Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q4KLY0
(Centrosomal protein of 63 kDa) with a FATCAT P-Value: 4.8e-11 and RMSD of 3.66 angstrom. The sequence alignment identity is 15.2%.
Structural alignment shown in left. Query protein Q5M9N0 colored as red in alignment, homolog Q4KLY0 colored as blue.
Query protein Q5M9N0 is also shown in right top, homolog Q4KLY0 showed in right bottom. They are colored based on secondary structures.
Q5M9N0 MESKAWESNNEDLLSSSGVTSNGGSSSSFFVSSIRGTIIENTSSAGTLTQVPFFPKYEVELDSPRKIIPSPGKEHFERVLEEYSHQVKDLQRRLNESNEL 100 Q4KLY0 ---------------------------------------------------------------------------------------------------- 0 Q5M9N0 HEKQKFYLRQSVIDLQTKLQEMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAKCLKEDMLKDSNTQIEQLRKMMLSHEGVLQEIRSILVDFEEAS 200 Q4KLY0 ---------------------------------------------------------------------------------------------------- 0 Q5M9N0 GKKICEHDSMSTLHFRSLGSAISKILRELDTEISYLKGRIFPVEDQLEALKSESQNKIELLLQQHQDRIEQLISEHEVEITG--LTEKASSARSQANSIQ 298 Q4KLY0 ---------------------------------------------------------MEALLEGIQTR------GH----SGGFLT----SCEAELQELM 29 Q5M9N0 SQMEIIQEQARNQNSMYMRQLSDLESTVSQLRS-ELREAKRMYED-KTEELEKQLVLANSELTEARTERDQFSQESGNLD--DQLQKLLADLHKREKELS 394 Q4KLY0 KQIDIM---VAHKKSEWEGQTHALETCLD-MRDRELK-ALRSQLDMK----HKEVGILHQQI-E---EQEKTKQEMA-LEYKEELMKLQEEL-SRLKR-S 113 Q5M9N0 LEKEQNKRLWDRD-TGNSITIDHLRRELDNRNMEVQRL-----EALLKALKSECQGQM--ERQMAAIQGKNESLEKVSS-LTAQLESTKEMLRKVVEELT 485 Q4KLY0 YEKLQKKQL--REFRGN--T-KSLRE--D-RS-EIERLTGKIEEFRQKSLDWEKQ-RLIYQQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESV--ELS 201 Q5M9N0 AKKMTLESSERTISDLTTSLQEKERAIE--ATNAEITKLRSRVDLKLQELQHLKNEGDHLR--NVQTECEALKLQMTEKDKVIEILRQQIENMTQLVGQH 581 Q4KLY0 SQ------SE--IQHLSSKL---ERAKDTICAN-EL-EIE-RLNIRVKDLM-----GTNVTILQEQRQKEE-KLR--ESEKLLEALQ---EEQKEL---- 272 Q5M9N0 GRTAGAMQVEKAQLE-KE--INDRRMELKELKI-LK--DKKDAKIRELEARVSDLELEKVKLVNAGS---ER-LRAVKDIKQERDQLLNE---------- 661 Q4KLY0 ----------KASLQAQESFILDAKMQEK-LQTKLKAVDTKHSVERSLE----DCQVER-KYSSSGQGVLDNVLSQL-DISHSSEELLQAEVTRLEGSLE 355 Q5M9N0 -VKTSRSELNN-LSEEYEVLKRNFRNKSEEMEMT-TNKLKMQLKSAQSELEQTRNTLKSMEGSDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMT 758 Q4KLY0 SVSTTCKQLSQELMEKYEELKR-MEGHNNEYR-TEIKKLKEQILQA----DQTYSS--ALEG-----MKTEI---SQLT--R-ELH--QRDITIASAKCS 434 Q5M9N0 NANKEKHFLKEEKSKLSQELSTVATEKNKMAGELEVLRSQERRLKEKVTNMEVALDKASLQFAECQDIIQR-QEQESVR---LKLQHTLD--IKELQGPG 852 Q4KLY0 SSDMERQ-LKAEMQK-AEE---KAVEHKEILSQLESLRLENRRLSETVMKLELGLHECSMPVSPLGLIATRFLEEEELRSHHI-LER-LDAHIEELKRE- 526 Q5M9N0 YTSNSSLK--PRLLQPASVTRSHSNVPSSQSTASFLSHHSTKANTLKEDPTRDLKQLLQELRSVINEEPAVSLSKTEEDGRTSLGALEDRVRDCITESSL 950 Q4KLY0 --SEKTVRQFTALV-------------------------------------------------------------------------------------- 538 Q5M9N0 RSDMCHRSNNSLRDSTEGSKSSETLSREPVTLHAGDREDPSGCFTFTSAASPSVKNSASRSFNSSPKKSPVHSLLTSSVEGSIGSTSQYRSAKPIHSSDS 1050 Q4KLY0 ---------------------------------------------------------------------------------------------------- 538 Q5M9N0 VKDSQSPPIETTGKTCRKLQNRLESLQTLVEDLQLKNQAMSSMIRNQEKRIQKVKDQEKMLLK 1113 Q4KLY0 --------------------------------------------------------------- 538
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0097539 | ciliary transition fiber |
| 1. PB | GO:0051959 | dynein light intermediate chain binding |
| 1. PB | GO:0005652 | nuclear lamina |
| 1. PB | GO:0051660 | establishment of centrosome localization |
| 1. PB | GO:0006997 | nucleus organization |
| 1. PB | GO:0030705 | cytoskeleton-dependent intracellular transport |
| 1. PB | GO:0005638 | lamin filament |
| 1. PB | GO:0016477 | cell migration |
| 1. PB | GO:0005635 | nuclear envelope |
| 1. PB | GO:0043001 | Golgi to plasma membrane protein transport |
| 1. PB | GO:0071539 | protein localization to centrosome |
| 1. PB | GO:0048278 | vesicle docking |
| 1. PB | GO:0060271 | cilium assembly |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0110092 | nucleus leading edge |
| 2. P | GO:0006611 | protein export from nucleus |
| 2. P | GO:0070530 | K63-linked polyubiquitin modification-dependent protein binding |
| 2. P | GO:0019904 | protein domain specific binding |
| 2. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 2. P | GO:0045141 | meiotic telomere clustering |
| 2. P | GO:1902410 | mitotic cytokinetic process |
| 2. P | GO:0090161 | Golgi ribbon formation |
| 2. P | GO:0034499 | late endosome to Golgi transport |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0010375 | stomatal complex patterning |
| 2. P | GO:0051026 | chiasma assembly |
| 2. P | GO:0047496 | vesicle transport along microtubule |
| 2. P | GO:1903251 | multi-ciliated epithelial cell differentiation |
| 2. P | GO:0048786 | presynaptic active zone |
| 2. P | GO:0044615 | nuclear pore nuclear basket |
| 2. P | GO:0048874 | host-mediated regulation of intestinal microbiota composition |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0023035 | CD40 signaling pathway |
| 2. P | GO:0048193 | Golgi vesicle transport |
| 2. P | GO:0030426 | growth cone |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0071907 | determination of digestive tract left/right asymmetry |
| 2. P | GO:0035092 | sperm DNA condensation |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0007020 | microtubule nucleation |
| 2. P | GO:0048790 | maintenance of presynaptic active zone structure |
| 2. P | GO:0120103 | centriolar subdistal appendage |
| 2. P | GO:0032982 | myosin filament |
| 2. P | GO:0032663 | regulation of interleukin-2 production |
| 2. P | GO:0001673 | male germ cell nucleus |
| 2. P | GO:0097431 | mitotic spindle pole |
| 2. P | GO:0042110 | T cell activation |
| 2. P | GO:0090166 | Golgi disassembly |
| 2. P | GO:0070016 | armadillo repeat domain binding |
| 2. P | GO:0034067 | protein localization to Golgi apparatus |
| 2. P | GO:0010005 | cortical microtubule, transverse to long axis |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:0005154 | epidermal growth factor receptor binding |
| 2. P | GO:0051301 | cell division |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0002756 | MyD88-independent toll-like receptor signaling pathway |
| 2. P | GO:0072518 | Rho-dependent protein serine/threonine kinase activity |
| 2. P | GO:0008356 | asymmetric cell division |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0000802 | transverse filament |
| 2. P | GO:0071910 | determination of liver left/right asymmetry |
| 2. P | GO:0080009 | mRNA methylation |
| 2. P | GO:0007283 | spermatogenesis |
| 2. P | GO:0051878 | lateral element assembly |
| 2. P | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 2. P | GO:0071955 | recycling endosome to Golgi transport |
| 2. P | GO:0044565 | dendritic cell proliferation |
| 2. P | GO:2000114 | regulation of establishment of cell polarity |
| 2. P | GO:0099070 | static microtubule bundle |
| 2. P | GO:0055107 | Golgi to secretory granule transport |
| 2. P | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production |
| 2. P | GO:0042130 | negative regulation of T cell proliferation |
| 2. P | GO:0120229 | protein localization to motile cilium |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0043015 | gamma-tubulin binding |
| 2. P | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 2. P | GO:0036159 | inner dynein arm assembly |
| 2. P | GO:0045098 | type III intermediate filament |
| 2. P | GO:0034162 | toll-like receptor 9 signaling pathway |
| 2. P | GO:0051649 | establishment of localization in cell |
| 2. P | GO:0005816 | spindle pole body |
| 2. P | GO:0010975 | regulation of neuron projection development |
| 2. P | GO:0001965 | G-protein alpha-subunit binding |
| 2. P | GO:0042734 | presynaptic membrane |
| 2. P | GO:0000151 | ubiquitin ligase complex |
| 2. P | GO:0110120 | gamma-tubulin complex localization to nuclear side of mitotic spindle pole body |
| 2. P | GO:1990450 | linear polyubiquitin binding |
| 2. P | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0090316 | positive regulation of intracellular protein transport |
| 2. P | GO:0071958 | new mitotic spindle pole body |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0061024 | membrane organization |
| 2. P | GO:0001947 | heart looping |
| 2. P | GO:0043515 | kinetochore binding |
| 2. P | GO:0043621 | protein self-association |
| 2. P | GO:0070938 | contractile ring |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0032148 | activation of protein kinase B activity |
| 2. P | GO:0000242 | pericentriolar material |
| 2. P | GO:0031593 | polyubiquitin modification-dependent protein binding |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0031682 | G-protein gamma-subunit binding |
| 2. P | GO:0016064 | immunoglobulin mediated immune response |
| 2. P | GO:0120317 | sperm mitochondrial sheath assembly |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0001782 | B cell homeostasis |
| 2. P | GO:0097225 | sperm midpiece |
| 2. P | GO:0045742 | positive regulation of epidermal growth factor receptor signaling pathway |
| 2. P | GO:0003146 | heart jogging |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0061499 | outer plaque of mitotic spindle pole body |
| 2. P | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0042803 | protein homodimerization activity |
| 2. P | GO:0007018 | microtubule-based movement |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0030031 | cell projection assembly |
| 2. P | GO:0051289 | protein homotetramerization |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:0034138 | toll-like receptor 3 signaling pathway |
| 2. P | GO:1900017 | positive regulation of cytokine production involved in inflammatory response |
| 2. P | GO:0043330 | response to exogenous dsRNA |
| 2. P | GO:0050862 | positive regulation of T cell receptor signaling pathway |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0051650 | establishment of vesicle localization |
| 2. P | GO:1903438 | positive regulation of mitotic cytokinetic process |
| 2. P | GO:0034452 | dynactin binding |
| 2. P | GO:0061496 | half bridge of mitotic spindle pole body |
| 2. P | GO:0061760 | antifungal innate immune response |
| 2. P | GO:0043276 | anoikis |
| 2. P | GO:0006915 | apoptotic process |
| 2. P | GO:1902426 | deactivation of mitotic spindle assembly checkpoint |
| 2. P | GO:0003356 | regulation of cilium beat frequency |
| 2. P | GO:0032495 | response to muramyl dipeptide |
| 2. P | GO:0097228 | sperm principal piece |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0140475 | spindle pole body anchor activity |
| 2. P | GO:0042073 | intraciliary transport |
| 2. P | GO:0000795 | synaptonemal complex |
| 2. P | GO:0032740 | positive regulation of interleukin-17 production |
| 2. P | GO:0000137 | Golgi cis cisterna |
| 2. P | GO:0099010 | modification of postsynaptic structure |
| 2. P | GO:0051299 | centrosome separation |
| 2. P | GO:0005801 | cis-Golgi network |
| 2. P | GO:1902236 | negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
| 2. P | GO:0051220 | cytoplasmic sequestering of protein |
| 2. P | GO:0007274 | neuromuscular synaptic transmission |
| 2. P | GO:0032118 | horsetail-astral microtubule organization |
| 2. P | GO:0035372 | protein localization to microtubule |
| 2. P | GO:0051233 | spindle midzone |
| 2. P | GO:0034453 | microtubule anchoring |
| 2. P | GO:0000077 | DNA damage checkpoint signaling |
| 2. P | GO:0035773 | insulin secretion involved in cellular response to glucose stimulus |
| 2. P | GO:0048788 | cytoskeleton of presynaptic active zone |
| 2. P | GO:0099041 | vesicle tethering to Golgi |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0035082 | axoneme assembly |
| 2. P | GO:0098831 | presynaptic active zone cytoplasmic component |
| 2. P | GO:0060050 | positive regulation of protein glycosylation |
| 2. P | GO:0007080 | mitotic metaphase plate congression |
| 2. P | GO:0003413 | chondrocyte differentiation involved in endochondral bone morphogenesis |
| 2. P | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 2. P | GO:2000146 | negative regulation of cell motility |
| 2. P | GO:2000318 | positive regulation of T-helper 17 type immune response |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0000132 | establishment of mitotic spindle orientation |
| 2. P | GO:0098882 | structural constituent of presynaptic active zone |
| 2. P | GO:1902254 | negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:1902440 | protein localization to mitotic spindle pole body |
| 2. P | GO:0030032 | lamellipodium assembly |
| 2. P | GO:0006974 | cellular response to DNA damage stimulus |
| 2. P | GO:0007030 | Golgi organization |
| 2. P | GO:0007052 | mitotic spindle organization |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0051645 | Golgi localization |
| 2. P | GO:0042975 | peroxisome proliferator activated receptor binding |
| 2. P | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 2. P | GO:0034399 | nuclear periphery |
| 2. P | GO:1990023 | mitotic spindle midzone |
| 2. P | GO:0098535 | de novo centriole assembly involved in multi-ciliated epithelial cell differentiation |
| 2. P | GO:0009832 | plant-type cell wall biogenesis |
| 2. P | GO:2001224 | positive regulation of neuron migration |
| 2. P | GO:0098978 | glutamatergic synapse |
| 2. P | GO:0006622 | protein targeting to lysosome |
| 2. P | GO:0000711 | meiotic DNA repair synthesis |
| 2. P | GO:0032494 | response to peptidoglycan |
| 2. P | GO:0005815 | microtubule organizing center |
| 2. P | GO:0035567 | non-canonical Wnt signaling pathway |
| 2. P | GO:0098871 | postsynaptic actin cytoskeleton |
| 2. P | GO:0051315 | attachment of mitotic spindle microtubules to kinetochore |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0031023 | microtubule organizing center organization |
| 2. P | GO:0032880 | regulation of protein localization |
| 2. P | GO:0070498 | interleukin-1-mediated signaling pathway |
| 2. P | GO:0065003 | protein-containing complex assembly |
| 2. P | GO:0034134 | toll-like receptor 2 signaling pathway |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:0050700 | CARD domain binding |
| 2. P | GO:0007250 | activation of NF-kappaB-inducing kinase activity |
| 2. P | GO:0005802 | trans-Golgi network |
| 2. P | GO:0030954 | astral microtubule nucleation |
| 2. P | GO:0048309 | endoplasmic reticulum inheritance |
| 2. P | GO:0007129 | homologous chromosome pairing at meiosis |
| 2. P | GO:0060285 | cilium-dependent cell motility |
| 2. P | GO:0045089 | positive regulation of innate immune response |
| 2. P | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0048167 | regulation of synaptic plasticity |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0090306 | meiotic spindle assembly |
| 2. P | GO:0051298 | centrosome duplication |
| 2. P | GO:0007130 | synaptonemal complex assembly |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0061676 | importin-alpha family protein binding |
| 2. P | GO:0090235 | regulation of metaphase plate congression |
| 2. P | GO:0032580 | Golgi cisterna membrane |
| 2. P | GO:0000801 | central element |
| 2. P | GO:0097729 | 9+2 motile cilium |
| 2. P | GO:0050699 | WW domain binding |
| 2. P | GO:0009937 | regulation of gibberellic acid mediated signaling pathway |
| 2. P | GO:0051225 | spindle assembly |
| 2. P | GO:2000352 | negative regulation of endothelial cell apoptotic process |
| 2. P | GO:0000742 | karyogamy involved in conjugation with cellular fusion |
| 2. P | GO:0002081 | outer acrosomal membrane |
| 2. P | GO:0097298 | regulation of nucleus size |
| 2. P | GO:0051020 | GTPase binding |
| 2. P | GO:0003382 | epithelial cell morphogenesis |
| 2. P | GO:0140405 | spindle pole body-led chromosome movement during mitotic interphase |
| 2. P | GO:0072660 | maintenance of protein location in plasma membrane |
| 2. P | GO:0034501 | protein localization to kinetochore |
| 2. P | GO:0002446 | neutrophil mediated immunity |
| 2. P | GO:0061512 | protein localization to cilium |
| 2. P | GO:0030142 | COPI-coated Golgi to ER transport vesicle |
| 2. P | GO:0070286 | axonemal dynein complex assembly |
| 2. P | GO:0005085 | guanyl-nucleotide exchange factor activity |
| 2. P | GO:0030527 | structural constituent of chromatin |
| 2. P | GO:0010847 | regulation of chromatin assembly |
| 2. P | GO:0035024 | negative regulation of Rho protein signal transduction |
| 2. P | GO:0003713 | transcription coactivator activity |
| 2. P | GO:0007131 | reciprocal meiotic recombination |
| 2. P | GO:0090660 | cerebrospinal fluid circulation |
| 2. P | GO:0005092 | GDP-dissociation inhibitor activity |
| 2. P | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 2. P | GO:0099518 | vesicle cytoskeletal trafficking |
| 2. P | GO:0008574 | plus-end-directed microtubule motor activity |
| 2. P | GO:0032467 | positive regulation of cytokinesis |
| 2. P | GO:0008385 | IkappaB kinase complex |
| 2. P | GO:0007099 | centriole replication |
| 2. P | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0035469 | determination of pancreatic left/right asymmetry |
| 2. P | GO:0061966 | establishment of left/right asymmetry |
| 2. P | GO:0061493 | central plaque of mitotic spindle pole body |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:1901214 | regulation of neuron death |
| 2. P | GO:0043422 | protein kinase B binding |
| 2. P | GO:0016459 | myosin complex |
| 2. P | GO:0044732 | mitotic spindle pole body |
| 2. P | GO:1903566 | positive regulation of protein localization to cilium |
| 2. P | GO:0042147 | retrograde transport, endosome to Golgi |
| 2. P | GO:0051415 | microtubule nucleation by interphase microtubule organizing center |
| 2. P | GO:0035686 | sperm fibrous sheath |
| 2. P | GO:1990939 | |
| 2. P | GO:0030154 | cell differentiation |
| 2. P | GO:0097028 | dendritic cell differentiation |
| 2. P | GO:0005158 | insulin receptor binding |
| 2. P | GO:0098536 | deuterosome |
| 2. P | GO:0016082 | synaptic vesicle priming |
| 2. P | GO:0072766 | centromere clustering at the mitotic interphase nuclear envelope |
| 2. P | GO:1903445 | protein transport from ciliary membrane to plasma membrane |
| 2. P | GO:0005798 | Golgi-associated vesicle |
| 2. P | GO:0005822 | inner plaque of spindle pole body |
| 2. P | GO:0048538 | thymus development |
| 2. P | GO:0005794 | Golgi apparatus |
| 2. P | GO:0098982 | GABA-ergic synapse |
| 2. P | GO:0001932 | regulation of protein phosphorylation |
| 2. P | GO:0007264 | small GTPase mediated signal transduction |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0035974 | meiotic spindle pole body |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0030989 | dynein-driven meiotic oscillatory nuclear movement |
| 2. P | GO:0061804 | mitotic spindle formation (spindle phase one) |
| 2. P | GO:1990459 | transferrin receptor binding |
| 2. P | GO:0007252 | I-kappaB phosphorylation |
| 2. P | GO:0043184 | vascular endothelial growth factor receptor 2 binding |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0099635 | voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels |
| 2. P | GO:0031929 | TOR signaling |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0000940 | outer kinetochore |
| 2. P | GO:0032991 | protein-containing complex |
| 2. P | GO:0007088 | regulation of mitotic nuclear division |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0044458 | motile cilium assembly |
| 2. P | GO:0036396 | RNA N6-methyladenosine methyltransferase complex |
| 2. P | GO:0070861 | regulation of protein exit from endoplasmic reticulum |
| 2. P | GO:0032449 | CBM complex |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:0042169 | SH2 domain binding |
| 2. P | GO:0042770 | signal transduction in response to DNA damage |
| 2. P | GO:1902017 | regulation of cilium assembly |
| 2. P | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 2. P | GO:0043032 | positive regulation of macrophage activation |
| 2. P | GO:0045724 | positive regulation of cilium assembly |
| 2. P | GO:0019905 | syntaxin binding |
| 2. P | GO:0030518 | intracellular steroid hormone receptor signaling pathway |
| 2. P | GO:0031098 | stress-activated protein kinase signaling cascade |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0045773 | positive regulation of axon extension |
| 2. P | GO:0003383 | apical constriction |
| 3. B | GO:0071711 | basement membrane organization |
| 3. B | GO:0006998 | nuclear envelope organization |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0090398 | cellular senescence |
| 3. B | GO:0030951 | establishment or maintenance of microtubule cytoskeleton polarity |
| 3. B | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 3. B | GO:0007414 | axonal defasciculation |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0043260 | laminin-11 complex |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0035011 | melanotic encapsulation of foreign target |
| 3. B | GO:1990683 | DNA double-strand break attachment to nuclear envelope |
| 3. B | GO:0016363 | nuclear matrix |
| 3. B | GO:1903243 | negative regulation of cardiac muscle hypertrophy in response to stress |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0040017 | positive regulation of locomotion |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:1904178 | negative regulation of adipose tissue development |
| 3. B | GO:0030010 | establishment of cell polarity |
| 3. B | GO:0035861 | site of double-strand break |
| 3. B | GO:0043259 | laminin-10 complex |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:2001237 | negative regulation of extrinsic apoptotic signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0001755 | neural crest cell migration |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0051788 | response to misfolded protein |
| 3. B | GO:0031647 | regulation of protein stability |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:1900114 | positive regulation of histone H3-K9 trimethylation |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:0007498 | mesoderm development |
| 3. B | GO:0034504 | protein localization to nucleus |
| 3. B | GO:0005610 | laminin-5 complex |
| 3. B | GO:0009612 | response to mechanical stimulus |
| 3. B | GO:0009887 | animal organ morphogenesis |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0072201 | negative regulation of mesenchymal cell proliferation |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:1900180 | regulation of protein localization to nucleus |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0000003 | reproduction |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:0035001 | dorsal trunk growth, open tracheal system |
| 3. B | GO:0036062 | presynaptic periactive zone |
| 3. B | GO:0042475 | odontogenesis of dentin-containing tooth |
| 3. B | GO:0090343 | positive regulation of cell aging |
| 3. B | GO:0071456 | cellular response to hypoxia |
| 3. B | GO:0010628 | positive regulation of gene expression |
| 3. B | GO:0006606 | protein import into nucleus |
| 3. B | GO:0033627 | cell adhesion mediated by integrin |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0005882 | intermediate filament |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0032204 | regulation of telomere maintenance |
| 3. B | GO:0031941 | filamentous actin |
| 3. B | GO:0010950 | positive regulation of endopeptidase activity |
| 3. B | GO:0055015 | ventricular cardiac muscle cell development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8CDI6 | Coiled-coil domain-containing protein 158 | 1.14e-08 | 5.78e-81 | 0.0 |
| 1. PB | Q5M9N0 | Coiled-coil domain-containing protein 158 | 0 | 2.50e-147 | 0.0 |
| 1. PB | Q9Y592 | Centrosomal protein of 83 kDa | 3.31e-06 | 3.75e-11 | 0.044 |
| 2. P | Q3UPP8 | Centrosomal protein of 63 kDa | 6.75e-08 | 6.29e-05 | NA |
| 2. P | Q5U465 | Coiled-coil domain-containing protein 125 | 1.05e-03 | 4.29e-04 | NA |
| 2. P | Q6QZQ4 | Vimentin-type intermediate filament-associated coiled-coil protein | 1.20e-02 | 2.47e-03 | NA |
| 2. P | Q5T655 | Cilia- and flagella-associated protein 58 | 2.19e-09 | 3.48e-05 | NA |
| 2. P | O76878 | RILP-like protein homolog | 1.11e-02 | 1.04e-04 | NA |
| 2. P | Q6AXZ4 | Centrosomal protein CEP57L1 | 5.21e-03 | 2.20e-03 | NA |
| 2. P | P75395 | Uncharacterized protein MG269 homolog | 7.46e-03 | 1.04e-05 | NA |
| 2. P | Q9D5Y1 | Coiled-coil domain-containing protein 39 | 2.63e-06 | 7.57e-04 | NA |
| 2. P | Q8HZ60 | Coiled-coil alpha-helical rod protein 1 | 1.02e-08 | 2.15e-02 | NA |
| 2. P | Q6ZU80 | Centrosomal protein of 128 kDa | 3.14e-07 | 1.23e-12 | NA |
| 2. P | Q9H257 | Caspase recruitment domain-containing protein 9 | 2.59e-04 | 1.16e-02 | NA |
| 2. P | Q4R703 | Centrosomal protein of 63 kDa | 3.72e-08 | 9.21e-11 | NA |
| 2. P | Q9JJC6 | RILP-like protein 1 | 2.77e-04 | 2.41e-04 | NA |
| 2. P | Q6PH08 | ERC protein 2 | 7.41e-09 | 4.43e-05 | NA |
| 2. P | Q0VFX2 | Cilia- and flagella-associated protein 157 | 1.37e-04 | 4.43e-05 | NA |
| 2. P | Q99JG7 | TNFAIP3-interacting protein 2 | 1.04e-03 | 9.75e-04 | NA |
| 2. P | Q6DIX6 | BICD family-like cargo adapter 2 | 2.46e-04 | 4.88e-04 | NA |
| 2. P | Q15643 | Thyroid receptor-interacting protein 11 | 3.99e-02 | 2.12e-02 | NA |
| 2. P | Q96KP6 | TNFAIP3-interacting protein 3 | 1.31e-03 | 1.18e-10 | NA |
| 2. P | O15083 | ERC protein 2 | 6.92e-04 | 2.05e-04 | NA |
| 2. P | F1R4Y7 | Centrosomal protein of 83 kDa | 3.58e-08 | 5.15e-09 | NA |
| 2. P | Q8WP33 | Coiled-coil domain-containing protein 30 | 2.97e-04 | 1.02e-03 | NA |
| 2. P | Q01202 | Paramyosin | 3.27e-08 | 4.87e-02 | NA |
| 2. P | Q6FY25 | Spindle pole body component 110 | 2.55e-06 | 9.43e-05 | NA |
| 2. P | A0JMK8 | BICD family-like cargo adapter 2 | 3.74e-05 | 4.69e-02 | NA |
| 2. P | Q9D5R3 | Centrosomal protein of 83 kDa | 3.83e-07 | 7.95e-06 | NA |
| 2. P | Q92805 | Golgin subfamily A member 1 | 7.35e-06 | 3.95e-03 | NA |
| 2. P | B0CM36 | Lebercilin-like protein | 1.52e-02 | 9.45e-04 | NA |
| 2. P | Q95K40 | Coiled-coil domain-containing protein 83 | 6.58e-02 | 1.94e-03 | NA |
| 2. P | Q7ZVT3 | Spindle assembly abnormal protein 6 homolog | 5.42e-04 | 4.28e-06 | NA |
| 2. P | Q9LFE4 | WEB family protein At5g16730, chloroplastic | 1.89e-07 | 9.35e-04 | NA |
| 2. P | A0JNT9 | BICD family-like cargo adapter 1 | 3.21e-06 | 1.37e-03 | NA |
| 2. P | Q9EPY0 | Caspase recruitment domain-containing protein 9 | 3.33e-04 | 3.39e-03 | NA |
| 2. P | Q4R3Q7 | Lebercilin-like protein | 8.46e-03 | 1.19e-03 | NA |
| 2. P | P32448 | Anti-silencing protein 2 | 1.76e-04 | 1.32e-02 | NA |
| 2. P | A8HUA1 | Cilia- and flagella-associated protein 58 | 2.74e-07 | 2.36e-04 | NA |
| 2. P | Q9SAF6 | Protein CROWDED NUCLEI 2 | 3.47e-05 | 4.53e-05 | NA |
| 2. P | C5DY19 | Spindle pole body component 110 | 3.08e-07 | 6.91e-08 | NA |
| 2. P | Q6NRW2 | Protein Spindly-B | 8.46e-06 | 7.97e-03 | NA |
| 2. P | A8MQT2 | Golgin subfamily A member 8B | 9.88e-04 | 2.12e-02 | NA |
| 2. P | Q8IWF9 | Coiled-coil domain-containing protein 83 | 3.10e-02 | 4.24e-04 | NA |
| 2. P | C5DJH6 | Spindle pole body component 110 | 8.56e-05 | 2.28e-05 | NA |
| 2. P | Q86RN8 | Paramyosin | 3.88e-09 | 8.52e-05 | NA |
| 2. P | Q10336 | Meiotic coiled-coil protein 6 | 9.74e-04 | 4.24e-04 | NA |
| 2. P | Q96EA4 | Protein Spindly | 2.45e-03 | 7.49e-06 | NA |
| 2. P | Q8NB25 | Protein FAM184A | 1.83e-05 | 4.13e-05 | NA |
| 2. P | A6NEE1 | Pleckstrin homology domain-containing family D member 1 | 8.03e-06 | 2.58e-02 | NA |
| 2. P | Q0KK56 | Protein FAM184B | 1.72e-07 | 4.13e-05 | NA |
| 2. P | Q8NCX0 | Coiled-coil domain-containing protein 150 | 7.37e-08 | 1.68e-02 | NA |
| 2. P | Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 | 1.24e-06 | 8.43e-05 | NA |
| 2. P | Q0V9R4 | Coiled-coil domain-containing protein 39 | 9.84e-08 | 1.23e-03 | NA |
| 2. P | Q9P219 | Protein Daple | 2.71e-04 | 1.06e-02 | NA |
| 2. P | A6ZYV5 | Spindle pole body component 110 | 1.38e-05 | 1.40e-02 | NA |
| 2. P | Q6VGS5 | Protein Daple | 9.10e-05 | 5.22e-07 | NA |
| 2. P | A7THU9 | Spindle pole body component 110 | 6.26e-06 | 1.32e-03 | NA |
| 2. P | Q2NL98 | Vimentin-type intermediate filament-associated coiled-coil protein | 1.56e-02 | 3.99e-03 | NA |
| 2. P | Q11102 | Putative protein tag-278 | 2.56e-07 | 4.74e-08 | NA |
| 2. P | Q756L3 | Spindle pole body component 110 | 3.96e-05 | 2.49e-08 | NA |
| 2. P | Q5VVM6 | Coiled-coil domain-containing protein 30 | 2.12e-02 | 3.95e-02 | NA |
| 2. P | Q9H6S1 | 5-azacytidine-induced protein 2 | 3.26e-03 | 7.37e-05 | NA |
| 2. P | A1A5D9 | BICD family-like cargo adapter 2 | 1.58e-03 | 4.07e-02 | NA |
| 2. P | Q08DR9 | Protein Spindly | 1.26e-01 | 1.55e-05 | NA |
| 2. P | B3LFU6 | Spindle pole body component 110 | 2.55e-06 | 1.01e-02 | NA |
| 2. P | P0CF95 | BICD family-like cargo adapter 1 | NA | 2.95e-02 | NA |
| 2. P | Q9CA42 | Protein CROWDED NUCLEI 3 | 6.40e-08 | 1.83e-04 | NA |
| 2. P | Q5WN60 | Intermediate filament protein ifc-2 | 5.95e-04 | 7.82e-03 | NA |
| 2. P | Q7Z7B0 | Filamin-A-interacting protein 1 | 4.13e-06 | 6.03e-03 | NA |
| 2. P | Q8HZ57 | Coiled-coil alpha-helical rod protein 1 | 4.48e-06 | 2.12e-02 | NA |
| 2. P | P61430 | Synaptonemal complex protein 2 | 1.53e-03 | 1.54e-04 | NA |
| 2. P | Q60563 | Synaptonemal complex protein 1 (Fragment) | 1.56e-06 | 1.37e-08 | NA |
| 2. P | Q2TA00 | Coiled-coil domain-containing protein 83 | 3.53e-02 | 7.00e-03 | NA |
| 2. P | B9V5F5 | Centrosomal protein of 63 kDa-A | 6.37e-07 | 2.05e-03 | NA |
| 2. P | B2RW38 | Cilia- and flagella-associated protein 58 | 2.98e-08 | 3.69e-04 | NA |
| 2. P | Q8CB62 | Centrobin | 2.30e-03 | 5.25e-05 | NA |
| 2. P | Q86W54 | Spermatogenesis-associated protein 24 | 6.66e-04 | 2.52e-03 | NA |
| 2. P | A6NCC3 | Golgin subfamily A member 8O | 4.50e-03 | 4.73e-03 | NA |
| 2. P | Q62839 | Golgin subfamily A member 2 | 6.70e-06 | 8.68e-04 | NA |
| 2. P | F4K1B4 | Nuclear envelope-associated protein 2 | 6.01e-07 | 2.88e-03 | NA |
| 2. P | Q84WU4 | Golgin candidate 3 | 8.06e-05 | 1.05e-06 | NA |
| 2. P | Q9C717 | Protein FLX-like 3 | 8.85e-05 | 3.14e-05 | NA |
| 2. P | Q8L7S4 | Microtubule-associated protein 70-2 | 3.83e-04 | 2.26e-04 | NA |
| 2. P | P0CB05 | Centrosomal protein of 63 kDa | 5.32e-07 | 2.63e-08 | NA |
| 2. P | A2BDR7 | Cilia- and flagella-associated protein 157 | 8.20e-06 | 6.59e-04 | NA |
| 2. P | Q5RD40 | 5-azacytidine-induced protein 2 | 2.03e-02 | 1.13e-03 | NA |
| 2. P | Q8VYU6 | Golgin candidate 4 | 8.49e-06 | 1.19e-05 | NA |
| 2. P | E9PVB3 | Coiled-coil domain-containing protein 175 | 2.60e-08 | 7.10e-04 | NA |
| 2. P | Q6CRH4 | SWI5-dependent HO expression protein 3 | 1.79e-05 | 5.49e-04 | NA |
| 2. P | A0A125S9M6 | Cytotardin | 3.31e-04 | 3.64e-03 | NA |
| 2. P | Q2KJE0 | Tax1-binding protein 1 homolog | 4.63e-05 | 5.68e-03 | NA |
| 2. P | A0A2R8QCI3 | Protein Daple | 3.07e-04 | 1.31e-02 | NA |
| 2. P | Q5R8Y4 | Leucine zipper protein 2 | 2.02e-03 | 4.09e-05 | NA |
| 2. P | I6L899 | Golgin subfamily A member 8R | 4.28e-06 | 2.60e-02 | NA |
| 2. P | O94488 | Microtubule organizer protein 1 | 2.54e-06 | 4.78e-04 | NA |
| 2. P | Q8VDS7 | Centrosomal protein CEP57L1 | 8.43e-04 | 3.33e-06 | NA |
| 2. P | Q99MI1 | ELKS/Rab6-interacting/CAST family member 1 | 1.56e-06 | 1.86e-06 | NA |
| 2. P | Q9LEZ4 | Protein MICROTUBULE BINDING PROTEIN 2C | 8.26e-03 | 3.64e-03 | NA |
| 2. P | Q6ZP65 | BICD family-like cargo adapter 1 | 3.83e-06 | 3.00e-02 | NA |
| 2. P | Q6NRG6 | Spindle assembly abnormal protein 6 homolog | 5.06e-03 | 2.22e-05 | NA |
| 2. P | A8IQE0 | Coiled-coil domain-containing protein 39 | 1.07e-09 | 1.32e-02 | NA |
| 2. P | A0PJT0 | RILP-like protein 1 | 3.20e-04 | 2.43e-06 | NA |
| 2. P | Q0VFN8 | Cilia- and flagella-associated protein 157 | 1.44e-06 | 2.99e-09 | NA |
| 2. P | P0CK98 | Coiled-coil domain-containing protein 39 | 2.61e-06 | 7.97e-05 | NA |
| 2. P | Q4PJT6 | Spermatogenesis-associated protein 24 | 4.92e-05 | 1.84e-02 | NA |
| 2. P | C8Z5R8 | Spindle pole body component 110 | 4.36e-07 | 8.98e-03 | NA |
| 2. P | Q8NFZ5 | TNFAIP3-interacting protein 2 | 1.31e-04 | 1.12e-02 | NA |
| 2. P | Q6TMG5 | NF-kappa-B essential modulator | 6.14e-06 | 3.60e-03 | NA |
| 2. P | Q8N137 | Centrobin | 7.15e-05 | 2.65e-02 | NA |
| 2. P | Q4R6W3 | Testis-specific gene 10 protein | 2.58e-06 | 1.94e-03 | NA |
| 2. P | Q6GLX3 | BICD family-like cargo adapter 2 | 8.42e-05 | 2.60e-02 | NA |
| 2. P | A7TJJ7 | SWI5-dependent HO expression protein 3 | 1.33e-03 | 1.54e-02 | NA |
| 2. P | Q9CS72 | Filamin-A-interacting protein 1 | 7.15e-06 | 4.78e-03 | NA |
| 2. P | Q9ULE4 | Protein FAM184B | 2.19e-08 | 7.97e-03 | NA |
| 2. P | Q4R7H3 | Protein Spindly | 1.46e-01 | 1.38e-05 | NA |
| 2. P | Q86Z20 | Coiled-coil domain-containing protein 125 | 1.62e-01 | 1.18e-02 | NA |
| 2. P | Q5NVN6 | Centrosomal protein of 63 kDa | 1.81e-10 | 9.82e-03 | NA |
| 2. P | P0C221 | Coiled-coil domain-containing protein 175 | 8.25e-08 | 7.02e-04 | NA |
| 2. P | Q5BIX7 | Protein Spindly-A | 1.02e-08 | 1.26e-02 | NA |
| 2. P | Q5R4U3 | Tax1-binding protein 1 homolog | 2.68e-05 | 1.32e-02 | NA |
| 2. P | Q03410 | Synaptonemal complex protein 1 | 1.24e-07 | 5.15e-09 | NA |
| 2. P | Q66H89 | Centrosomal protein of 83 kDa | 2.34e-06 | 4.33e-06 | NA |
| 2. P | A8IQT2 | Coiled-coil domain-containing protein 40 homolog | 3.95e-07 | 4.64e-03 | NA |
| 2. P | Q4R3X1 | 5-azacytidine-induced protein 2 | 1.82e-02 | 2.09e-03 | NA |
| 2. P | Q9BE52 | CDK5 regulatory subunit-associated protein 2 | 1.05e-06 | 3.18e-05 | NA |
| 2. P | Q86VP1 | Tax1-binding protein 1 | 2.06e-05 | 2.13e-03 | NA |
| 2. P | Q8HZ58 | Coiled-coil alpha-helical rod protein 1 | 8.05e-06 | 4.60e-02 | NA |
| 2. P | P21249 | Major antigen | 3.39e-04 | 4.78e-03 | NA |
| 2. P | F7DP49 | Deuterosome assembly protein 1 | 5.57e-04 | 1.68e-03 | NA |
| 2. P | Q49407 | Uncharacterized protein MG269 | 1.93e-03 | 8.72e-03 | NA |
| 2. P | Q62209 | Synaptonemal complex protein 1 | 1.97e-07 | 3.51e-08 | NA |
| 2. P | Q9Y6K9 | NF-kappa-B essential modulator | 1.49e-03 | 1.39e-02 | NA |
| 2. P | Q9M8T5 | WEB family protein At3g02930, chloroplastic | 3.17e-05 | 1.53e-02 | NA |
| 2. P | Q54HI5 | Lamin-like protein | 3.38e-05 | 4.03e-02 | NA |
| 2. P | Q9UTK5 | Nucleoporin alm1 | 2.14e-04 | 3.87e-03 | NA |
| 2. P | A9QT41 | NF-kappa-B essential modulator | 1.10e-05 | 6.38e-04 | NA |
| 2. P | B3DLE8 | Protein Spindly | 2.94e-05 | 2.97e-02 | NA |
| 2. P | Q4KLY0 | Centrosomal protein of 63 kDa | 4.80e-11 | 1.56e-03 | NA |
| 2. P | Q8C9S4 | Coiled-coil domain-containing protein 186 | 4.61e-05 | 9.86e-04 | NA |
| 2. P | C5DLA5 | SWI5-dependent HO expression protein 3 | 1.74e-03 | 1.94e-04 | NA |
| 2. P | Q13439 | Golgin subfamily A member 4 | 3.02e-02 | 4.55e-03 | NA |
| 2. P | Q86XR8 | Centrosomal protein of 57 kDa | 3.24e-03 | 3.37e-02 | NA |
| 2. P | Q8CDI7 | Coiled-coil domain-containing protein 150 | 2.17e-09 | 1.34e-03 | NA |
| 2. P | Q6NY15 | Testis-specific gene 10 protein | 2.28e-08 | 1.03e-02 | NA |
| 2. P | Q5PQ23 | Outer dense fiber protein 2 | 1.22e-05 | 1.70e-03 | NA |
| 2. P | D3Z8K2 | Coiled-coil domain-containing protein 39 | 2.75e-09 | 1.06e-02 | NA |
| 2. P | A0PJP4 | RILP-like protein 1 | 6.22e-01 | 1.96e-04 | NA |
| 2. P | Q15431 | Synaptonemal complex protein 1 | 2.47e-07 | 1.86e-08 | NA |
| 2. P | Q8K4T4 | Filamin-A-interacting protein 1 | 3.73e-06 | 1.37e-02 | NA |
| 2. P | Q4R8G4 | Centrosomal protein POC5 | 4.30e-03 | 4.56e-02 | NA |
| 2. P | Q66HR5 | Calcium-binding and coiled-coil domain-containing protein 1 | 1.62e-01 | 1.29e-05 | NA |
| 2. P | Q8BXX9 | Coiled-coil domain-containing protein 169 | 4.46e-02 | 3.50e-02 | NA |
| 2. P | O88522 | NF-kappa-B essential modulator | 9.57e-04 | 1.31e-03 | NA |
| 2. P | Q9ER69 | Pre-mRNA-splicing regulator WTAP | 9.95e-04 | 3.10e-04 | NA |
| 2. P | Q9LS42 | Protein CASP | 7.14e-06 | 2.31e-04 | NA |
| 2. P | Q10PZ6 | Microtubule-associated protein 70-4 | 1.07e-03 | 8.24e-04 | NA |
| 2. P | Q498G2 | Centrosomal protein of 152 kDa | 4.64e-06 | 3.21e-02 | NA |
| 2. P | Q3KR99 | Protein Spindly | 9.91e-02 | 6.22e-05 | NA |
| 2. P | Q9FLH0 | Protein CROWDED NUCLEI 4 | 1.88e-06 | 5.32e-04 | NA |
| 2. P | Q5U3Z6 | Deuterosome assembly protein 1 | 2.29e-07 | 9.60e-07 | NA |
| 2. P | Q8CGU1 | Calcium-binding and coiled-coil domain-containing protein 1 | 9.51e-04 | 5.80e-04 | NA |
| 2. P | Q94LW7 | Kinesin-like protein KIN-4B | 1.23e-04 | 1.05e-03 | NA |
| 2. P | F8WBI6 | Golgin subfamily A member 8N | 1.75e-04 | 6.21e-03 | NA |
| 2. P | Q5EBL4 | RILP-like protein 1 | 1.42e-04 | 8.91e-05 | NA |
| 2. P | Q3SYW5 | 5-azacytidine-induced protein 2 | 5.17e-03 | 1.39e-02 | NA |
| 2. P | O95447 | Lebercilin-like protein | 1.00e-02 | 1.65e-03 | NA |
| 2. P | Q6PGZ0 | Centrosomal protein of 63 kDa | 9.85e-11 | 3.98e-11 | NA |
| 2. P | Q8K2I2 | Coiled-coil alpha-helical rod protein 1 | 2.33e-02 | 1.37e-02 | NA |
| 2. P | A7E3D8 | Lebercilin-like protein | 1.11e-02 | 2.30e-02 | NA |
| 2. P | Q6P926 | Spermatogenesis-associated protein 24 | 5.34e-05 | 3.84e-02 | NA |
| 2. P | Q95JK1 | Deuterosome assembly protein 1 | 1.70e-06 | 2.64e-09 | NA |
| 2. P | Q9ZRT1 | Protein gamma response 1 | 2.46e-04 | 2.43e-02 | NA |
| 2. P | Q9Z220 | Testis-specific gene 10 protein | 1.61e-07 | 4.73e-02 | NA |
| 2. P | A6H5Y1 | M-phase phosphoprotein 9 | 2.37e-03 | 5.97e-03 | NA |
| 2. P | Q6P3P1 | Tax1-binding protein 1 homolog | 9.52e-06 | 5.08e-03 | NA |
| 2. P | Q9Y6D9 | Mitotic spindle assembly checkpoint protein MAD1 | 1.32e-02 | 6.66e-03 | NA |
| 2. P | Q92351 | Spindle pole body protein pcp1 | 2.32e-05 | 7.49e-04 | NA |
| 2. P | Q7M6Y5 | Deuterosome assembly protein 1 | 3.13e-09 | 2.21e-06 | NA |
| 2. P | Q811U3 | ELKS/Rab6-interacting/CAST family member 1 | 1.49e-06 | 2.50e-02 | NA |
| 2. P | Q5ZMV2 | Spindle assembly abnormal protein 6 homolog | 2.29e-02 | 7.62e-09 | NA |
| 2. P | A3KNA5 | Filamin A-interacting protein 1-like | 4.54e-06 | 1.61e-06 | NA |
| 2. P | Q8CHG3 | GRIP and coiled-coil domain-containing protein 2 | 4.70e-06 | 7.89e-04 | NA |
| 2. P | Q4R7I4 | Spermatogenesis-associated protein 24 | 2.02e-04 | 2.83e-02 | NA |
| 2. P | Q91VW5 | Golgin subfamily A member 4 | 1.10e-02 | 8.22e-03 | NA |
| 2. P | Q8IYJ2 | Uncharacterized protein C10orf67, mitochondrial | 6.38e-04 | 7.78e-07 | NA |
| 2. P | Q5JU67 | Cilia- and flagella-associated protein 157 | 3.11e-05 | 4.55e-03 | NA |
| 2. P | Q3V6T2 | Girdin | 4.26e-05 | 2.75e-04 | NA |
| 2. P | F4HZB5 | Protein NETWORKED 1D | 6.81e-05 | 5.18e-06 | NA |
| 2. P | Q56A40 | Coiled-coil domain-containing protein 40 | 6.20e-08 | 1.55e-04 | NA |
| 2. P | Q8N3L3 | Beta-taxilin | 1.43e-03 | 1.75e-03 | NA |
| 2. P | F4HRT5 | Protein CROWDED NUCLEI 1 | 9.23e-06 | 8.43e-05 | NA |
| 2. P | Q921M4 | Golgin subfamily A member 2 | 1.36e-05 | 8.55e-03 | NA |
| 2. P | Q96Q89 | Kinesin-like protein KIF20B | 1.01e-02 | 2.32e-02 | NA |
| 2. P | Q96MT8 | Centrosomal protein of 63 kDa | 5.17e-09 | 3.42e-08 | NA |
| 2. P | Q95KU9 | NF-kappa-B essential modulator | 1.99e-04 | 1.11e-02 | NA |
| 2. P | Q9U2T3 | Uncharacterized protein Y116A8C.11 | 4.79e-05 | 1.16e-02 | NA |
| 2. P | O61308 | 227 kDa spindle- and centromere-associated protein | 2.13e-04 | 2.08e-07 | NA |
| 2. P | Q8BGY3 | Leucine zipper protein 2 | 3.02e-03 | 1.85e-04 | NA |
| 2. P | A6NMD2 | Golgin subfamily A member 8J | 6.87e-03 | 4.23e-02 | NA |
| 2. P | Q08379 | Golgin subfamily A member 2 | 5.52e-04 | 8.38e-03 | NA |
| 2. P | Q9C9X0 | Microtubule-associated protein 70-1 | 1.67e-04 | 1.92e-03 | NA |
| 2. P | Q5PQJ9 | Coiled-coil domain-containing protein 175 | 1.34e-08 | 4.18e-05 | NA |
| 2. P | Q5SNZ0 | Girdin | 4.90e-04 | 7.37e-05 | NA |
| 2. P | Q9CW79 | Golgin subfamily A member 1 | 4.76e-06 | 1.22e-04 | NA |
| 2. P | Q86TE4 | Leucine zipper protein 2 | 1.41e-03 | 1.32e-03 | NA |
| 2. P | Q9PW73 | Cytoskeletal protein Sojo | 2.57e-02 | 1.50e-02 | NA |
| 2. P | Q5R829 | Outer dense fiber protein 2 | 1.56e-08 | 2.05e-03 | NA |
| 2. P | Q8IWJ2 | GRIP and coiled-coil domain-containing protein 2 | 5.23e-05 | 1.39e-08 | NA |
| 2. P | Q8IYE0 | Coiled-coil domain-containing protein 146 | 9.49e-08 | 9.96e-04 | NA |
| 2. P | A0A068FIK2 | Kinesin-like protein KIN-4A | 2.53e-05 | 4.78e-02 | NA |
| 2. P | Q9WTX8 | Mitotic spindle assembly checkpoint protein MAD1 | 2.18e-02 | 8.30e-03 | NA |
| 2. P | A2BGD5 | Calcium-binding and coiled-coil domain-containing protein 1 | 3.37e-04 | 2.71e-06 | NA |
| 2. P | D3ZZL9 | GRIP and coiled-coil domain-containing protein 2 | 7.32e-06 | 1.01e-04 | NA |
| 2. P | Q96NL6 | Sodium channel and clathrin linker 1 | 5.51e-10 | 2.91e-03 | NA |
| 2. P | Q0IHE5 | RILP-like protein 1 | 2.66e-04 | 1.06e-02 | NA |
| 2. P | Q4V7B0 | Cilia- and flagella-associated protein 157 | 2.05e-05 | 1.98e-04 | NA |
| 2. P | Q80UK7 | Spindle assembly abnormal protein 6 homolog | 2.90e-03 | 2.52e-07 | NA |
| 2. P | Q569K6 | Coiled-coil domain-containing protein 157 | 5.12e-03 | 4.27e-02 | NA |
| 2. P | Q05D60 | Deuterosome assembly protein 1 | 5.07e-06 | 8.28e-08 | NA |
| 2. P | Q7FAD5 | Synaptonemal complex protein ZEP1 | 1.57e-06 | 7.49e-06 | NA |
| 2. P | A7E2F4 | Golgin subfamily A member 8A | 3.12e-04 | 1.20e-03 | NA |
| 2. P | Q9LME2 | Synaptonemal complex protein 1 | 3.52e-06 | 2.81e-02 | NA |
| 2. P | Q9I969 | Beta-taxilin | 2.14e-03 | 3.74e-02 | NA |
| 2. P | Q5HZK9 | Centrosomal protein of 63 kDa-B | 6.63e-10 | 4.19e-02 | NA |
| 2. P | Q4L180 | Filamin A-interacting protein 1-like | 2.29e-06 | 8.43e-06 | NA |
| 2. P | P32380 | Spindle pole body component 110 | 1.92e-03 | 1.09e-02 | NA |
| 2. P | Q9C9N6 | Protein PLASTID MOVEMENT IMPAIRED 2 | 9.07e-09 | 3.00e-03 | NA |
| 2. P | Q8MUF6 | Paramyosin | 5.09e-08 | 9.86e-04 | NA |
| 2. P | Q8K3M6 | ERC protein 2 | 1.82e-05 | 1.26e-04 | NA |
| 2. P | Q8VBT1 | Beta-taxilin | 1.07e-02 | 4.02e-04 | NA |
| 2. P | Q6CMB5 | Spindle pole body component 110 | 2.44e-06 | 3.42e-03 | NA |
| 2. P | Q923A2 | Protein Spindly | 1.14e-01 | 1.70e-05 | NA |
| 2. P | A7YWC8 | Vimentin-type intermediate filament-associated coiled-coil protein | 1.19e-02 | 1.15e-02 | NA |
| 2. P | Q3V079 | Basal body-orientation factor 1 | 1.57e-06 | 2.73e-02 | NA |
| 2. P | D3ZUQ0 | RILP-like protein 1 | 4.17e-04 | 8.33e-05 | NA |
| 2. P | Q7Z3E2 | Coiled-coil domain-containing protein 186 | 3.45e-06 | 3.60e-03 | NA |
| 2. P | Q9BMM8 | Paramyosin | 6.44e-08 | 8.74e-06 | NA |
| 2. P | Q9ZQX8 | Protein NETWORKED 1C | 3.31e-07 | 1.85e-05 | NA |
| 2. P | Q8S2T0 | Protein GRIP | 6.82e-05 | 9.13e-07 | NA |
| 2. P | Q6YUL8 | Kinesin-like protein KIN-4A | 3.18e-03 | 2.73e-03 | NA |
| 2. P | A2IDD5 | Coiled-coil domain-containing protein 78 | 3.78e-04 | 1.29e-04 | NA |
| 2. P | Q6UVJ0 | Spindle assembly abnormal protein 6 homolog | 7.76e-03 | 6.57e-09 | NA |
| 2. P | H3BV12 | Golgin subfamily A member 8Q | 3.99e-04 | 3.56e-03 | NA |
| 2. P | Q9ZUA3 | Microtubule-associated protein 70-3 | 3.29e-04 | 7.82e-03 | NA |
| 2. P | Q8BI22 | Centrosomal protein of 128 kDa | 6.40e-09 | 1.35e-12 | NA |
| 2. P | Q15007 | Pre-mRNA-splicing regulator WTAP | 4.94e-03 | 9.97e-05 | NA |
| 2. P | Q4V891 | Centrosomal protein POC5 | 1.78e-02 | 4.39e-02 | NA |
| 2. P | F4IMQ0 | Protein FLC EXPRESSOR | 3.62e-04 | 1.03e-03 | NA |
| 2. P | C5DUI8 | SWI5-dependent HO expression protein 3 | 3.69e-03 | 3.03e-02 | NA |
| 2. P | Q80WE4 | Kinesin-like protein KIF20B | 2.49e-04 | 2.62e-03 | NA |
| 2. P | Q66H60 | Coiled-coil domain-containing protein 146 | 1.89e-05 | 2.41e-02 | NA |
| 2. P | A7MD70 | Protein Spindly | 1.78e-05 | 2.63e-08 | NA |
| 2. P | Q5U4E6 | Golgin subfamily A member 4 | 8.14e-05 | 1.46e-06 | NA |
| 2. P | Q8BVF4 | Coiled-coil domain-containing protein 30 | 9.86e-09 | 2.14e-04 | NA |
| 2. P | Q2KJ21 | Calcium-binding and coiled-coil domain-containing protein 1 | 3.89e-03 | 4.77e-06 | NA |
| 2. P | Q17QG3 | RILP-like protein 1 | 5.66e-04 | 7.68e-07 | NA |
| 2. P | Q6P6L0 | Filamin A-interacting protein 1-like | 7.98e-07 | 1.20e-04 | NA |
| 2. P | Q10030 | Uncharacterized protein C27D6.1 | 1.98e-07 | 4.37e-03 | NA |
| 2. P | E1BM70 | Coiled-coil domain-containing protein 39 | 2.98e-08 | 1.07e-03 | NA |
| 2. P | P61584 | Rho-associated protein kinase 1 (Fragment) | 4.39e-06 | 4.31e-02 | NA |
| 3. B | P48678 | Prelamin-A/C | 4.38e-04 | NA | 0.019 |
| 3. B | P02545 | Prelamin-A/C | 4.90e-04 | NA | 0.014 |
| 3. B | Q00174 | Laminin subunit alpha | NA | NA | 0.042 |
| 3. B | Q3ZD69 | Prelamin-A/C | 3.94e-04 | NA | 0.007 |
| 3. B | O15230 | Laminin subunit alpha-5 | NA | NA | 0.030 |
| 3. B | Q75AF5 | Golgin IMH1 | 8.08e-09 | NA | 0.003 |
| 3. B | P48679 | Prelamin-A/C | 3.62e-03 | NA | 0.019 |
| 3. B | B6MFW3 | Protein Hook homolog | 2.76e-05 | NA | 2.23e-04 |
| 3. B | Q21313 | Laminin-like protein epi-1 | NA | NA | 2.76e-08 |
| 3. B | Q5M775 | Cytospin-B | 5.50e-04 | NA | 0.047 |