Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q6SJ91
(Sperm protein associated with the nucleus on the X chromosome N1) with a FATCAT P-Value: 1.65e-09 and RMSD of 2.60 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein Q5MJ07 colored as red in alignment, homolog Q6SJ91 colored as blue.
Query protein Q5MJ07 is also shown in right top, homolog Q6SJ91 showed in right bottom. They are colored based on secondary structures.
Q5MJ07 MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS 72 Q6SJ91 MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS 72
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0010468 | regulation of gene expression |
| 2. P | GO:0042101 | T cell receptor complex |
| 2. P | GO:0009617 | response to bacterium |
| 2. P | GO:0002250 | adaptive immune response |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0007286 | spermatid development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6SJ91 | Sperm protein associated with the nucleus on the X chromosome N1 | 1.65e-09 | 6.55e-131 | 9.37e-47 |
| 1. PB | Q5MJ07 | Sperm protein associated with the nucleus on the X chromosome N5 | 0 | 6.55e-131 | 9.37e-47 |
| 1. PB | Q5VSR9 | Sperm protein associated with the nucleus on the X chromosome N1 | 4.74e-05 | 1.48e-36 | 2.05e-40 |
| 1. PB | Q6SJ84 | Sperm protein associated with the nucleus on the X chromosome N1 | 6.73e-08 | 3.64e-99 | 3.91e-46 |
| 2. P | Q05105 | Uncharacterized 16.7 kDa protein | NA | 3.54e-04 | NA |
| 2. P | P01848 | T cell receptor alpha chain constant | 3.11e-02 | 7.90e-03 | NA |
| 2. P | P14379 | Transcriptional regulator ICP22 homolog (Fragment) | NA | 2.28e-02 | NA |
| 2. P | Q9E6L7 | Uncharacterized gene 93 protein | NA | 1.24e-03 | NA |
| 3. B | Q0ZNK1 | Sperm protein associated with the nucleus on the X chromosome N3 | 2.06e-02 | NA | 8.39e-29 |
| 3. B | Q5MJ09 | Sperm protein associated with the nucleus on the X chromosome N3 | 2.16e-02 | NA | 1.73e-26 |
| 3. B | Q9NY87 | Sperm protein associated with the nucleus on the X chromosome C | 1.94e-02 | NA | 8.33e-10 |
| 3. B | Q5MJ08 | Sperm protein associated with the nucleus on the X chromosome N4 | 1.57e-02 | NA | 2.60e-09 |
| 3. B | Q9NS25 | Sperm protein associated with the nucleus on the X chromosome B1 | 8.17e-02 | NA | 5.98e-06 |
| 3. B | Q5MJ10 | Sperm protein associated with the nucleus on the X chromosome N2 | 1.68e-02 | NA | 4.17e-26 |
| 3. B | Q6SJ82 | Sperm protein associated with the nucleus on the X chromosome N2 | 4.94e-03 | NA | 1.68e-45 |
| 3. B | Q9NS26 | Sperm protein associated with the nucleus on the X chromosome A | 1.55e-02 | NA | 6.63e-13 |
| 3. B | Q9BXN6 | Sperm protein associated with the nucleus on the X chromosome D | 6.62e-02 | NA | 1.29e-09 |