Summary

Q5JQC4

Homolog: P0C2W7.
Function: Cancer/testis antigen 47B.

Statistics

Total GO Annotation: 25
Unique PROST Go: 17
Unique BLAST Go: 8

Total Homologs: 14
Unique PROST Homologs: 10
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0C2W7 (Cancer/testis antigen 47B) with a FATCAT P-Value: 0.00219 and RMSD of 9.46 angstrom. The sequence alignment identity is 85.3%.
Structural alignment shown in left. Query protein Q5JQC4 colored as red in alignment, homolog P0C2W7 colored as blue. Query protein Q5JQC4 is also shown in right top, homolog P0C2W7 showed in right bottom. They are colored based on secondary structures. 

  Q5JQC4 MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEGLGEEEGEQAAGLAAVPRGGSAEEDSDIGPAT-EEEEEEEG 99
  P0C2W7 MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDMVPAAEVVGVAGPVEGLGEEEGEQAAGLAAVPQGGSAEEDSDIGPATEEEEEEEEG 100

  Q5JQC4 NEAANFDLAVVARRYPASGIHFVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPP-LLLPQRLGAGAAARAGEGLGLI------QEA 192
  P0C2W7 NEAANFDLAVATRRYPAAGIGFVFLYLVHSLLRRLYHNDHIQIANRHLSRLMVGPHAAVPNLWDN-PPLLLLSQRLGAGAAAPEGEGLGLIQEAASVQEA 199

  Q5JQC4 ASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEE---PDA-EEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT 288
  P0C2W7 ASVPEPAVPADLAEMAREPAEEAADEKPPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDVENKVKNSKGT 299

  Q5JQC4  288
  P0C2W7  299

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0051087 chaperone binding
2. P GO:0071031 nuclear mRNA surveillance of mRNA 3'-end processing
2. P GO:0071030 nuclear mRNA surveillance of spliceosomal pre-mRNA splicing
2. P GO:0044877 protein-containing complex binding
2. P GO:0006334 nucleosome assembly
2. P GO:0031011 Ino80 complex
2. P GO:0000722 telomere maintenance via recombination
2. P GO:0005634 nucleus
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:0043044
2. P GO:0032502 developmental process
2. P GO:0008266 poly(U) RNA binding
2. P GO:0071039 nuclear polyadenylation-dependent CUT catabolic process
2. P GO:0030544 Hsp70 protein binding
2. P GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
2. P GO:0006351 transcription, DNA-templated
3. B GO:0005509 calcium ion binding
3. B GO:0042262 DNA protection
3. B GO:0000027 ribosomal large subunit assembly
3. B GO:0030687 preribosome, large subunit precursor
3. B GO:0061631 ubiquitin conjugating enzyme activity
3. B GO:0140603 obsolete ATP hydrolysis activity
3. B GO:0005730 nucleolus
3. B GO:0006364 rRNA processing

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5JQC4 Cancer/testis antigen 47A 0 1.06e-152 0.0
1. PB P0C2W7 Cancer/testis antigen 47B 2.19e-03 7.56e-39 1.39e-123
2. P X1WGV5 Coiled-coil domain-containing protein 32 NA 4.94e-03 NA
2. P A6QL29 Avian agnoprotein 1a NA 2.23e-04 NA
2. P A0LJ43 DNA-directed RNA polymerase subunit omega 6.29e-01 1.24e-02 NA
2. P P53725 M-phase phosphoprotein 6 homolog 2.20e-01 3.64e-02 NA
2. P Q6ZSJ8 Uncharacterized protein C1orf122 9.45e-02 4.89e-02 NA
2. P Q5ZM46 Protein LBH 4.01e-01 2.13e-02 NA
2. P Q9BLJ6 BAG domain-containing protein Samui 8.32e-02 5.05e-04 NA
2. P Q6AWX8 Growth-regulating factor 11 3.21e-02 1.14e-02 NA
2. P Q08561 Ino eighty subunit 4 2.20e-01 3.19e-02 NA
2. P Q5R4H5 Nucleosome assembly protein 1-like 5 5.26e-02 3.44e-02 NA
3. B O94248 Midasin NA NA 0.035
3. B Q5UQ88 Probable ubiquitin-conjugating enzyme E2 R521 NA NA 0.014