Summary

Q5JRK9

Homolog: Q7Z2X7.
Function: P antigen family member 2.

Statistics

Total GO Annotation: 64
Unique PROST Go: 57
Unique BLAST Go: 4

Total Homologs: 68
Unique PROST Homologs: 52
Unique BLAST Homologs: 10

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q7Z2X7 (P antigen family member 2) with a FATCAT P-Value: 5.61e-10 and RMSD of 2.73 angstrom. The sequence alignment identity is 93.7%.
Structural alignment shown in left. Query protein Q5JRK9 colored as red in alignment, homolog Q7Z2X7 colored as blue. Query protein Q5JRK9 is also shown in right top, homolog Q7Z2X7 showed in right bottom. They are colored based on secondary structures. 

  Q5JRK9 MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDL 100
  Q7Z2X7 MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDL 100

  Q5JRK9 TKVLEAGDAQP 111
  Q7Z2X7 TKVLEAGDAQP 111

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0032872 regulation of stress-activated MAPK cascade
1. PB GO:1903202 negative regulation of oxidative stress-induced cell death
1. PB GO:1903427 negative regulation of reactive oxygen species biosynthetic process
2. P GO:0001708 cell fate specification
2. P GO:0009306 protein secretion
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0047555 3',5'-cyclic-GMP phosphodiesterase activity
2. P GO:0061564 axon development
2. P GO:0045746 negative regulation of Notch signaling pathway
2. P GO:0050896 response to stimulus
2. P GO:0007601 visual perception
2. P GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
2. P GO:0007423 sensory organ development
2. P GO:0019031 viral envelope
2. P GO:0140538 negative regulation of conjugation with zygote
2. P GO:0030430 host cell cytoplasm
2. P GO:0004857 enzyme inhibitor activity
2. P GO:1905048 regulation of metallopeptidase activity
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0005102 signaling receptor binding
2. P GO:0030291 protein serine/threonine kinase inhibitor activity
2. P GO:0007219 Notch signaling pathway
2. P GO:0000187 obsolete activation of MAPK activity
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0031386 protein tag
2. P GO:0042393 histone binding
2. P GO:0005163 nerve growth factor receptor binding
2. P GO:0017053 transcription repressor complex
2. P GO:0030991 intraciliary transport particle A
2. P GO:0034728 nucleosome organization
2. P GO:0030071 regulation of mitotic metaphase/anaphase transition
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0008233 peptidase activity
2. P GO:0051983 regulation of chromosome segregation
2. P GO:0007275 multicellular organism development
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0007165 signal transduction
2. P GO:0042622 photoreceptor outer segment membrane
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:0043985 histone H4-R3 methylation
2. P GO:1904824 anaphase-promoting complex assembly
2. P GO:0005634 nucleus
2. P GO:0001835 blastocyst hatching
2. P GO:0030476 ascospore wall assembly
2. P GO:0007517 muscle organ development
2. P GO:0005680 anaphase-promoting complex
2. P GO:0010498 proteasomal protein catabolic process
2. P GO:0019083 viral transcription
2. P GO:0005801 cis-Golgi network
2. P GO:0000118 histone deacetylase complex
2. P GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
2. P GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
2. P GO:0030553 cGMP binding
2. P GO:0016922 nuclear receptor binding
2. P GO:0050699 WW domain binding
2. P GO:0070490 protein pupylation
2. P GO:0019069 viral capsid assembly
2. P GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
2. P GO:0070628 proteasome binding
2. P GO:0110046 signal transduction involved in cell cycle switching, mitotic to meiotic cell cycle
3. B GO:0003713 transcription coactivator activity
3. B GO:0006979 response to oxidative stress
3. B GO:0042594 response to starvation
3. B GO:0043066 negative regulation of apoptotic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5JRK9 Putative G antigen family E member 3 0 2.35e-140 1.16e-74
1. PB Q8WTP9 X antigen family member 3 1.21e-02 4.76e-04 4.59e-09
1. PB O60829 P antigen family member 4 2.65e-02 2.70e-04 1.92e-09
1. PB Q7Z2X7 P antigen family member 2 5.61e-10 3.30e-38 2.71e-69
1. PB Q5JUK9 P antigen family member 3 3.78e-02 3.68e-07 2.37e-14
1. PB Q96GU1 P antigen family member 5 2.89e-03 5.37e-08 2.24e-62
2. P Q00994 Protein BEX3 1.71e-02 2.93e-02 NA
2. P A5PJD3 Coordinator of PRMT5 and differentiation stimulator 4.12e-02 3.25e-03 NA
2. P Q9BSF0 Small membrane A-kinase anchor protein 2.10e-01 1.29e-04 NA
2. P A9WSI2 Prokaryotic ubiquitin-like protein Pup 2.54e-01 5.31e-03 NA
2. P Q54C62 Putative uncharacterized protein DDB_G0293150 3.81e-02 2.43e-02 NA
2. P Q5H9J7 Protein BEX5 4.28e-01 1.26e-02 NA
2. P Q9P534 Histone H2A.Z-specific chaperone chz-1 1.99e-02 2.08e-02 NA
2. P Q9CQ13 Coordinator of PRMT5 and differentiation stimulator 5.79e-02 6.67e-03 NA
2. P Q5YUX1 Prokaryotic ubiquitin-like protein Pup 3.06e-01 2.49e-03 NA
2. P Q12191 Binder of USO1 and GRH1 protein 1 6.61e-01 2.77e-02 NA
2. P Q9CZY2 Transcription elongation factor A protein-like 8 1.55e-02 6.12e-07 NA
2. P B1W305 Prokaryotic ubiquitin-like protein Pup 5.20e-01 7.36e-03 NA
2. P P07242 Late transcription elongation factor H5 NA 9.23e-03 NA
2. P Q8IYN2 Transcription elongation factor A protein-like 8 3.10e-02 1.93e-02 NA
2. P P08090 21 kDa protein inducing meiosis and sporulation 3.64e-02 1.49e-02 NA
2. P A0JWY5 Prokaryotic ubiquitin-like protein Pup 2.75e-01 2.74e-02 NA
2. P Q13956 Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma 6.48e-01 4.73e-02 NA
2. P Q3T020 Transcription elongation factor A protein-like 8 8.88e-03 8.47e-06 NA
2. P P0CG90 Prokaryotic ubiquitin-like protein Pup 1.82e-01 5.36e-06 NA
2. P P22571 Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma 9.77e-02 4.42e-04 NA
2. P Q6C818 Ribosome assembly protein 3 4.60e-02 1.28e-03 NA
2. P C4LIL0 Prokaryotic ubiquitin-like protein Pup 9.08e-02 1.82e-03 NA
2. P P43359 Putative melanoma-associated antigen 5P 1.05e-02 5.24e-04 NA
2. P Q96N06 Spermatogenesis-associated protein 33 3.82e-03 9.05e-03 NA
2. P Q10239 Histone H2A.Z-specific chaperone chz1 4.54e-02 1.70e-02 NA
2. P B8H8L5 Prokaryotic ubiquitin-like protein Pup 2.99e-01 1.77e-02 NA
2. P C0ZZU8 Prokaryotic ubiquitin-like protein Pup 3.93e-01 1.57e-03 NA
2. P B5X392 Proline-rich nuclear receptor coactivator 2 1.69e-01 1.87e-02 NA
2. P A1SK12 Prokaryotic ubiquitin-like protein Pup 4.45e-01 2.36e-02 NA
2. P A8M2A2 Prokaryotic ubiquitin-like protein Pup 8.04e-02 2.77e-02 NA
2. P O70791 Protein 6 NA 7.74e-03 NA
2. P A1CQS5 Histone H2A.Z-specific chaperone chz1 9.71e-02 4.09e-03 NA
2. P Q2UBH8 Histone H2A.Z-specific chaperone chz1 4.07e-02 4.43e-03 NA
2. P Q12379 Anaphase-promoting complex subunit SWM1 4.30e-01 6.69e-04 NA
2. P Q5UQR7 Uncharacterized protein L324 NA 2.04e-02 NA
2. P Q9H4R4 Putative nuclear receptor corepressor 1-like protein NCOR1P1 3.96e-02 2.29e-02 NA
2. P Q6I7R5 Transcription elongation factor A protein-like 8 7.41e-03 9.09e-06 NA
2. P Q53082 Prokaryotic ubiquitin-like protein Pup 2 4.92e-01 1.57e-03 NA
2. P P0C8M3 Small vasohibin-binding protein 1.02e-01 4.95e-03 NA
2. P Q38036 Internal scaffolding protein B NA 6.29e-03 NA
2. P P13095 Enhancer of split m4 protein 3.68e-01 1.20e-02 NA
2. P Q0SIF8 Prokaryotic ubiquitin-like protein Pup 5.44e-01 3.64e-02 NA
2. P P24359 Protein F7 NA 1.24e-02 NA
2. P P31278 Internal scaffolding protein B NA 6.87e-03 NA
2. P Q3B8E9 Intraflagellar transport protein 43 homolog 1.44e-01 1.16e-02 NA
2. P Q3ZBJ9 Protein BEX5 7.17e-02 5.03e-04 NA
2. P P20538 Late transcription elongation factor H5 NA 4.43e-03 NA
2. P O97178 Enhancer of split malpha protein 2.20e-01 3.97e-03 NA
2. P Q6BWS4 Ribosome assembly protein 3 6.59e-02 8.37e-03 NA
2. P Q828J0 Prokaryotic ubiquitin-like protein Pup 5.57e-01 6.10e-03 NA
2. P Q9US01 Uncharacterized protein C664.13 5.00e-01 1.72e-02 NA
2. P A8LH55 Prokaryotic ubiquitin-like protein Pup 2.99e-01 5.10e-03 NA
3. B O76087 G antigen 7 3.94e-02 NA 0.033
3. B Q96GT9 X antigen family member 2 1.13e-02 NA 2.46e-08
3. B O75459 P antigen family member 1 3.12e-02 NA 0.004
3. B Q8WWM1 X antigen family member 5 2.99e-02 NA 1.28e-08
3. B P0CL81 G antigen 12G 7.58e-02 NA 0.033
3. B Q13066 G antigen 2B/2C 5.77e-02 NA 0.027
3. B A1L429 G antigen 12B/C/D/E 1.77e-02 NA 0.047
3. B A6NGK3 G antigen 10 1.92e-02 NA 0.001
3. B P0CL80 G antigen 12F 4.77e-02 NA 0.033
3. B P0CL82 G antigen 12I 2.29e-02 NA 0.033