Summary

Q5JRC9

Homolog: Q8NA70.
Function: Protein FAM47B.

Statistics

Total GO Annotation: 131
Unique PROST Go: 126
Unique BLAST Go: 5

Total Homologs: 95
Unique PROST Homologs: 90
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8NA70 (Protein FAM47B) with a FATCAT P-Value: 0.000478 and RMSD of 13.01 angstrom. The sequence alignment identity is 57.4%.
Structural alignment shown in left. Query protein Q5JRC9 colored as red in alignment, homolog Q8NA70 colored as blue. Query protein Q5JRC9 is also shown in right top, homolog Q8NA70 showed in right bottom. They are colored based on secondary structures. 

  Q5JRC9 MGDQRLQDWLRSPGMDSKPWYCNKRPSKCFAKCKHRRLRFPPMDTQNWVFVKEGMDDFRYGCPSPEDTLVCRRDEFLLPKISLRGPQADPKSGQKKLLKK 100
  Q8NA70 MGDRRPQDRPRSQGMDSKPWYCDKPPSKYFAKRKHRRLRFPPVDTQNWVFVTEGMDDFRYACQSPEDTLVCRRDEFLLPKISLRGPQADRKSRKKKLLKK 100

  Q5JRC9 AALFSKLSPAQLARKAFVEQVEAQLMAKHPLAMYPNLGEDMPPDLLLQVLKHLDPERELEDAWACCETQEKTTEVPTEPGKHPCGEFCLKPPETPVSHLL 200
  Q8NA70 AALFSELSPVQPARKAFVEEVEAQLMTKHPLAMYPNLGKDMPPDLLLQVLKQLDPERKLEDAWARCEAREKTTEVPTESGKYPCGESCPRPPETPVSRLR 200

  Q5JRC9 PEPPETGVSHLSPEPPKTPVSSLRPEPPETGVSHLRPEPPETGVSHIRPGPPITRRRSSLLRQLLKLDSERKLEDARAPCEGREKTTDEPTEPGKYPCGK 300
  Q8NA70 PQLPKTPVSSRRPEPPKTRVSSLRPEPPKTRVSSLHPEPPETRASHLR------------------VD----------P----------P---------- 252

  Q5JRC9 FCPRPFETPLSHLRQEPPKTPVSSLRPEPPETGESHLRLEHSKTRRGSSLRSEPSETGVSRLRLAPPKTRRGSSLHAEPSKTGVSHLSPEPPKTEVSHLH 400
  Q8NA70 ------ETGVSHLCPEPPKTLVSSVHPEPPDTGASHL---------------CP----------EPPETRV-SHLHPEPPETGVSHLRPEPSKTQVSSLC 320

  Q5JRC9 PVPPKTGVCHLRLEPPDTSQVSNLLLYILKVLDSGRTLKDVWDRCEARVKKTKEPTEPHKSPCGEPCLQPPETQVSHPHPEHPKTRRRSSLHSQPPKTRR 500
  Q8NA70 PEPPEAGVSHLCLEPPNTHRVSSFLLQVLK-LDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRM--PH-------LRLVL----PITRR 406

  Q5JRC9 TSSLRSEPPKTRRTSSLRSEPPKTRRTSSLGPEPPKTRRVSSLRPELPKSRRVSSLHPEPPKAPESHQFSEPPKIRASYIKELLQEDTPSTKECVSDSLQ 600
  Q8NA70 MASL-----------CLK--PPKTRRVSSLCPEPTKT--------------------------------------GASHLKELFQEDTPSTMECVSDSLQ 455

  Q5JRC9 YRYTSEKLREFFKWAGDLGADEESIRNLFDFTPKYRATHEDQKFKKVKECSSELKYSMELDEKDEDKFFSQEKYWGRKFHTPSNSYTAQRVKMKYGAWYL 700
  Q8NA70 RRHTSRKLRD-FKWAGDLGVNEESISSLFDFTPECRTTDQDQKIKKANECASRLMYGMELDDMDEVEFL-RIKYWDRRRRAAPHSYSAQRGRIRYGPWYF 553

  Q5JRC9 KPKLWKKLRSDEPLIDPKLLLKKPDEPDVLDDLYGPIAFKDFILSKGYEMPGIIQRLFARRGWTYDSVKTPIQRAMIFYKYKE-IVEASEED 791
  Q8NA70 EPKLGKKLRSDEPLIDPKPVLEKPDEPDILDGLYGPIAFKDFILSKGYRMPGVIEKLFAKKGWTYDSVKTPIQRAVQVYKYKEDVTDASKED 645

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1904312 cellular response to gold(3+)
2. P GO:0044853 plasma membrane raft
2. P GO:0032886 regulation of microtubule-based process
2. P GO:0060789 hair follicle placode formation
2. P GO:0032039 integrator complex
2. P GO:1903573 negative regulation of response to endoplasmic reticulum stress
2. P GO:0042994 cytoplasmic sequestering of transcription factor
2. P GO:1904308 cellular response to desipramine
2. P GO:0034501 protein localization to kinetochore
2. P GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
2. P GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:0034472 snRNA 3'-end processing
2. P GO:0030953 astral microtubule organization
2. P GO:1904310 cellular response to cordycepin
2. P GO:0005796 Golgi lumen
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0090648 response to environmental enrichment
2. P GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
2. P GO:0072732 cellular response to calcium ion starvation
2. P GO:0090281 negative regulation of calcium ion import
2. P GO:0031134 sister chromatid biorientation
2. P GO:0030017 sarcomere
2. P GO:0030669 clathrin-coated endocytic vesicle membrane
2. P GO:0000128 flocculation
2. P GO:1990441 negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
2. P GO:0045667 regulation of osteoblast differentiation
2. P GO:0015891 siderophore transport
2. P GO:1901899 positive regulation of relaxation of cardiac muscle
2. P GO:0000793 condensed chromosome
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0035308 negative regulation of protein dephosphorylation
2. P GO:0019903 protein phosphatase binding
2. P GO:0072542 protein phosphatase activator activity
2. P GO:0030414 peptidase inhibitor activity
2. P GO:0050902 leukocyte adhesive activation
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0050817 coagulation
2. P GO:0016604 nuclear body
2. P GO:0090543 Flemming body
2. P GO:1902465 negative regulation of histone H3-K27 trimethylation
2. P GO:1901844 regulation of cell communication by electrical coupling involved in cardiac conduction
2. P GO:0005788 endoplasmic reticulum lumen
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
2. P GO:1903917 positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation
2. P GO:0050900 leukocyte migration
2. P GO:0030140 trans-Golgi network transport vesicle
2. P GO:0032515 negative regulation of phosphoprotein phosphatase activity
2. P GO:0022027 interkinetic nuclear migration
2. P GO:1903898 negative regulation of PERK-mediated unfolded protein response
2. P GO:0010168 ER body
2. P GO:0110148 biomineralization
2. P GO:0001533 cornified envelope
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0090650 cellular response to oxygen-glucose deprivation
2. P GO:0018149 peptide cross-linking
2. P GO:0000182 rDNA binding
2. P GO:0050901 leukocyte tethering or rolling
2. P GO:0048388 endosomal lumen acidification
2. P GO:0030154 cell differentiation
2. P GO:0010460 positive regulation of heart rate
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0031848 protection from non-homologous end joining at telomere
2. P GO:0002020 protease binding
2. P GO:0045943 positive regulation of transcription by RNA polymerase I
2. P GO:0010466 negative regulation of peptidase activity
2. P GO:0030097 hemopoiesis
2. P GO:0019901 protein kinase binding
2. P GO:0035902 response to immobilization stress
2. P GO:0071236 cellular response to antibiotic
2. P GO:0048599 oocyte development
2. P GO:0070972 protein localization to endoplasmic reticulum
2. P GO:0032516 positive regulation of phosphoprotein phosphatase activity
2. P GO:1903494 response to dehydroepiandrosterone
2. P GO:0032058 positive regulation of translational initiation in response to stress
2. P GO:0031424 keratinization
2. P GO:0031386 protein tag
2. P GO:0022408 negative regulation of cell-cell adhesion
2. P GO:0033138 positive regulation of peptidyl-serine phosphorylation
2. P GO:1903496 response to 11-deoxycorticosterone
2. P GO:0034976 response to endoplasmic reticulum stress
2. P GO:0033135 regulation of peptidyl-serine phosphorylation
2. P GO:1902850 microtubule cytoskeleton organization involved in mitosis
2. P GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
2. P GO:0020016 ciliary pocket
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0040024 dauer larval development
2. P GO:0030968 endoplasmic reticulum unfolded protein response
2. P GO:0006915 apoptotic process
2. P GO:0071322 cellular response to carbohydrate stimulus
2. P GO:0001520 outer dense fiber
2. P GO:0110143 magnetosome
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:1900005 positive regulation of serine-type endopeptidase activity
2. P GO:0009640 photomorphogenesis
2. P GO:0010955 negative regulation of protein processing
2. P GO:0099503 secretory vesicle
2. P GO:0032184 SUMO polymer binding
2. P GO:1904314 cellular response to methamphetamine hydrochloride
2. P GO:0001931 uropod
2. P GO:0031154 culmination involved in sorocarp development
2. P GO:0071933 Arp2/3 complex binding
2. P GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
2. P GO:0060236 regulation of mitotic spindle organization
2. P GO:0045823 positive regulation of heart contraction
2. P GO:0004791 thioredoxin-disulfide reductase activity
2. P GO:0061187 regulation of ribosomal DNA heterochromatin assembly
2. P GO:0014850 response to muscle activity
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0071354 cellular response to interleukin-6
2. P GO:0036496 regulation of translational initiation by eIF2 alpha dephosphorylation
2. P GO:1902310 positive regulation of peptidyl-serine dephosphorylation
2. P GO:0035372 protein localization to microtubule
2. P GO:0080119 ER body organization
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0060734 regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0072703 cellular response to methyl methanesulfonate
2. P GO:0042628 mating plug formation
2. P GO:0009303 rRNA transcription
2. P GO:0070262 peptidyl-serine dephosphorylation
2. P GO:1903169 regulation of calcium ion transmembrane transport
2. P GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0033018 sarcoplasmic reticulum lumen
2. P GO:0005654 nucleoplasm
3. B GO:0034401 obsolete chromatin organization involved in regulation of transcription
3. B GO:0008047 enzyme activator activity
3. B GO:0000785 chromatin
3. B GO:0031062 positive regulation of histone methylation
3. B GO:0071168 protein localization to chromatin

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NA70 Protein FAM47B 4.78e-04 9.42e-29 9.13e-150
1. PB Q5JRC9 Protein FAM47A 0 2.36e-158 0.0
1. PB Q5HY64 Putative protein FAM47C 1.30e-01 1.80e-18 0.0
2. P Q3V4U7 Structural protein ORF567 NA 1.39e-05 NA
2. P O09116 Small proline-rich protein 3 9.56e-01 4.95e-02 NA
2. P P24710 Involucrin 7.66e-01 4.26e-07 NA
2. P Q62170 P-selectin glycoprotein ligand 1 4.32e-01 1.18e-02 NA
2. P E9Q6E9 SUMO-interacting motif-containing protein 1 7.89e-01 4.94e-07 NA
2. P A6NKU9 Speedy protein E3 3.74e-01 1.07e-04 NA
2. P P0DKJ7 Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2 2.73e-02 1.29e-05 NA
2. P Q2W8Q7 Magnetosome-associated protein MamJ 3.65e-01 3.15e-02 NA
2. P Q5UPE4 Collagen-like protein 1 NA 4.05e-02 NA
2. P Q86VQ3 Thioredoxin domain-containing protein 2 1.02e-01 4.95e-02 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 2.17e-01 3.82e-05 NA
2. P P17564 Protein phosphatase 1 regulatory subunit 15A 2.53e-01 1.76e-04 NA
2. P P08462 Submandibular gland secretory Glx-rich protein CB 4.24e-01 6.56e-03 NA
2. P O88492 Perilipin-4 7.86e-01 1.06e-02 NA
2. P Q6IN02 Protein phosphatase 1 regulatory subunit 15A 2.89e-01 4.85e-02 NA
2. P Q03650 Cysteine-rich, acidic integral membrane protein 9.97e-01 1.22e-02 NA
2. P Q5XPK0 Scar-like domain-containing protein WAVE 5 7.85e-01 1.76e-02 NA
2. P P43537 Uncharacterized membrane protein YFL067W 7.16e-01 8.65e-03 NA
2. P Q9UKN1 Mucin-12 NA 2.49e-02 NA
2. P Q7Z2K8 G protein-regulated inducer of neurite outgrowth 1 2.80e-01 3.00e-04 NA
2. P Q6NU13 Protein SPT2 homolog 9.99e-02 1.93e-03 NA
2. P Q9LTJ8 Methyl-CpG-binding domain-containing protein 13 1.94e-01 4.63e-09 NA
2. P Q4ZJY7 Mucin-like protein Glc1.8b NA 1.26e-02 NA
2. P Q86MA7 Protein PRQFV-amide 5.86e-01 1.58e-03 NA
2. P V6F519 Magnetosome-associated protein MamJ 1.60e-01 6.04e-05 NA
2. P P19228 Alpha-S1-casein 8.63e-01 3.56e-03 NA
2. P Q149B8 PGC-1 and ERR-induced regulator in muscle protein 1 8.03e-02 1.36e-05 NA
2. P Q5SSG8 Mucin-21 8.01e-01 4.47e-03 NA
2. P Q8N307 Mucin-20 3.57e-01 1.57e-03 NA
2. P P18175 Involucrin 4.66e-01 2.87e-03 NA
2. P A5D7L8 PGC-1 and ERR-induced regulator in muscle protein 1 2.96e-01 1.06e-06 NA
2. P P84996 Protein ALEX 4.70e-01 4.66e-02 NA
2. P O74876 Meiotically up-regulated gene 135 protein 7.18e-01 4.61e-03 NA
2. P P04672 Nodulin-44 4.73e-01 6.76e-04 NA
2. P P0CG50 Polyubiquitin-C 9.96e-01 4.19e-03 NA
2. P Q7T2B3 Protein SLX4IP 1.88e-01 2.67e-04 NA
2. P Q95JY5 Sterile alpha motif domain-containing protein 15 1.14e-01 6.11e-04 NA
2. P Q14242 P-selectin glycoprotein ligand 1 4.48e-02 4.10e-03 NA
2. P P62976 Polyubiquitin 9.96e-01 2.05e-04 NA
2. P Q9URU4 Putative cell agglutination protein pfl5 9.77e-01 4.48e-02 NA
2. P F4ICX9 TSK-associating protein 1 7.91e-01 2.30e-03 NA
2. P Q9HCK1 DBF4-type zinc finger-containing protein 2 5.93e-01 4.66e-02 NA
2. P E5AV36 Burkholderia TALE-like protein 1 9.95e-01 2.50e-06 NA
2. P Q80YD3 Protein FAM205C 2.38e-01 3.93e-02 NA
2. P A6NJ88 Putative SAGE1-like protein 7.51e-01 4.41e-12 NA
2. P O75807 Protein phosphatase 1 regulatory subunit 15A 4.49e-01 6.92e-03 NA
2. P Q8TFG4 Uncharacterized protein PB18E9.04c 9.69e-01 1.17e-05 NA
2. P P0C728 Uncharacterized protein LF3 NA 7.46e-03 NA
2. P P13492 Antigen 10-3 8.41e-01 1.39e-02 NA
2. P O43493 Trans-Golgi network integral membrane protein 2 1.40e-01 3.67e-02 NA
2. P P54681 Protein rtoA 9.91e-01 4.71e-02 NA
2. P Q9JJ11 Transforming acidic coiled-coil-containing protein 3 3.00e-01 4.87e-03 NA
2. P P0C727 Uncharacterized protein LF3 NA 7.46e-03 NA
2. P P0CV57 Secreted RxLR effector protein 138 2.34e-01 1.32e-08 NA
2. P P48998 Involucrin 2.06e-01 3.03e-05 NA
2. P Q9XVS4 Nucleolar protein dao-5 9.83e-02 5.51e-04 NA
2. P Q5UP72 Uncharacterized protein R604 NA 7.34e-07 NA
2. P Q0P6D6 Coiled-coil domain-containing protein 15 3.49e-01 2.33e-03 NA
2. P Q9PU53 Telomeric repeat-binding factor 2 1.74e-01 3.40e-06 NA
2. P Q5SV97 PGC-1 and ERR-induced regulator in muscle protein 1 7.01e-02 6.18e-09 NA
2. P F1LWT0 SUMO-interacting motif-containing protein 1 7.15e-01 2.28e-06 NA
2. P B1B0V2 EZH inhibitory protein 1.75e-01 3.06e-08 NA
2. P E5AW45 Burkholderia TALE-like protein 2 9.97e-01 4.10e-03 NA
2. P P22006 Seminal vesicle secretory protein 2 7.15e-01 4.09e-02 NA
2. P O46383 Sodium/potassium/calcium exchanger 1 (Fragment) 8.26e-01 1.24e-02 NA
2. P P23327 Sarcoplasmic reticulum histidine-rich calcium-binding protein 1.11e-01 1.15e-03 NA
2. P P97347 Repetin 3.82e-01 9.91e-03 NA
2. P P14590 Involucrin 6.80e-01 2.25e-03 NA
2. P P33666 Exported protein YdbA 9.32e-01 4.87e-03 NA
2. P P81592 Acaloleptin A 9.50e-01 4.33e-03 NA
2. P Q9P1V8 Sterile alpha motif domain-containing protein 15 4.88e-02 1.14e-04 NA
2. P Q27905 Probable antibacterial peptide polyprotein 9.38e-01 1.30e-03 NA
2. P Q9LSB4 TSA1-like protein 8.94e-01 3.22e-04 NA
2. P P0CG48 Polyubiquitin-C 9.95e-01 3.12e-02 NA
2. P Q9NXZ1 Sarcoma antigen 1 9.18e-01 2.18e-10 NA
2. P A0A0U1RQI7 Kruppel-like factor 18 9.43e-01 2.47e-02 NA
2. P Q4ZJZ0 Mucin-like protein Glc1.8a NA 4.76e-02 NA
2. P Q9ERZ0 Hemogen 4.82e-02 8.15e-05 NA
2. P O24006 Antimicrobial peptides 9.49e-01 4.44e-02 NA
2. P P0CH28 Polyubiquitin-C 9.95e-01 1.55e-03 NA
2. P Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 9.95e-01 2.90e-04 NA
2. P Q04433 Facilitator of iron transport 1 2.67e-01 4.18e-02 NA
2. P P48997 Involucrin 6.78e-01 4.71e-02 NA
2. P Q96M34 Testis-specific expressed protein 55 3.60e-01 2.49e-05 NA
2. P P0DKJ8 Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2 2.10e-01 2.84e-06 NA
2. P Q8K327 Chromosome alignment-maintaining phosphoprotein 1 1.50e-01 7.70e-03 NA
2. P Q96JM3 Chromosome alignment-maintaining phosphoprotein 1 1.05e-01 2.80e-04 NA
2. P Q6P902 Thioredoxin domain-containing protein 2 2.90e-01 1.10e-05 NA
2. P Q6AZ54 Hemogen 3.06e-01 1.95e-04 NA
2. P P16230 Sarcoplasmic reticulum histidine-rich calcium-binding protein 5.18e-01 3.80e-03 NA
3. B A6NHR8 Putative protein FAM47D 1.36e-01 NA 5.49e-109
3. B Q6ZV65 Protein FAM47E 1.01e-01 NA 2.43e-31