Summary

Q5M9N0

Homolog: Q4KLY0.
Function: Centrosomal protein of 63 kDa.

Statistics

Total GO Annotation: 379
Unique PROST Go: 298
Unique BLAST Go: 66

Total Homologs: 271
Unique PROST Homologs: 258
Unique BLAST Homologs: 10

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q4KLY0 (Centrosomal protein of 63 kDa) with a FATCAT P-Value: 4.8e-11 and RMSD of 3.66 angstrom. The sequence alignment identity is 15.2%.
Structural alignment shown in left. Query protein Q5M9N0 colored as red in alignment, homolog Q4KLY0 colored as blue. Query protein Q5M9N0 is also shown in right top, homolog Q4KLY0 showed in right bottom. They are colored based on secondary structures. 

  Q5M9N0 MESKAWESNNEDLLSSSGVTSNGGSSSSFFVSSIRGTIIENTSSAGTLTQVPFFPKYEVELDSPRKIIPSPGKEHFERVLEEYSHQVKDLQRRLNESNEL 100
  Q4KLY0 ---------------------------------------------------------------------------------------------------- 0

  Q5M9N0 HEKQKFYLRQSVIDLQTKLQEMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAKCLKEDMLKDSNTQIEQLRKMMLSHEGVLQEIRSILVDFEEAS 200
  Q4KLY0 ---------------------------------------------------------------------------------------------------- 0

  Q5M9N0 GKKICEHDSMSTLHFRSLGSAISKILRELDTEISYLKGRIFPVEDQLEALKSESQNKIELLLQQHQDRIEQLISEHEVEITG--LTEKASSARSQANSIQ 298
  Q4KLY0 ---------------------------------------------------------MEALLEGIQTR------GH----SGGFLT----SCEAELQELM 29

  Q5M9N0 SQMEIIQEQARNQNSMYMRQLSDLESTVSQLRS-ELREAKRMYED-KTEELEKQLVLANSELTEARTERDQFSQESGNLD--DQLQKLLADLHKREKELS 394
  Q4KLY0 KQIDIM---VAHKKSEWEGQTHALETCLD-MRDRELK-ALRSQLDMK----HKEVGILHQQI-E---EQEKTKQEMA-LEYKEELMKLQEEL-SRLKR-S 113

  Q5M9N0 LEKEQNKRLWDRD-TGNSITIDHLRRELDNRNMEVQRL-----EALLKALKSECQGQM--ERQMAAIQGKNESLEKVSS-LTAQLESTKEMLRKVVEELT 485
  Q4KLY0 YEKLQKKQL--REFRGN--T-KSLRE--D-RS-EIERLTGKIEEFRQKSLDWEKQ-RLIYQQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESV--ELS 201

  Q5M9N0 AKKMTLESSERTISDLTTSLQEKERAIE--ATNAEITKLRSRVDLKLQELQHLKNEGDHLR--NVQTECEALKLQMTEKDKVIEILRQQIENMTQLVGQH 581
  Q4KLY0 SQ------SE--IQHLSSKL---ERAKDTICAN-EL-EIE-RLNIRVKDLM-----GTNVTILQEQRQKEE-KLR--ESEKLLEALQ---EEQKEL---- 272

  Q5M9N0 GRTAGAMQVEKAQLE-KE--INDRRMELKELKI-LK--DKKDAKIRELEARVSDLELEKVKLVNAGS---ER-LRAVKDIKQERDQLLNE---------- 661
  Q4KLY0 ----------KASLQAQESFILDAKMQEK-LQTKLKAVDTKHSVERSLE----DCQVER-KYSSSGQGVLDNVLSQL-DISHSSEELLQAEVTRLEGSLE 355

  Q5M9N0 -VKTSRSELNN-LSEEYEVLKRNFRNKSEEMEMT-TNKLKMQLKSAQSELEQTRNTLKSMEGSDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMT 758
  Q4KLY0 SVSTTCKQLSQELMEKYEELKR-MEGHNNEYR-TEIKKLKEQILQA----DQTYSS--ALEG-----MKTEI---SQLT--R-ELH--QRDITIASAKCS 434

  Q5M9N0 NANKEKHFLKEEKSKLSQELSTVATEKNKMAGELEVLRSQERRLKEKVTNMEVALDKASLQFAECQDIIQR-QEQESVR---LKLQHTLD--IKELQGPG 852
  Q4KLY0 SSDMERQ-LKAEMQK-AEE---KAVEHKEILSQLESLRLENRRLSETVMKLELGLHECSMPVSPLGLIATRFLEEEELRSHHI-LER-LDAHIEELKRE- 526

  Q5M9N0 YTSNSSLK--PRLLQPASVTRSHSNVPSSQSTASFLSHHSTKANTLKEDPTRDLKQLLQELRSVINEEPAVSLSKTEEDGRTSLGALEDRVRDCITESSL 950
  Q4KLY0 --SEKTVRQFTALV-------------------------------------------------------------------------------------- 538

  Q5M9N0 RSDMCHRSNNSLRDSTEGSKSSETLSREPVTLHAGDREDPSGCFTFTSAASPSVKNSASRSFNSSPKKSPVHSLLTSSVEGSIGSTSQYRSAKPIHSSDS 1050
  Q4KLY0 ---------------------------------------------------------------------------------------------------- 538

  Q5M9N0 VKDSQSPPIETTGKTCRKLQNRLESLQTLVEDLQLKNQAMSSMIRNQEKRIQKVKDQEKMLLK 1113
  Q4KLY0 --------------------------------------------------------------- 538

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0097539 ciliary transition fiber
1. PB GO:0051959 dynein light intermediate chain binding
1. PB GO:0005652 nuclear lamina
1. PB GO:0051660 establishment of centrosome localization
1. PB GO:0006997 nucleus organization
1. PB GO:0030705 cytoskeleton-dependent intracellular transport
1. PB GO:0005638 lamin filament
1. PB GO:0016477 cell migration
1. PB GO:0005635 nuclear envelope
1. PB GO:0043001 Golgi to plasma membrane protein transport
1. PB GO:0071539 protein localization to centrosome
1. PB GO:0048278 vesicle docking
1. PB GO:0060271 cilium assembly
1. PB GO:0031965 nuclear membrane
1. PB GO:0005654 nucleoplasm
2. P GO:0110092 nucleus leading edge
2. P GO:0006611 protein export from nucleus
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0019904 protein domain specific binding
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0045141 meiotic telomere clustering
2. P GO:1902410 mitotic cytokinetic process
2. P GO:0090161 Golgi ribbon formation
2. P GO:0034499 late endosome to Golgi transport
2. P GO:0005874 microtubule
2. P GO:0010375 stomatal complex patterning
2. P GO:0051026 chiasma assembly
2. P GO:0047496 vesicle transport along microtubule
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0048786 presynaptic active zone
2. P GO:0044615 nuclear pore nuclear basket
2. P GO:0048874 host-mediated regulation of intestinal microbiota composition
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0023035 CD40 signaling pathway
2. P GO:0048193 Golgi vesicle transport
2. P GO:0030426 growth cone
2. P GO:0044877 protein-containing complex binding
2. P GO:0071907 determination of digestive tract left/right asymmetry
2. P GO:0035092 sperm DNA condensation
2. P GO:0008017 microtubule binding
2. P GO:0007020 microtubule nucleation
2. P GO:0048790 maintenance of presynaptic active zone structure
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0032982 myosin filament
2. P GO:0032663 regulation of interleukin-2 production
2. P GO:0001673 male germ cell nucleus
2. P GO:0097431 mitotic spindle pole
2. P GO:0042110 T cell activation
2. P GO:0090166 Golgi disassembly
2. P GO:0070016 armadillo repeat domain binding
2. P GO:0034067 protein localization to Golgi apparatus
2. P GO:0010005 cortical microtubule, transverse to long axis
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0005154 epidermal growth factor receptor binding
2. P GO:0051301 cell division
2. P GO:0005524 ATP binding
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0072518 Rho-dependent protein serine/threonine kinase activity
2. P GO:0008356 asymmetric cell division
2. P GO:0010507 negative regulation of autophagy
2. P GO:0000802 transverse filament
2. P GO:0071910 determination of liver left/right asymmetry
2. P GO:0080009 mRNA methylation
2. P GO:0007283 spermatogenesis
2. P GO:0051878 lateral element assembly
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0071955 recycling endosome to Golgi transport
2. P GO:0044565 dendritic cell proliferation
2. P GO:2000114 regulation of establishment of cell polarity
2. P GO:0099070 static microtubule bundle
2. P GO:0055107 Golgi to secretory granule transport
2. P GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
2. P GO:0042130 negative regulation of T cell proliferation
2. P GO:0120229 protein localization to motile cilium
2. P GO:0005886 plasma membrane
2. P GO:0043015 gamma-tubulin binding
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0036159 inner dynein arm assembly
2. P GO:0045098 type III intermediate filament
2. P GO:0034162 toll-like receptor 9 signaling pathway
2. P GO:0051649 establishment of localization in cell
2. P GO:0005816 spindle pole body
2. P GO:0010975 regulation of neuron projection development
2. P GO:0001965 G-protein alpha-subunit binding
2. P GO:0042734 presynaptic membrane
2. P GO:0000151 ubiquitin ligase complex
2. P GO:0110120 gamma-tubulin complex localization to nuclear side of mitotic spindle pole body
2. P GO:1990450 linear polyubiquitin binding
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0090316 positive regulation of intracellular protein transport
2. P GO:0071958 new mitotic spindle pole body
2. P GO:0072686 mitotic spindle
2. P GO:0061024 membrane organization
2. P GO:0001947 heart looping
2. P GO:0043515 kinetochore binding
2. P GO:0043621 protein self-association
2. P GO:0070938 contractile ring
2. P GO:0005634 nucleus
2. P GO:0032148 activation of protein kinase B activity
2. P GO:0000242 pericentriolar material
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0036064 ciliary basal body
2. P GO:0031682 G-protein gamma-subunit binding
2. P GO:0016064 immunoglobulin mediated immune response
2. P GO:0120317 sperm mitochondrial sheath assembly
2. P GO:0005930 axoneme
2. P GO:0007010 cytoskeleton organization
2. P GO:0001782 B cell homeostasis
2. P GO:0097225 sperm midpiece
2. P GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
2. P GO:0003146 heart jogging
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:0061499 outer plaque of mitotic spindle pole body
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0042803 protein homodimerization activity
2. P GO:0007018 microtubule-based movement
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0030031 cell projection assembly
2. P GO:0051289 protein homotetramerization
2. P GO:0000775 chromosome, centromeric region
2. P GO:0034138 toll-like receptor 3 signaling pathway
2. P GO:1900017 positive regulation of cytokine production involved in inflammatory response
2. P GO:0043330 response to exogenous dsRNA
2. P GO:0050862 positive regulation of T cell receptor signaling pathway
2. P GO:0005814 centriole
2. P GO:0051650 establishment of vesicle localization
2. P GO:1903438 positive regulation of mitotic cytokinetic process
2. P GO:0034452 dynactin binding
2. P GO:0061496 half bridge of mitotic spindle pole body
2. P GO:0061760 antifungal innate immune response
2. P GO:0043276 anoikis
2. P GO:0006915 apoptotic process
2. P GO:1902426 deactivation of mitotic spindle assembly checkpoint
2. P GO:0003356 regulation of cilium beat frequency
2. P GO:0032495 response to muramyl dipeptide
2. P GO:0097228 sperm principal piece
2. P GO:0007368 determination of left/right symmetry
2. P GO:0140475 spindle pole body anchor activity
2. P GO:0042073 intraciliary transport
2. P GO:0000795 synaptonemal complex
2. P GO:0032740 positive regulation of interleukin-17 production
2. P GO:0000137 Golgi cis cisterna
2. P GO:0099010 modification of postsynaptic structure
2. P GO:0051299 centrosome separation
2. P GO:0005801 cis-Golgi network
2. P GO:1902236 negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
2. P GO:0051220 cytoplasmic sequestering of protein
2. P GO:0007274 neuromuscular synaptic transmission
2. P GO:0032118 horsetail-astral microtubule organization
2. P GO:0035372 protein localization to microtubule
2. P GO:0051233 spindle midzone
2. P GO:0034453 microtubule anchoring
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0035773 insulin secretion involved in cellular response to glucose stimulus
2. P GO:0048788 cytoskeleton of presynaptic active zone
2. P GO:0099041 vesicle tethering to Golgi
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0035082 axoneme assembly
2. P GO:0098831 presynaptic active zone cytoplasmic component
2. P GO:0060050 positive regulation of protein glycosylation
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0003413 chondrocyte differentiation involved in endochondral bone morphogenesis
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:2000146 negative regulation of cell motility
2. P GO:2000318 positive regulation of T-helper 17 type immune response
2. P GO:0030016 myofibril
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0098882 structural constituent of presynaptic active zone
2. P GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0032091 negative regulation of protein binding
2. P GO:1902440 protein localization to mitotic spindle pole body
2. P GO:0030032 lamellipodium assembly
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:0007030 Golgi organization
2. P GO:0007052 mitotic spindle organization
2. P GO:0005929 cilium
2. P GO:0051645 Golgi localization
2. P GO:0042975 peroxisome proliferator activated receptor binding
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0034399 nuclear periphery
2. P GO:1990023 mitotic spindle midzone
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0009832 plant-type cell wall biogenesis
2. P GO:2001224 positive regulation of neuron migration
2. P GO:0098978 glutamatergic synapse
2. P GO:0006622 protein targeting to lysosome
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0032494 response to peptidoglycan
2. P GO:0005815 microtubule organizing center
2. P GO:0035567 non-canonical Wnt signaling pathway
2. P GO:0098871 postsynaptic actin cytoskeleton
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0003341 cilium movement
2. P GO:0007098 centrosome cycle
2. P GO:0031023 microtubule organizing center organization
2. P GO:0032880 regulation of protein localization
2. P GO:0070498 interleukin-1-mediated signaling pathway
2. P GO:0065003 protein-containing complex assembly
2. P GO:0034134 toll-like receptor 2 signaling pathway
2. P GO:0000922 spindle pole
2. P GO:0050700 CARD domain binding
2. P GO:0007250 activation of NF-kappaB-inducing kinase activity
2. P GO:0005802 trans-Golgi network
2. P GO:0030954 astral microtubule nucleation
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0045089 positive regulation of innate immune response
2. P GO:0007288 sperm axoneme assembly
2. P GO:0048167 regulation of synaptic plasticity
2. P GO:0030030 cell projection organization
2. P GO:0030165 PDZ domain binding
2. P GO:0090306 meiotic spindle assembly
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005856 cytoskeleton
2. P GO:0061676 importin-alpha family protein binding
2. P GO:0090235 regulation of metaphase plate congression
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0000801 central element
2. P GO:0097729 9+2 motile cilium
2. P GO:0050699 WW domain binding
2. P GO:0009937 regulation of gibberellic acid mediated signaling pathway
2. P GO:0051225 spindle assembly
2. P GO:2000352 negative regulation of endothelial cell apoptotic process
2. P GO:0000742 karyogamy involved in conjugation with cellular fusion
2. P GO:0002081 outer acrosomal membrane
2. P GO:0097298 regulation of nucleus size
2. P GO:0051020 GTPase binding
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0140405 spindle pole body-led chromosome movement during mitotic interphase
2. P GO:0072660 maintenance of protein location in plasma membrane
2. P GO:0034501 protein localization to kinetochore
2. P GO:0002446 neutrophil mediated immunity
2. P GO:0061512 protein localization to cilium
2. P GO:0030142 COPI-coated Golgi to ER transport vesicle
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0005085 guanyl-nucleotide exchange factor activity
2. P GO:0030527 structural constituent of chromatin
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:0003713 transcription coactivator activity
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0090660 cerebrospinal fluid circulation
2. P GO:0005092 GDP-dissociation inhibitor activity
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0099518 vesicle cytoskeletal trafficking
2. P GO:0008574 plus-end-directed microtubule motor activity
2. P GO:0032467 positive regulation of cytokinesis
2. P GO:0008385 IkappaB kinase complex
2. P GO:0007099 centriole replication
2. P GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0035469 determination of pancreatic left/right asymmetry
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0061493 central plaque of mitotic spindle pole body
2. P GO:0090307 mitotic spindle assembly
2. P GO:1901214 regulation of neuron death
2. P GO:0043422 protein kinase B binding
2. P GO:0016459 myosin complex
2. P GO:0044732 mitotic spindle pole body
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:0042147 retrograde transport, endosome to Golgi
2. P GO:0051415 microtubule nucleation by interphase microtubule organizing center
2. P GO:0035686 sperm fibrous sheath
2. P GO:1990939
2. P GO:0030154 cell differentiation
2. P GO:0097028 dendritic cell differentiation
2. P GO:0005158 insulin receptor binding
2. P GO:0098536 deuterosome
2. P GO:0016082 synaptic vesicle priming
2. P GO:0072766 centromere clustering at the mitotic interphase nuclear envelope
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0005822 inner plaque of spindle pole body
2. P GO:0048538 thymus development
2. P GO:0005794 Golgi apparatus
2. P GO:0098982 GABA-ergic synapse
2. P GO:0001932 regulation of protein phosphorylation
2. P GO:0007264 small GTPase mediated signal transduction
2. P GO:0016021 integral component of membrane
2. P GO:0035974 meiotic spindle pole body
2. P GO:0031267 small GTPase binding
2. P GO:0030989 dynein-driven meiotic oscillatory nuclear movement
2. P GO:0061804 mitotic spindle formation (spindle phase one)
2. P GO:1990459 transferrin receptor binding
2. P GO:0007252 I-kappaB phosphorylation
2. P GO:0043184 vascular endothelial growth factor receptor 2 binding
2. P GO:0030317 flagellated sperm motility
2. P GO:0031514 motile cilium
2. P GO:0099635 voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P GO:0031929 TOR signaling
2. P GO:0005813 centrosome
2. P GO:0000940 outer kinetochore
2. P GO:0032991 protein-containing complex
2. P GO:0007088 regulation of mitotic nuclear division
2. P GO:0005829 cytosol
2. P GO:0044458 motile cilium assembly
2. P GO:0036396 RNA N6-methyladenosine methyltransferase complex
2. P GO:0070861 regulation of protein exit from endoplasmic reticulum
2. P GO:0032449 CBM complex
2. P GO:0000139 Golgi membrane
2. P GO:0042169 SH2 domain binding
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:1902017 regulation of cilium assembly
2. P GO:0032874 positive regulation of stress-activated MAPK cascade
2. P GO:0043032 positive regulation of macrophage activation
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0019905 syntaxin binding
2. P GO:0030518 intracellular steroid hormone receptor signaling pathway
2. P GO:0031098 stress-activated protein kinase signaling cascade
2. P GO:0042802 identical protein binding
2. P GO:0045773 positive regulation of axon extension
2. P GO:0003383 apical constriction
3. B GO:0071711 basement membrane organization
3. B GO:0006998 nuclear envelope organization
3. B GO:0007411 axon guidance
3. B GO:0090398 cellular senescence
3. B GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity
3. B GO:0045886 negative regulation of synaptic assembly at neuromuscular junction
3. B GO:0007414 axonal defasciculation
3. B GO:0009888 tissue development
3. B GO:0005201 extracellular matrix structural constituent
3. B GO:0043260 laminin-11 complex
3. B GO:0001738 morphogenesis of a polarized epithelium
3. B GO:0035011 melanotic encapsulation of foreign target
3. B GO:1990683 DNA double-strand break attachment to nuclear envelope
3. B GO:0016363 nuclear matrix
3. B GO:1903243 negative regulation of cardiac muscle hypertrophy in response to stress
3. B GO:0043083 synaptic cleft
3. B GO:0040017 positive regulation of locomotion
3. B GO:0008285 negative regulation of cell population proliferation
3. B GO:1904178 negative regulation of adipose tissue development
3. B GO:0030010 establishment of cell polarity
3. B GO:0035861 site of double-strand break
3. B GO:0043259 laminin-10 complex
3. B GO:0090201 negative regulation of release of cytochrome c from mitochondria
3. B GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
3. B GO:0030334 regulation of cell migration
3. B GO:0045995 regulation of embryonic development
3. B GO:0001755 neural crest cell migration
3. B GO:0007517 muscle organ development
3. B GO:0051788 response to misfolded protein
3. B GO:0031647 regulation of protein stability
3. B GO:0016604 nuclear body
3. B GO:0042127 regulation of cell population proliferation
3. B GO:0034446 substrate adhesion-dependent cell spreading
3. B GO:1900114 positive regulation of histone H3-K9 trimethylation
3. B GO:0008157 protein phosphatase 1 binding
3. B GO:0001942 hair follicle development
3. B GO:0007498 mesoderm development
3. B GO:0034504 protein localization to nucleus
3. B GO:0005610 laminin-5 complex
3. B GO:0009612 response to mechanical stimulus
3. B GO:0009887 animal organ morphogenesis
3. B GO:0034613 cellular protein localization
3. B GO:0072201 negative regulation of mesenchymal cell proliferation
3. B GO:0030155 regulation of cell adhesion
3. B GO:0045669 positive regulation of osteoblast differentiation
3. B GO:1900180 regulation of protein localization to nucleus
3. B GO:0060445 branching involved in salivary gland morphogenesis
3. B GO:0005604 basement membrane
3. B GO:0000003 reproduction
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0016331 morphogenesis of embryonic epithelium
3. B GO:0035001 dorsal trunk growth, open tracheal system
3. B GO:0036062 presynaptic periactive zone
3. B GO:0042475 odontogenesis of dentin-containing tooth
3. B GO:0090343 positive regulation of cell aging
3. B GO:0071456 cellular response to hypoxia
3. B GO:0010628 positive regulation of gene expression
3. B GO:0006606 protein import into nucleus
3. B GO:0033627 cell adhesion mediated by integrin
3. B GO:0062023 collagen-containing extracellular matrix
3. B GO:0005882 intermediate filament
3. B GO:0016607 nuclear speck
3. B GO:0032204 regulation of telomere maintenance
3. B GO:0031941 filamentous actin
3. B GO:0010950 positive regulation of endopeptidase activity
3. B GO:0055015 ventricular cardiac muscle cell development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8CDI6 Coiled-coil domain-containing protein 158 1.14e-08 5.78e-81 0.0
1. PB Q5M9N0 Coiled-coil domain-containing protein 158 0 2.50e-147 0.0
1. PB Q9Y592 Centrosomal protein of 83 kDa 3.31e-06 3.75e-11 0.044
2. P Q3UPP8 Centrosomal protein of 63 kDa 6.75e-08 6.29e-05 NA
2. P Q5U465 Coiled-coil domain-containing protein 125 1.05e-03 4.29e-04 NA
2. P Q6QZQ4 Vimentin-type intermediate filament-associated coiled-coil protein 1.20e-02 2.47e-03 NA
2. P Q5T655 Cilia- and flagella-associated protein 58 2.19e-09 3.48e-05 NA
2. P O76878 RILP-like protein homolog 1.11e-02 1.04e-04 NA
2. P Q6AXZ4 Centrosomal protein CEP57L1 5.21e-03 2.20e-03 NA
2. P P75395 Uncharacterized protein MG269 homolog 7.46e-03 1.04e-05 NA
2. P Q9D5Y1 Coiled-coil domain-containing protein 39 2.63e-06 7.57e-04 NA
2. P Q8HZ60 Coiled-coil alpha-helical rod protein 1 1.02e-08 2.15e-02 NA
2. P Q6ZU80 Centrosomal protein of 128 kDa 3.14e-07 1.23e-12 NA
2. P Q9H257 Caspase recruitment domain-containing protein 9 2.59e-04 1.16e-02 NA
2. P Q4R703 Centrosomal protein of 63 kDa 3.72e-08 9.21e-11 NA
2. P Q9JJC6 RILP-like protein 1 2.77e-04 2.41e-04 NA
2. P Q6PH08 ERC protein 2 7.41e-09 4.43e-05 NA
2. P Q0VFX2 Cilia- and flagella-associated protein 157 1.37e-04 4.43e-05 NA
2. P Q99JG7 TNFAIP3-interacting protein 2 1.04e-03 9.75e-04 NA
2. P Q6DIX6 BICD family-like cargo adapter 2 2.46e-04 4.88e-04 NA
2. P Q15643 Thyroid receptor-interacting protein 11 3.99e-02 2.12e-02 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 1.31e-03 1.18e-10 NA
2. P O15083 ERC protein 2 6.92e-04 2.05e-04 NA
2. P F1R4Y7 Centrosomal protein of 83 kDa 3.58e-08 5.15e-09 NA
2. P Q8WP33 Coiled-coil domain-containing protein 30 2.97e-04 1.02e-03 NA
2. P Q01202 Paramyosin 3.27e-08 4.87e-02 NA
2. P Q6FY25 Spindle pole body component 110 2.55e-06 9.43e-05 NA
2. P A0JMK8 BICD family-like cargo adapter 2 3.74e-05 4.69e-02 NA
2. P Q9D5R3 Centrosomal protein of 83 kDa 3.83e-07 7.95e-06 NA
2. P Q92805 Golgin subfamily A member 1 7.35e-06 3.95e-03 NA
2. P B0CM36 Lebercilin-like protein 1.52e-02 9.45e-04 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 6.58e-02 1.94e-03 NA
2. P Q7ZVT3 Spindle assembly abnormal protein 6 homolog 5.42e-04 4.28e-06 NA
2. P Q9LFE4 WEB family protein At5g16730, chloroplastic 1.89e-07 9.35e-04 NA
2. P A0JNT9 BICD family-like cargo adapter 1 3.21e-06 1.37e-03 NA
2. P Q9EPY0 Caspase recruitment domain-containing protein 9 3.33e-04 3.39e-03 NA
2. P Q4R3Q7 Lebercilin-like protein 8.46e-03 1.19e-03 NA
2. P P32448 Anti-silencing protein 2 1.76e-04 1.32e-02 NA
2. P A8HUA1 Cilia- and flagella-associated protein 58 2.74e-07 2.36e-04 NA
2. P Q9SAF6 Protein CROWDED NUCLEI 2 3.47e-05 4.53e-05 NA
2. P C5DY19 Spindle pole body component 110 3.08e-07 6.91e-08 NA
2. P Q6NRW2 Protein Spindly-B 8.46e-06 7.97e-03 NA
2. P A8MQT2 Golgin subfamily A member 8B 9.88e-04 2.12e-02 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 3.10e-02 4.24e-04 NA
2. P C5DJH6 Spindle pole body component 110 8.56e-05 2.28e-05 NA
2. P Q86RN8 Paramyosin 3.88e-09 8.52e-05 NA
2. P Q10336 Meiotic coiled-coil protein 6 9.74e-04 4.24e-04 NA
2. P Q96EA4 Protein Spindly 2.45e-03 7.49e-06 NA
2. P Q8NB25 Protein FAM184A 1.83e-05 4.13e-05 NA
2. P A6NEE1 Pleckstrin homology domain-containing family D member 1 8.03e-06 2.58e-02 NA
2. P Q0KK56 Protein FAM184B 1.72e-07 4.13e-05 NA
2. P Q8NCX0 Coiled-coil domain-containing protein 150 7.37e-08 1.68e-02 NA
2. P Q8IUD2 ELKS/Rab6-interacting/CAST family member 1 1.24e-06 8.43e-05 NA
2. P Q0V9R4 Coiled-coil domain-containing protein 39 9.84e-08 1.23e-03 NA
2. P Q9P219 Protein Daple 2.71e-04 1.06e-02 NA
2. P A6ZYV5 Spindle pole body component 110 1.38e-05 1.40e-02 NA
2. P Q6VGS5 Protein Daple 9.10e-05 5.22e-07 NA
2. P A7THU9 Spindle pole body component 110 6.26e-06 1.32e-03 NA
2. P Q2NL98 Vimentin-type intermediate filament-associated coiled-coil protein 1.56e-02 3.99e-03 NA
2. P Q11102 Putative protein tag-278 2.56e-07 4.74e-08 NA
2. P Q756L3 Spindle pole body component 110 3.96e-05 2.49e-08 NA
2. P Q5VVM6 Coiled-coil domain-containing protein 30 2.12e-02 3.95e-02 NA
2. P Q9H6S1 5-azacytidine-induced protein 2 3.26e-03 7.37e-05 NA
2. P A1A5D9 BICD family-like cargo adapter 2 1.58e-03 4.07e-02 NA
2. P Q08DR9 Protein Spindly 1.26e-01 1.55e-05 NA
2. P B3LFU6 Spindle pole body component 110 2.55e-06 1.01e-02 NA
2. P P0CF95 BICD family-like cargo adapter 1 NA 2.95e-02 NA
2. P Q9CA42 Protein CROWDED NUCLEI 3 6.40e-08 1.83e-04 NA
2. P Q5WN60 Intermediate filament protein ifc-2 5.95e-04 7.82e-03 NA
2. P Q7Z7B0 Filamin-A-interacting protein 1 4.13e-06 6.03e-03 NA
2. P Q8HZ57 Coiled-coil alpha-helical rod protein 1 4.48e-06 2.12e-02 NA
2. P P61430 Synaptonemal complex protein 2 1.53e-03 1.54e-04 NA
2. P Q60563 Synaptonemal complex protein 1 (Fragment) 1.56e-06 1.37e-08 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 3.53e-02 7.00e-03 NA
2. P B9V5F5 Centrosomal protein of 63 kDa-A 6.37e-07 2.05e-03 NA
2. P B2RW38 Cilia- and flagella-associated protein 58 2.98e-08 3.69e-04 NA
2. P Q8CB62 Centrobin 2.30e-03 5.25e-05 NA
2. P Q86W54 Spermatogenesis-associated protein 24 6.66e-04 2.52e-03 NA
2. P A6NCC3 Golgin subfamily A member 8O 4.50e-03 4.73e-03 NA
2. P Q62839 Golgin subfamily A member 2 6.70e-06 8.68e-04 NA
2. P F4K1B4 Nuclear envelope-associated protein 2 6.01e-07 2.88e-03 NA
2. P Q84WU4 Golgin candidate 3 8.06e-05 1.05e-06 NA
2. P Q9C717 Protein FLX-like 3 8.85e-05 3.14e-05 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 3.83e-04 2.26e-04 NA
2. P P0CB05 Centrosomal protein of 63 kDa 5.32e-07 2.63e-08 NA
2. P A2BDR7 Cilia- and flagella-associated protein 157 8.20e-06 6.59e-04 NA
2. P Q5RD40 5-azacytidine-induced protein 2 2.03e-02 1.13e-03 NA
2. P Q8VYU6 Golgin candidate 4 8.49e-06 1.19e-05 NA
2. P E9PVB3 Coiled-coil domain-containing protein 175 2.60e-08 7.10e-04 NA
2. P Q6CRH4 SWI5-dependent HO expression protein 3 1.79e-05 5.49e-04 NA
2. P A0A125S9M6 Cytotardin 3.31e-04 3.64e-03 NA
2. P Q2KJE0 Tax1-binding protein 1 homolog 4.63e-05 5.68e-03 NA
2. P A0A2R8QCI3 Protein Daple 3.07e-04 1.31e-02 NA
2. P Q5R8Y4 Leucine zipper protein 2 2.02e-03 4.09e-05 NA
2. P I6L899 Golgin subfamily A member 8R 4.28e-06 2.60e-02 NA
2. P O94488 Microtubule organizer protein 1 2.54e-06 4.78e-04 NA
2. P Q8VDS7 Centrosomal protein CEP57L1 8.43e-04 3.33e-06 NA
2. P Q99MI1 ELKS/Rab6-interacting/CAST family member 1 1.56e-06 1.86e-06 NA
2. P Q9LEZ4 Protein MICROTUBULE BINDING PROTEIN 2C 8.26e-03 3.64e-03 NA
2. P Q6ZP65 BICD family-like cargo adapter 1 3.83e-06 3.00e-02 NA
2. P Q6NRG6 Spindle assembly abnormal protein 6 homolog 5.06e-03 2.22e-05 NA
2. P A8IQE0 Coiled-coil domain-containing protein 39 1.07e-09 1.32e-02 NA
2. P A0PJT0 RILP-like protein 1 3.20e-04 2.43e-06 NA
2. P Q0VFN8 Cilia- and flagella-associated protein 157 1.44e-06 2.99e-09 NA
2. P P0CK98 Coiled-coil domain-containing protein 39 2.61e-06 7.97e-05 NA
2. P Q4PJT6 Spermatogenesis-associated protein 24 4.92e-05 1.84e-02 NA
2. P C8Z5R8 Spindle pole body component 110 4.36e-07 8.98e-03 NA
2. P Q8NFZ5 TNFAIP3-interacting protein 2 1.31e-04 1.12e-02 NA
2. P Q6TMG5 NF-kappa-B essential modulator 6.14e-06 3.60e-03 NA
2. P Q8N137 Centrobin 7.15e-05 2.65e-02 NA
2. P Q4R6W3 Testis-specific gene 10 protein 2.58e-06 1.94e-03 NA
2. P Q6GLX3 BICD family-like cargo adapter 2 8.42e-05 2.60e-02 NA
2. P A7TJJ7 SWI5-dependent HO expression protein 3 1.33e-03 1.54e-02 NA
2. P Q9CS72 Filamin-A-interacting protein 1 7.15e-06 4.78e-03 NA
2. P Q9ULE4 Protein FAM184B 2.19e-08 7.97e-03 NA
2. P Q4R7H3 Protein Spindly 1.46e-01 1.38e-05 NA
2. P Q86Z20 Coiled-coil domain-containing protein 125 1.62e-01 1.18e-02 NA
2. P Q5NVN6 Centrosomal protein of 63 kDa 1.81e-10 9.82e-03 NA
2. P P0C221 Coiled-coil domain-containing protein 175 8.25e-08 7.02e-04 NA
2. P Q5BIX7 Protein Spindly-A 1.02e-08 1.26e-02 NA
2. P Q5R4U3 Tax1-binding protein 1 homolog 2.68e-05 1.32e-02 NA
2. P Q03410 Synaptonemal complex protein 1 1.24e-07 5.15e-09 NA
2. P Q66H89 Centrosomal protein of 83 kDa 2.34e-06 4.33e-06 NA
2. P A8IQT2 Coiled-coil domain-containing protein 40 homolog 3.95e-07 4.64e-03 NA
2. P Q4R3X1 5-azacytidine-induced protein 2 1.82e-02 2.09e-03 NA
2. P Q9BE52 CDK5 regulatory subunit-associated protein 2 1.05e-06 3.18e-05 NA
2. P Q86VP1 Tax1-binding protein 1 2.06e-05 2.13e-03 NA
2. P Q8HZ58 Coiled-coil alpha-helical rod protein 1 8.05e-06 4.60e-02 NA
2. P P21249 Major antigen 3.39e-04 4.78e-03 NA
2. P F7DP49 Deuterosome assembly protein 1 5.57e-04 1.68e-03 NA
2. P Q49407 Uncharacterized protein MG269 1.93e-03 8.72e-03 NA
2. P Q62209 Synaptonemal complex protein 1 1.97e-07 3.51e-08 NA
2. P Q9Y6K9 NF-kappa-B essential modulator 1.49e-03 1.39e-02 NA
2. P Q9M8T5 WEB family protein At3g02930, chloroplastic 3.17e-05 1.53e-02 NA
2. P Q54HI5 Lamin-like protein 3.38e-05 4.03e-02 NA
2. P Q9UTK5 Nucleoporin alm1 2.14e-04 3.87e-03 NA
2. P A9QT41 NF-kappa-B essential modulator 1.10e-05 6.38e-04 NA
2. P B3DLE8 Protein Spindly 2.94e-05 2.97e-02 NA
2. P Q4KLY0 Centrosomal protein of 63 kDa 4.80e-11 1.56e-03 NA
2. P Q8C9S4 Coiled-coil domain-containing protein 186 4.61e-05 9.86e-04 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 1.74e-03 1.94e-04 NA
2. P Q13439 Golgin subfamily A member 4 3.02e-02 4.55e-03 NA
2. P Q86XR8 Centrosomal protein of 57 kDa 3.24e-03 3.37e-02 NA
2. P Q8CDI7 Coiled-coil domain-containing protein 150 2.17e-09 1.34e-03 NA
2. P Q6NY15 Testis-specific gene 10 protein 2.28e-08 1.03e-02 NA
2. P Q5PQ23 Outer dense fiber protein 2 1.22e-05 1.70e-03 NA
2. P D3Z8K2 Coiled-coil domain-containing protein 39 2.75e-09 1.06e-02 NA
2. P A0PJP4 RILP-like protein 1 6.22e-01 1.96e-04 NA
2. P Q15431 Synaptonemal complex protein 1 2.47e-07 1.86e-08 NA
2. P Q8K4T4 Filamin-A-interacting protein 1 3.73e-06 1.37e-02 NA
2. P Q4R8G4 Centrosomal protein POC5 4.30e-03 4.56e-02 NA
2. P Q66HR5 Calcium-binding and coiled-coil domain-containing protein 1 1.62e-01 1.29e-05 NA
2. P Q8BXX9 Coiled-coil domain-containing protein 169 4.46e-02 3.50e-02 NA
2. P O88522 NF-kappa-B essential modulator 9.57e-04 1.31e-03 NA
2. P Q9ER69 Pre-mRNA-splicing regulator WTAP 9.95e-04 3.10e-04 NA
2. P Q9LS42 Protein CASP 7.14e-06 2.31e-04 NA
2. P Q10PZ6 Microtubule-associated protein 70-4 1.07e-03 8.24e-04 NA
2. P Q498G2 Centrosomal protein of 152 kDa 4.64e-06 3.21e-02 NA
2. P Q3KR99 Protein Spindly 9.91e-02 6.22e-05 NA
2. P Q9FLH0 Protein CROWDED NUCLEI 4 1.88e-06 5.32e-04 NA
2. P Q5U3Z6 Deuterosome assembly protein 1 2.29e-07 9.60e-07 NA
2. P Q8CGU1 Calcium-binding and coiled-coil domain-containing protein 1 9.51e-04 5.80e-04 NA
2. P Q94LW7 Kinesin-like protein KIN-4B 1.23e-04 1.05e-03 NA
2. P F8WBI6 Golgin subfamily A member 8N 1.75e-04 6.21e-03 NA
2. P Q5EBL4 RILP-like protein 1 1.42e-04 8.91e-05 NA
2. P Q3SYW5 5-azacytidine-induced protein 2 5.17e-03 1.39e-02 NA
2. P O95447 Lebercilin-like protein 1.00e-02 1.65e-03 NA
2. P Q6PGZ0 Centrosomal protein of 63 kDa 9.85e-11 3.98e-11 NA
2. P Q8K2I2 Coiled-coil alpha-helical rod protein 1 2.33e-02 1.37e-02 NA
2. P A7E3D8 Lebercilin-like protein 1.11e-02 2.30e-02 NA
2. P Q6P926 Spermatogenesis-associated protein 24 5.34e-05 3.84e-02 NA
2. P Q95JK1 Deuterosome assembly protein 1 1.70e-06 2.64e-09 NA
2. P Q9ZRT1 Protein gamma response 1 2.46e-04 2.43e-02 NA
2. P Q9Z220 Testis-specific gene 10 protein 1.61e-07 4.73e-02 NA
2. P A6H5Y1 M-phase phosphoprotein 9 2.37e-03 5.97e-03 NA
2. P Q6P3P1 Tax1-binding protein 1 homolog 9.52e-06 5.08e-03 NA
2. P Q9Y6D9 Mitotic spindle assembly checkpoint protein MAD1 1.32e-02 6.66e-03 NA
2. P Q92351 Spindle pole body protein pcp1 2.32e-05 7.49e-04 NA
2. P Q7M6Y5 Deuterosome assembly protein 1 3.13e-09 2.21e-06 NA
2. P Q811U3 ELKS/Rab6-interacting/CAST family member 1 1.49e-06 2.50e-02 NA
2. P Q5ZMV2 Spindle assembly abnormal protein 6 homolog 2.29e-02 7.62e-09 NA
2. P A3KNA5 Filamin A-interacting protein 1-like 4.54e-06 1.61e-06 NA
2. P Q8CHG3 GRIP and coiled-coil domain-containing protein 2 4.70e-06 7.89e-04 NA
2. P Q4R7I4 Spermatogenesis-associated protein 24 2.02e-04 2.83e-02 NA
2. P Q91VW5 Golgin subfamily A member 4 1.10e-02 8.22e-03 NA
2. P Q8IYJ2 Uncharacterized protein C10orf67, mitochondrial 6.38e-04 7.78e-07 NA
2. P Q5JU67 Cilia- and flagella-associated protein 157 3.11e-05 4.55e-03 NA
2. P Q3V6T2 Girdin 4.26e-05 2.75e-04 NA
2. P F4HZB5 Protein NETWORKED 1D 6.81e-05 5.18e-06 NA
2. P Q56A40 Coiled-coil domain-containing protein 40 6.20e-08 1.55e-04 NA
2. P Q8N3L3 Beta-taxilin 1.43e-03 1.75e-03 NA
2. P F4HRT5 Protein CROWDED NUCLEI 1 9.23e-06 8.43e-05 NA
2. P Q921M4 Golgin subfamily A member 2 1.36e-05 8.55e-03 NA
2. P Q96Q89 Kinesin-like protein KIF20B 1.01e-02 2.32e-02 NA
2. P Q96MT8 Centrosomal protein of 63 kDa 5.17e-09 3.42e-08 NA
2. P Q95KU9 NF-kappa-B essential modulator 1.99e-04 1.11e-02 NA
2. P Q9U2T3 Uncharacterized protein Y116A8C.11 4.79e-05 1.16e-02 NA
2. P O61308 227 kDa spindle- and centromere-associated protein 2.13e-04 2.08e-07 NA
2. P Q8BGY3 Leucine zipper protein 2 3.02e-03 1.85e-04 NA
2. P A6NMD2 Golgin subfamily A member 8J 6.87e-03 4.23e-02 NA
2. P Q08379 Golgin subfamily A member 2 5.52e-04 8.38e-03 NA
2. P Q9C9X0 Microtubule-associated protein 70-1 1.67e-04 1.92e-03 NA
2. P Q5PQJ9 Coiled-coil domain-containing protein 175 1.34e-08 4.18e-05 NA
2. P Q5SNZ0 Girdin 4.90e-04 7.37e-05 NA
2. P Q9CW79 Golgin subfamily A member 1 4.76e-06 1.22e-04 NA
2. P Q86TE4 Leucine zipper protein 2 1.41e-03 1.32e-03 NA
2. P Q9PW73 Cytoskeletal protein Sojo 2.57e-02 1.50e-02 NA
2. P Q5R829 Outer dense fiber protein 2 1.56e-08 2.05e-03 NA
2. P Q8IWJ2 GRIP and coiled-coil domain-containing protein 2 5.23e-05 1.39e-08 NA
2. P Q8IYE0 Coiled-coil domain-containing protein 146 9.49e-08 9.96e-04 NA
2. P A0A068FIK2 Kinesin-like protein KIN-4A 2.53e-05 4.78e-02 NA
2. P Q9WTX8 Mitotic spindle assembly checkpoint protein MAD1 2.18e-02 8.30e-03 NA
2. P A2BGD5 Calcium-binding and coiled-coil domain-containing protein 1 3.37e-04 2.71e-06 NA
2. P D3ZZL9 GRIP and coiled-coil domain-containing protein 2 7.32e-06 1.01e-04 NA
2. P Q96NL6 Sodium channel and clathrin linker 1 5.51e-10 2.91e-03 NA
2. P Q0IHE5 RILP-like protein 1 2.66e-04 1.06e-02 NA
2. P Q4V7B0 Cilia- and flagella-associated protein 157 2.05e-05 1.98e-04 NA
2. P Q80UK7 Spindle assembly abnormal protein 6 homolog 2.90e-03 2.52e-07 NA
2. P Q569K6 Coiled-coil domain-containing protein 157 5.12e-03 4.27e-02 NA
2. P Q05D60 Deuterosome assembly protein 1 5.07e-06 8.28e-08 NA
2. P Q7FAD5 Synaptonemal complex protein ZEP1 1.57e-06 7.49e-06 NA
2. P A7E2F4 Golgin subfamily A member 8A 3.12e-04 1.20e-03 NA
2. P Q9LME2 Synaptonemal complex protein 1 3.52e-06 2.81e-02 NA
2. P Q9I969 Beta-taxilin 2.14e-03 3.74e-02 NA
2. P Q5HZK9 Centrosomal protein of 63 kDa-B 6.63e-10 4.19e-02 NA
2. P Q4L180 Filamin A-interacting protein 1-like 2.29e-06 8.43e-06 NA
2. P P32380 Spindle pole body component 110 1.92e-03 1.09e-02 NA
2. P Q9C9N6 Protein PLASTID MOVEMENT IMPAIRED 2 9.07e-09 3.00e-03 NA
2. P Q8MUF6 Paramyosin 5.09e-08 9.86e-04 NA
2. P Q8K3M6 ERC protein 2 1.82e-05 1.26e-04 NA
2. P Q8VBT1 Beta-taxilin 1.07e-02 4.02e-04 NA
2. P Q6CMB5 Spindle pole body component 110 2.44e-06 3.42e-03 NA
2. P Q923A2 Protein Spindly 1.14e-01 1.70e-05 NA
2. P A7YWC8 Vimentin-type intermediate filament-associated coiled-coil protein 1.19e-02 1.15e-02 NA
2. P Q3V079 Basal body-orientation factor 1 1.57e-06 2.73e-02 NA
2. P D3ZUQ0 RILP-like protein 1 4.17e-04 8.33e-05 NA
2. P Q7Z3E2 Coiled-coil domain-containing protein 186 3.45e-06 3.60e-03 NA
2. P Q9BMM8 Paramyosin 6.44e-08 8.74e-06 NA
2. P Q9ZQX8 Protein NETWORKED 1C 3.31e-07 1.85e-05 NA
2. P Q8S2T0 Protein GRIP 6.82e-05 9.13e-07 NA
2. P Q6YUL8 Kinesin-like protein KIN-4A 3.18e-03 2.73e-03 NA
2. P A2IDD5 Coiled-coil domain-containing protein 78 3.78e-04 1.29e-04 NA
2. P Q6UVJ0 Spindle assembly abnormal protein 6 homolog 7.76e-03 6.57e-09 NA
2. P H3BV12 Golgin subfamily A member 8Q 3.99e-04 3.56e-03 NA
2. P Q9ZUA3 Microtubule-associated protein 70-3 3.29e-04 7.82e-03 NA
2. P Q8BI22 Centrosomal protein of 128 kDa 6.40e-09 1.35e-12 NA
2. P Q15007 Pre-mRNA-splicing regulator WTAP 4.94e-03 9.97e-05 NA
2. P Q4V891 Centrosomal protein POC5 1.78e-02 4.39e-02 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 3.62e-04 1.03e-03 NA
2. P C5DUI8 SWI5-dependent HO expression protein 3 3.69e-03 3.03e-02 NA
2. P Q80WE4 Kinesin-like protein KIF20B 2.49e-04 2.62e-03 NA
2. P Q66H60 Coiled-coil domain-containing protein 146 1.89e-05 2.41e-02 NA
2. P A7MD70 Protein Spindly 1.78e-05 2.63e-08 NA
2. P Q5U4E6 Golgin subfamily A member 4 8.14e-05 1.46e-06 NA
2. P Q8BVF4 Coiled-coil domain-containing protein 30 9.86e-09 2.14e-04 NA
2. P Q2KJ21 Calcium-binding and coiled-coil domain-containing protein 1 3.89e-03 4.77e-06 NA
2. P Q17QG3 RILP-like protein 1 5.66e-04 7.68e-07 NA
2. P Q6P6L0 Filamin A-interacting protein 1-like 7.98e-07 1.20e-04 NA
2. P Q10030 Uncharacterized protein C27D6.1 1.98e-07 4.37e-03 NA
2. P E1BM70 Coiled-coil domain-containing protein 39 2.98e-08 1.07e-03 NA
2. P P61584 Rho-associated protein kinase 1 (Fragment) 4.39e-06 4.31e-02 NA
3. B P48678 Prelamin-A/C 4.38e-04 NA 0.019
3. B P02545 Prelamin-A/C 4.90e-04 NA 0.014
3. B Q00174 Laminin subunit alpha NA NA 0.042
3. B Q3ZD69 Prelamin-A/C 3.94e-04 NA 0.007
3. B O15230 Laminin subunit alpha-5 NA NA 0.030
3. B Q75AF5 Golgin IMH1 8.08e-09 NA 0.003
3. B P48679 Prelamin-A/C 3.62e-03 NA 0.019
3. B B6MFW3 Protein Hook homolog 2.76e-05 NA 2.23e-04
3. B Q21313 Laminin-like protein epi-1 NA NA 2.76e-08
3. B Q5M775 Cytospin-B 5.50e-04 NA 0.047