Summary

Q5MJ08

Homolog: Q5MJ09.
Function: Sperm protein associated with the nucleus on the X chromosome N3.

Statistics

Total GO Annotation: 31
Unique PROST Go: 31
Unique BLAST Go: 0

Total Homologs: 24
Unique PROST Homologs: 15
Unique BLAST Homologs: 8

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q5MJ09 (Sperm protein associated with the nucleus on the X chromosome N3) with a FATCAT P-Value: 0.000142 and RMSD of 3.03 angstrom. The sequence alignment identity is 40.1%.
Structural alignment shown in left. Query protein Q5MJ08 colored as red in alignment, homolog Q5MJ09 colored as blue. Query protein Q5MJ08 is also shown in right top, homolog Q5MJ09 showed in right bottom. They are colored based on secondary structures. 

  Q5MJ08 MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTL-VFYCRKNKKRNSNQLENNQPTESSTDPI-KEKGD--LDISAGSPQ-D 95
  Q5MJ09 MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLENEQSQENSINPIQKEE-DEGVDLSEGSSNED 99

  Q5MJ08 ---G---GQN-------------------------------- 99
  Q5MJ09 EDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGED 141

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0006283 transcription-coupled nucleotide-excision repair
2. P GO:1901666 positive regulation of NAD+ ADP-ribosyltransferase activity
2. P GO:0019985 translesion synthesis
2. P GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P GO:0003682 chromatin binding
2. P GO:0016032 viral process
2. P GO:0003700 DNA-binding transcription factor activity
2. P GO:0050678 regulation of epithelial cell proliferation
2. P GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
2. P GO:0044196 host cell nucleolus
2. P GO:0051028 mRNA transport
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0005634 nucleus
2. P GO:0031492 nucleosomal DNA binding
2. P GO:0030430 host cell cytoplasm
2. P GO:0010224 response to UV-B
2. P GO:0007098 centrosome cycle
2. P GO:0003723 RNA binding
2. P GO:0000720 pyrimidine dimer repair by nucleotide-excision repair
2. P GO:0009411 response to UV
2. P GO:0010225 response to UV-C
2. P GO:0006325 chromatin organization
2. P GO:0040034 regulation of development, heterochronic
2. P GO:0061178 regulation of insulin secretion involved in cellular response to glucose stimulus
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0032786 positive regulation of DNA-templated transcription, elongation
2. P GO:0000785 chromatin
2. P GO:0032056 positive regulation of translation in response to stress
2. P GO:0048597 post-embryonic camera-type eye morphogenesis
2. P GO:0051091 positive regulation of DNA-binding transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5MJ08 Sperm protein associated with the nucleus on the X chromosome N4 0 1.43e-144 9.28e-68
2. P Q5R715 High mobility group nucleosome-binding domain-containing protein 3 1.56e-02 5.24e-04 NA
2. P P31628 Protein Rev NA 1.99e-02 NA
2. P Q95228 Kappa-casein (Fragment) 1.76e-02 1.76e-02 NA
2. P Q66H40 High mobility group nucleosome-binding domain-containing protein 3 2.08e-02 2.23e-03 NA
2. P Q6AZL2 PCNA-associated factor 3.18e-01 7.82e-07 NA
2. P P04623 Protein Rev NA 1.61e-02 NA
2. P Q3ZBV4 High mobility group nucleosome-binding domain-containing protein 3 3.21e-02 1.58e-02 NA
2. P Q9DCB1 High mobility group nucleosome-binding domain-containing protein 3 2.71e-02 3.16e-04 NA
2. P P02316 Non-histone chromosomal protein HMG-14 5.65e-03 4.20e-03 NA
2. P Q15651 High mobility group nucleosome-binding domain-containing protein 3 2.17e-02 9.51e-05 NA
2. P P40023 Enhancer of mRNA-decapping protein 2 5.34e-02 3.40e-02 NA
2. P P05114 Non-histone chromosomal protein HMG-14 3.02e-03 3.35e-03 NA
2. P P05869 Protein Rev (Fragment) NA 4.81e-02 NA
2. P P05871 Protein Rev NA 5.72e-03 NA
2. P Q5ZIR5 High mobility group nucleosome-binding domain-containing protein 3 3.45e-02 8.34e-03 NA
3. B Q0ZNK1 Sperm protein associated with the nucleus on the X chromosome N3 6.54e-04 NA 4.76e-20
3. B Q6SJ91 Sperm protein associated with the nucleus on the X chromosome N1 1.00e-02 NA 1.26e-10
3. B Q5MJ09 Sperm protein associated with the nucleus on the X chromosome N3 1.42e-04 NA 4.14e-24
3. B Q5VSR9 Sperm protein associated with the nucleus on the X chromosome N1 1.10e-02 NA 2.66e-12
3. B Q6SJ84 Sperm protein associated with the nucleus on the X chromosome N1 2.33e-02 NA 1.68e-10
3. B Q5MJ07 Sperm protein associated with the nucleus on the X chromosome N5 1.57e-02 NA 1.26e-10
3. B Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 5.85e-02 NA 1.85e-20
3. B Q6SJ82 Sperm protein associated with the nucleus on the X chromosome N2 1.31e-02 NA 4.64e-15