEFLLPPLERPDIEPFSGDPVYLAEFLMQLETFIADHEDHFPGGAERVAFLISF 200

  Q5HYW3 FTGEAKDWAISVTQEGSPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEFFRKELLWSTEM 294
  Q5DTT4 FTGEARDWAISVTQEGSSLHANFPRFLDEIRKEFCGPIPSRVAKKAIRKLKQGNCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEIFRKELLWSTEV 300

  Q5HYW3 ADLDELILECVEIERKVRVPKPIPLPGVRNIIFPFAPSPNEEESEDEEYYSED--EDQEARRHRLHSKDQRKRMRAFQQEMKEKEEEEMKKEE-EMKKKE 391
  Q5DTT4 ADLDELILECVKIERKVRVPKTASLTGVQNSCCPFALIPNEDENEGVEFYSENEGEGEEAGGYRLYLKDQRQHMTAFPQEMRE-EEEEMRKEEDEMEDEE 399

  Q5HYW3 EKEEEEEEEMKQKEEEEEIRNKNEEEGESKDEEDE--DEDGG-QKPEG---------EPQQDPGTEE-----TYGEVEE------EPLDEAQDDDLD-EL 467
  Q5DTT4 DEDEDEDYEFEEEDEDDDDEEEEEEEEEEEDKEEEMKNEDSDENKYEEEDEVIVRVLEPEQEQEREEIEHEHVY--VHEHIHAHVHTL-AAHHHGLHGEL 496

  Q5HYW3 MEM-EPTFVHASSQTSGPTSGYHAENFLGASPPIIQPSRRRNQNRVPLLEGLPGTNSPFYSSPQLIRRTGRLGQRQVRRRPPVLFRLTPRQGGHRAARGR 566
  Q5DTT4 MVMDEPVLVDTSTQTISSAIGYHAENYLGVSPSVMHSSRQRSQNRVPLLEGLPGTNSSFYSPPPLMRHAGRLGQRQMRRCPSVLFCLTPRQGGHRATQGR 596

  Q5HYW3 IRV 569
  Q5DTT4 IRV 599

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0050890 cognition
1. PB GO:0042415 norepinephrine metabolic process
1. PB GO:0008270 zinc ion binding
1. PB GO:0003676 nucleic acid binding
2. P GO:0042025 host cell nucleus
2. P GO:0005198 structural molecule activity
2. P GO:0098975 postsynapse of neuromuscular junction
2. P GO:0046718 viral entry into host cell
2. P GO:1903561 extracellular vesicle
2. P GO:0016020 membrane
2. P GO:0019013 viral nucleocapsid
2. P GO:0032197 transposition, RNA-mediated
2. P GO:0075732 viral penetration into host nucleus
2. P GO:0042595 behavioral response to starvation
2. P GO:0039702 viral budding via host ESCRT complex
2. P GO:0110077 vesicle-mediated intercellular transport
2. P GO:0000943 retrotransposon nucleocapsid
2. P GO:0003012 muscle system process
2. P GO:0072494 host multivesicular body
2. P GO:0048168 regulation of neuronal synaptic plasticity
2. P GO:0042802 identical protein binding
2. P GO:0039620 T=7 icosahedral viral capsid
2. P GO:0055036 virion membrane
2. P GO:0030017 sarcomere
2. P GO:0020002 host cell plasma membrane
3. B GO:0007018 microtubule-based movement
3. B GO:0044650 adhesion of symbiont to host cell
3. B GO:0030286 dynein complex
3. B GO:0071225 cellular response to muramyl dipeptide
3. B GO:0001893 maternal placenta development
3. B GO:0030154 cell differentiation
3. B GO:0045505 dynein intermediate chain binding
3. B GO:0016324 apical plasma membrane
3. B GO:0060137 maternal process involved in parturition
3. B GO:0044409 entry into host
3. B GO:0051959 dynein light intermediate chain binding
3. B GO:1990225 rhoptry neck
3. B GO:0046789 host cell surface receptor binding
3. B GO:0070160 tight junction
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0005875 microtubule associated complex
3. B GO:0006915 apoptotic process
3. B GO:0097345 mitochondrial outer membrane permeabilization
3. B GO:0003777 microtubule motor activity
3. B GO:0098609 cell-cell adhesion
3. B GO:0008201 heparin binding
3. B GO:0051881 regulation of mitochondrial membrane potential
3. B GO:0008569 minus-end-directed microtubule motor activity
3. B GO:0020008 rhoptry
3. B GO:1903547 regulation of growth hormone activity
3. B GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
3. B GO:0005930 axoneme
3. B GO:0071222 cellular response to lipopolysaccharide
3. B GO:0007228 positive regulation of hh target transcription factor activity
3. B GO:0001890 placenta development
3. B GO:0005730 nucleolus
3. B GO:0003774 cytoskeletal motor activity
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZR62 Retrotransposon Gag-like protein 4 3.58e-01 8.13e-06 3.30e-07
1. PB Q5HYW3 Retrotransposon Gag-like protein 5 0 1.52e-139 0.0
1. PB Q5DTT4 Retrotransposon Gag-like protein 5 8.06e-08 1.03e-40 0.0
2. P Q12173 Transposon Ty3-G Gag polyprotein 1.44e-03 4.95e-05 NA
2. P P09519 Probable capsid protein NA 3.33e-02 NA
2. P P03543 Capsid protein NA 1.07e-03 NA
2. P P15832 Gag polyprotein NA 3.55e-02 NA
2. P Q66283 Putative Polyprotein CP NA 3.61e-02 NA
2. P Q5DTT8 Paraneoplastic antigen-like protein 5 1.30e-02 4.41e-02 NA
2. P Q3URY0 Retrotransposon Gag-like protein 4 2.00e-01 4.81e-06 NA
2. P P05399 Probable capsid protein NA 1.07e-04 NA
2. P Q02951 Capsid protein NA 1.25e-03 NA
2. P P03542 Capsid protein NA 3.98e-05 NA
2. P P05891 Gag polyprotein NA 6.87e-03 NA
2. P Q7K1U0 Activity-regulated cytoskeleton associated protein 1 4.19e-04 1.08e-03 NA
2. P P15627 Capsid protein NA 2.30e-04 NA
2. P P05887 Gag polyprotein NA 4.83e-02 NA
2. P P03544 Capsid protein NA 4.20e-05 NA
2. P Q76633 Gag polyprotein NA 3.89e-02 NA
2. P Q96PV4 Paraneoplastic antigen-like protein 5 1.20e-02 3.91e-03 NA
2. P P10405 Retrovirus-related Gag polyprotein from transposon gypsy 3.09e-04 8.01e-03 NA
2. P P27536 Posterior protein 2.87e-03 8.73e-03 NA
2. P Q7TD09 Capsid protein NA 1.66e-04 NA
2. P Q8I7Q0 Retrovirus-related Gag polyprotein from transposon opus 2.63e-02 8.17e-05 NA
2. P Q00956 Capsid protein NA 2.24e-05 NA
2. P Q967S7 Retrovirus-related Gag polyprotein from transposon HMS-Beagle 4.43e-02 1.29e-06 NA
2. P Q99219 Transposon Ty3-I Gag polyprotein 1.50e-03 9.30e-05 NA
2. P Q8JZW8 Paraneoplastic antigen Ma3 homolog 1.75e-02 1.44e-03 NA
3. B Q7TN75 Retrotransposon-derived protein PEG10 2.30e-02 NA 1.10e-18
3. B Q5R6M8 Protein Bop 5.95e-02 NA 0.016
3. B Q1JQ94 Retrotransposon Gag-like protein 8 2.35e-03 NA 9.51e-06
3. B Q8N8U3 Retrotransposon Gag-like protein 3 6.74e-04 NA 1.48e-15
3. B Q17QF6 Protein LDOC1 7.44e-04 NA 6.45e-10
3. B Q6SEH5 Protein LDOC1 4.64e-04 NA 1.47e-10
3. B Q6ICC9 Retrotransposon Gag-like protein 6 3.88e-04 NA 1.34e-18
3. B Q86TG7 Retrotransposon-derived protein PEG10 1.00e-02 NA 9.35e-21
3. B Q7M732 Retrotransposon-like protein 1 5.82e-01 NA 1.03e-13
3. B Q6SEH4 Protein LDOC1 7.60e-04 NA 1.50e-10
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 1.53e-08
3. B Q54LH8 Probable serine/threonine-protein kinase DDB_G0286627 4.90e-01 NA 0.009
3. B Q8IID4 Dynein heavy chain-like protein PF11_0240 NA NA 0.017
3. B Q32KG4 Retrotransposon Gag-like protein 9 2.11e-01 NA 5.38e-10
3. B Q505G4 Retrotransposon Gag-like protein 6 9.86e-05 NA 1.64e-18
3. B A6NKG5 Retrotransposon-like protein 1 1.59e-01 NA 1.42e-15
3. B A6ZKI3 Retrotransposon Gag-like protein 8C 1.76e-03 NA 8.14e-06
3. B Q8NET4 Retrotransposon Gag-like protein 9 2.21e-01 NA 4.38e-10
3. B Q6P1Y1 Retrotransposon Gag-like protein 3 1.78e-03 NA 1.60e-14
3. B Q52QI2 Retrotransposon-like protein 1 1.09e-01 NA 6.88e-11
3. B Q17RB0 Retrotransposon Gag-like protein 8B 1.75e-03 NA 1.52e-06
3. B Q9BWD3 Retrotransposon Gag-like protein 8A 1.91e-03 NA 4.78e-06
3. B Q7TPY9 Protein LDOC1 1.03e-02 NA 4.58e-10
3. B O95751 Protein LDOC1 7.78e-04 NA 1.50e-10
3. B C0H5F4 Reticulocyte-binding protein homolog 2b NA NA 5.35e-05