Summary

Q5SSQ6

Homolog: Q9CY86.
Function: Suppressor APC domain-containing protein 1.

Statistics

Total GO Annotation: 165
Unique PROST Go: 154
Unique BLAST Go: 10

Total Homologs: 229
Unique PROST Homologs: 225
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9CY86 (Suppressor APC domain-containing protein 1) with a FATCAT P-Value: 4.99e-09 and RMSD of 2.76 angstrom. The sequence alignment identity is 71.6%.
Structural alignment shown in left. Query protein Q5SSQ6 colored as red in alignment, homolog Q9CY86 colored as blue. Query protein Q5SSQ6 is also shown in right top, homolog Q9CY86 showed in right bottom. They are colored based on secondary structures. 

  Q5SSQ6 MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPL 100
  Q9CY86 MESPGPGGPPLVQAPYTVLLLPLGTSRQDPGAQNFFLWLQMMQALEREQDALWQGLELLEHGQAWFADRLRETQQRQLQLGALGEDFLMDLHSETDAPLL 100

  Q5SSQ6 AQIQKVNICLQNLIHEKELSRQQKGVTQPKEEMAQRGCTKGPRGPTRV 148
  Q9CY86 TRIQKVNACLHSLIH-KELSKHRKGVTQSTGEVVSQ-APPGPKGPTLV 146

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005654 nucleoplasm
2. P GO:0005768 endosome
2. P GO:0008090 retrograde axonal transport
2. P GO:0034993 meiotic nuclear membrane microtubule tethering complex
2. P GO:0051604 protein maturation
2. P GO:0045141 meiotic telomere clustering
2. P GO:0099078 BORC complex
2. P GO:0018342 protein prenylation
2. P GO:0042809 vitamin D receptor binding
2. P GO:1905907 negative regulation of amyloid fibril formation
2. P GO:0016188 synaptic vesicle maturation
2. P GO:0030010 establishment of cell polarity
2. P GO:0046887 positive regulation of hormone secretion
2. P GO:0051495 positive regulation of cytoskeleton organization
2. P GO:0005127 ciliary neurotrophic factor receptor binding
2. P GO:0048804 imaginal disc-derived female genitalia morphogenesis
2. P GO:0007042 lysosomal lumen acidification
2. P GO:0016272 prefoldin complex
2. P GO:0030141 secretory granule
2. P GO:0033299 secretion of lysosomal enzymes
2. P GO:0007032 endosome organization
2. P GO:0005929 cilium
2. P GO:0008021 synaptic vesicle
2. P GO:0016079 synaptic vesicle exocytosis
2. P GO:0000149 SNARE binding
2. P GO:0019101 female somatic sex determination
2. P GO:0050885 neuromuscular process controlling balance
2. P GO:0010017 red or far-red light signaling pathway
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0060392 negative regulation of SMAD protein signal transduction
2. P GO:0016020 membrane
2. P GO:0008089 anterograde axonal transport
2. P GO:0030318 melanocyte differentiation
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0048489 synaptic vesicle transport
2. P GO:0010438 cellular response to sulfur starvation
2. P GO:0070062 extracellular exosome
2. P GO:0061909 autophagosome-lysosome fusion
2. P GO:0007098 centrosome cycle
2. P GO:0032880 regulation of protein localization
2. P GO:0046907 intracellular transport
2. P GO:1990758 mitotic sister chromatid biorientation
2. P GO:0050942 positive regulation of pigment cell differentiation
2. P GO:0048691 positive regulation of axon extension involved in regeneration
2. P GO:0005198 structural molecule activity
2. P GO:0005886 plasma membrane
2. P GO:0097345 mitochondrial outer membrane permeabilization
2. P GO:0043015 gamma-tubulin binding
2. P GO:0019898 extrinsic component of membrane
2. P GO:0005694 chromosome
2. P GO:0005880 nuclear microtubule
2. P GO:0035646 endosome to melanosome transport
2. P GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
2. P GO:0048573 photoperiodism, flowering
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005856 cytoskeleton
2. P GO:0008333 endosome to lysosome transport
2. P GO:0030864 cortical actin cytoskeleton
2. P GO:0001540 amyloid-beta binding
2. P GO:0016592 mediator complex
2. P GO:0044183 protein folding chaperone
2. P GO:0048490 anterograde synaptic vesicle transport
2. P GO:0001222 transcription corepressor binding
2. P GO:0000801 central element
2. P GO:0072553 terminal button organization
2. P GO:0061025 membrane fusion
2. P GO:0051225 spindle assembly
2. P GO:0042753 positive regulation of circadian rhythm
2. P GO:2000300 regulation of synaptic vesicle exocytosis
2. P GO:0097352 autophagosome maturation
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0046786 viral replication complex formation and maintenance
2. P GO:0031083 BLOC-1 complex
2. P GO:0006886 intracellular protein transport
2. P GO:0046533 negative regulation of photoreceptor cell differentiation
2. P GO:0031201 SNARE complex
2. P GO:0031674 I band
2. P GO:1902824 positive regulation of late endosome to lysosome transport
2. P GO:0032838 plasma membrane bounded cell projection cytoplasm
2. P GO:0048511 rhythmic process
2. P GO:0000813 ESCRT I complex
2. P GO:0019827 stem cell population maintenance
2. P GO:0048680 positive regulation of axon regeneration
2. P GO:0007026 negative regulation of microtubule depolymerization
2. P GO:0016197 endosomal transport
2. P GO:0030027 lamellipodium
2. P GO:0010520 regulation of reciprocal meiotic recombination
2. P GO:0000707 meiotic DNA recombinase assembly
2. P GO:0140444 cytoskeleton-nuclear membrane anchor activity
2. P GO:0032402 melanosome transport
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0036064 ciliary basal body
2. P GO:0039675 exit of virus from host cell nucleus through nuclear pore
2. P GO:0030335 positive regulation of cell migration
2. P GO:0042592 homeostatic process
2. P GO:0060075 regulation of resting membrane potential
2. P GO:0048644 muscle organ morphogenesis
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0005765 lysosomal membrane
2. P GO:0042803 protein homodimerization activity
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0008585 female gonad development
2. P GO:0043473 pigmentation
2. P GO:0051015 actin filament binding
2. P GO:0007269 neurotransmitter secretion
2. P GO:0036258 multivesicular body assembly
2. P GO:0070527 platelet aggregation
2. P GO:0043393 regulation of protein binding
2. P GO:0007040 lysosome organization
2. P GO:0070120 ciliary neurotrophic factor-mediated signaling pathway
2. P GO:0046668 regulation of retinal cell programmed cell death
2. P GO:0051455 monopolar spindle attachment to meiosis I kinetochore
2. P GO:0009648 photoperiodism
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0031904 endosome lumen
2. P GO:1902441 protein localization to meiotic spindle pole body
2. P GO:1902774 late endosome to lysosome transport
2. P GO:0009649 entrainment of circadian clock
2. P GO:0030437 ascospore formation
2. P GO:0030672 synaptic vesicle membrane
2. P GO:0035974 meiotic spindle pole body
2. P GO:0018993 somatic sex determination
2. P GO:1904115 axon cytoplasm
2. P GO:0016021 integral component of membrane
2. P GO:0042729 DASH complex
2. P GO:0060271 cilium assembly
2. P GO:0042025 host cell nucleus
2. P GO:0031175 neuron projection development
2. P GO:0032418 lysosome localization
2. P GO:0034629
2. P GO:0000930 gamma-tubulin complex
2. P GO:0005813 centrosome
2. P GO:0051151 negative regulation of smooth muscle cell differentiation
2. P GO:0002177 manchette
2. P GO:0045103 intermediate filament-based process
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0003712 transcription coregulator activity
2. P GO:0035263 genital disc sexually dimorphic development
2. P GO:0000795 synaptonemal complex
2. P GO:0070652 HAUS complex
2. P GO:0021822 negative regulation of cell motility involved in cerebral cortex radial glia guided migration
2. P GO:0003779 actin binding
2. P GO:0001669 acrosomal vesicle
2. P GO:0030133 transport vesicle
2. P GO:0070319 Golgi to plasma membrane transport vesicle
2. P GO:0005882 intermediate filament
2. P GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0010540 basipetal auxin transport
2. P GO:0007596 blood coagulation
2. P GO:0032816 positive regulation of natural killer cell activation
2. P GO:0031322 ascospore-type prospore-specific spindle pole body remodeling
2. P GO:0005138 interleukin-6 receptor binding
2. P GO:0032438 melanosome organization
2. P GO:0031629 synaptic vesicle fusion to presynaptic active zone membrane
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter
3. B GO:0090175 regulation of establishment of planar polarity
3. B GO:0000132 establishment of mitotic spindle orientation
3. B GO:0005923 bicellular tight junction
3. B GO:0043296 apical junction complex
3. B GO:0005730 nucleolus
3. B GO:1904777 negative regulation of protein localization to cell cortex
3. B GO:0016324 apical plasma membrane
3. B GO:0045179 apical cortex
3. B GO:0008284 positive regulation of cell population proliferation
3. B GO:0098725 symmetric cell division

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5SSQ6 Suppressor APC domain-containing protein 1 0 1.59e-142 4.09e-105
1. PB Q9CY86 Suppressor APC domain-containing protein 1 4.99e-09 1.62e-31 2.01e-66
2. P P0CU25 Uncharacterized protein SPAC29A4.23 5.51e-06 5.72e-05 NA
2. P Q0A2I2 Nuclear export protein NA 2.21e-03 NA
2. P Q0P5J6 Keratin, type I cytoskeletal 27 5.26e-03 1.54e-02 NA
2. P Q9H1L0 Uncharacterized protein MIR1-1HG 2.13e-02 8.84e-05 NA
2. P P03504 Nuclear export protein NA 2.23e-03 NA
2. P P69267 Nuclear export protein NA 1.72e-02 NA
2. P Q6SXP0 Bublin coiled-coil protein 2.36e-07 2.35e-02 NA
2. P Q6IFX4 Keratin, type I cytoskeletal 39 4.24e-03 8.62e-04 NA
2. P Q8NCU1 Uncharacterized protein CCDC197 6.52e-05 8.05e-03 NA
2. P Q9H204 Mediator of RNA polymerase II transcription subunit 28 1.91e-04 2.86e-03 NA
2. P O41650 Nuclear export protein NA 1.42e-03 NA
2. P Q9Z266 SNARE-associated protein Snapin 3.52e-05 1.94e-06 NA
2. P Q0IHI6 Mediator of RNA polymerase II transcription subunit 30 2.81e-04 7.46e-04 NA
2. P P51642 Ciliary neurotrophic factor 7.51e-04 8.78e-03 NA
2. P Q5EB94 Myocardial zonula adherens protein 5.77e-03 1.45e-02 NA
2. P Q75ED7 DASH complex subunit DUO1 3.78e-05 1.06e-02 NA
2. P Q6XSV5 Nuclear export protein NA 1.38e-03 NA
2. P Q9NX70 Mediator of RNA polymerase II transcription subunit 29 4.99e-04 1.51e-03 NA
2. P P03505 Nuclear export protein NA 2.69e-03 NA
2. P A4JLT2 Exodeoxyribonuclease 7 small subunit 1.06e-03 3.73e-02 NA
2. P Q6XTC3 Nuclear export protein NA 1.40e-03 NA
2. P P69266 Nuclear export protein NA 1.72e-02 NA
2. P Q3UIJ9 Myocardial zonula adherens protein 4.22e-03 4.16e-03 NA
2. P A4GBY2 Nuclear export protein NA 2.23e-03 NA
2. P Q7VLP5 UPF0265 protein HD_1377 4.03e-07 3.59e-02 NA
2. P Q910E4 Nuclear export protein NA 1.38e-03 NA
2. P Q2TBN4 Mediator of RNA polymerase II transcription subunit 28 2.40e-04 2.48e-02 NA
2. P P69258 Nuclear export protein NA 2.44e-02 NA
2. P P13150 Nuclear export protein NA 2.64e-03 NA
2. P Q4PDA7 Mediator of RNA polymerase II transcription subunit 10 2.68e-04 7.53e-03 NA
2. P P0C5T9 Nuclear export protein NA 2.99e-04 NA
2. P Q93V47 Guanine nucleotide-binding protein subunit gamma 2 7.68e-04 2.41e-02 NA
2. P Q2ICQ5 Nuclear export protein NA 2.44e-02 NA
2. P Q0A463 Nuclear export protein NA 1.24e-03 NA
2. P P17043 Nuclear export protein NA 2.12e-03 NA
2. P E7KB73 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 3.39e-05 4.30e-05 NA
2. P B0BN18 Prefoldin subunit 2 6.60e-04 1.76e-02 NA
2. P Q76MT9 Nuclear export protein NA 2.12e-03 NA
2. P Q148H6 Keratin, type I cytoskeletal 28 9.40e-03 6.26e-03 NA
2. P Q8TDM0 Breast carcinoma-amplified sequence 4 1.83e-04 1.35e-04 NA
2. P E7KM17 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 NA 7.27e-05 NA
2. P P34665 Uncharacterized protein ZK652.8 1.16e-05 5.85e-06 NA
2. P P13147 Nuclear export protein NA 4.09e-04 NA
2. P A6ZRZ4 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 4.55e-06 3.80e-07 NA
2. P Q08D01 Mediator of RNA polymerase II transcription subunit 29 2.91e-04 7.60e-03 NA
2. P P0C5T7 Nuclear export protein NA 1.30e-03 NA
2. P Q9QUI1 Leucine repeat adapter protein 25 5.98e-04 1.86e-03 NA
2. P B4YNF6 Uncharacterized protein V16 NA 1.97e-02 NA
2. P Q8S8F5 Protein ELF4-LIKE 3 3.38e-05 1.13e-08 NA
2. P P69260 Nuclear export protein NA 1.30e-03 NA
2. P C8Z5R9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 3.51e-06 4.30e-05 NA
2. P O56263 Nuclear export protein NA 6.80e-04 NA
2. P Q0A2H1 Nuclear export protein NA 2.75e-03 NA
2. P P30913 Nuclear export protein NA 2.64e-03 NA
2. P A7TLF1 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 1.79e-06 2.02e-04 NA
2. P O80877 Protein ELF4-LIKE 1 8.53e-05 1.10e-03 NA
2. P Q66KX4 Mediator of RNA polymerase II transcription subunit 29 2.77e-04 2.45e-04 NA
2. P Q5R562 bMERB domain-containing protein 1 5.22e-04 8.19e-04 NA
2. P Q2VC88 Nuclear export protein NA 2.75e-03 NA
2. P Q10006 Uncharacterized protein hal-3 1.51e-07 2.02e-02 NA
2. P Q9VTE0 Biogenesis of lysosome-related organelles complex 1 subunit 2 5.46e-06 2.25e-04 NA
2. P Q9NUP1 Biogenesis of lysosome-related organelles complex 1 subunit 4 6.46e-05 5.85e-03 NA
2. P Q8R1Y2 bMERB domain-containing protein 1 2.90e-04 1.21e-03 NA
2. P B0ULP6 UPF0335 protein M446_5200 7.29e-03 2.44e-02 NA
2. P P03508 Nuclear export protein NA 2.95e-03 NA
2. P Q5RE16 HAUS augmin-like complex subunit 2 6.43e-04 4.39e-02 NA
2. P P11619 Nuclear export protein NA 1.96e-04 NA
2. P P60192 SNARE-associated protein Snapin 2.98e-05 1.94e-06 NA
2. P B8ITT7 UPF0335 protein Mnod_5968 7.34e-03 3.59e-02 NA
2. P Q38SQ3 Nuclear export protein NA 2.44e-02 NA
2. P Q0A3Q4 Nuclear export protein NA 2.75e-03 NA
2. P P0DO97 Coiled-coil domain-containing protein 192 2.52e-04 6.51e-03 NA
2. P Q3SBF1 Nuclear export protein NA 7.04e-05 NA
2. P Q96HR3 Mediator of RNA polymerase II transcription subunit 30 1.68e-04 1.32e-04 NA
2. P Q5K2P4 Keratin, type I cytoskeletal 13 3.98e-03 1.52e-03 NA
2. P Q969X0 RILP-like protein 2 1.18e-04 3.32e-03 NA
2. P Q08AY9 Protein FAM89A 5.40e-04 2.51e-03 NA
2. P B3LFU5 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 5.76e-06 4.30e-05 NA
2. P A4IFK7 RILP-like protein 2 1.43e-04 1.06e-02 NA
2. P Q7Z3Y7 Keratin, type I cytoskeletal 28 3.96e-04 1.36e-02 NA
2. P Q32WR5 Biogenesis of lysosome-related organelles complex-1 subunit 2 7.07e-06 3.79e-02 NA
2. P Q20NN8 Nuclear export protein NA 2.75e-03 NA
2. P Q8JHI6 Mediator of RNA polymerase II transcription subunit 29 3.45e-05 1.98e-03 NA
2. P Q67255 Nuclear export protein NA 1.24e-03 NA
2. P P0C5T8 Nuclear export protein NA 1.48e-02 NA
2. P Q6DP67 Nuclear export protein NA 4.09e-04 NA
2. P Q89733 Nuclear export protein NA 5.16e-03 NA
2. P A4K148 Nuclear export protein NA 1.30e-03 NA
2. P Q9VQF9 SNAPIN protein homolog 3.69e-05 8.54e-06 NA
2. P Q57796 Uncharacterized protein MJ0350 1.26e-09 1.77e-02 NA
2. P Q9DB91 Mediator of RNA polymerase II transcription subunit 29 3.61e-04 2.06e-02 NA
2. P P08273 Nuclear export protein NA 2.59e-03 NA
2. P O44445 SNAPIN protein homolog 4.89e-05 2.50e-04 NA
2. P Q6ZMV7 Protein LEKR1 1.41e-03 2.60e-02 NA
2. P A4GCK2 Nuclear export protein NA 2.21e-03 NA
2. P O57275 Nuclear export protein NA 4.27e-04 NA
2. P Q5R8D4 Arginine vasopressin-induced protein 1 1.74e-01 7.54e-04 NA
2. P P69259 Nuclear export protein NA 1.30e-03 NA
2. P Q5K2P6 Keratin, type 1 cytoskeletal 11 2.10e-03 5.07e-05 NA
2. P Q07FI0 Nuclear export protein NA 1.51e-05 NA
2. P Q6FP96 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 2.51e-06 5.95e-04 NA
2. P Q9SCK1 Protein RESPONSE TO LOW SULFUR 1 1.06e-05 2.44e-03 NA
2. P Q6XTK1 Nuclear export protein NA 5.53e-04 NA
2. P Q8VED2 Biogenesis of lysosome-related organelles complex 1 subunit 4 6.23e-05 9.54e-05 NA
2. P B5FY93 Bublin coiled-coil protein 1.56e-05 2.85e-02 NA
2. P A4GCJ1 Nuclear export protein NA 6.31e-05 NA
2. P B4URE1 Nuclear export protein NA 2.95e-03 NA
2. P C7GUN6 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 4.56e-06 5.09e-07 NA
2. P A8WJ42 COA8 family protein CBG23705, mitochondrial 8.01e-05 4.56e-02 NA
2. P P69257 Nuclear export protein NA 2.44e-02 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 1.52e-05 1.00e-02 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 5.74e-04 7.02e-04 NA
2. P P86247 Keratin, type II cytoskeletal 8 (Fragments) 6.69e-07 9.39e-03 NA
2. P Q96MC5 bMERB domain-containing protein 1 6.15e-05 4.00e-03 NA
2. P A1L168 Uncharacterized protein C20orf202 8.26e-04 7.76e-05 NA
2. P P08279 Nuclear export protein (Fragment) NA 6.70e-03 NA
2. P Q463X0 Nuclear export protein NA 2.44e-02 NA
2. P Q1PUD4 Nuclear export protein NA 2.44e-02 NA
2. P O89285 Nuclear export protein NA 1.72e-04 NA
2. P Q6PIF2 Synaptonemal complex central element protein 2 3.44e-05 5.15e-04 NA
2. P O95295 SNARE-associated protein Snapin 1.66e-05 5.67e-07 NA
2. P P0C5U0 Nuclear export protein NA 4.33e-03 NA
2. P A4U6V7 Nuclear export protein NA 1.36e-03 NA
2. P Q20PL9 Nuclear export protein NA 2.27e-03 NA
2. P P0C2M1 Nuclear export protein NA 3.09e-03 NA
2. P Q289M2 Nuclear export protein NA 1.36e-04 NA
2. P Q9R0C0 Biogenesis of lysosome-related organelles complex 1 subunit 6 1.21e-05 5.91e-05 NA
2. P Q6DP71 Nuclear export protein NA 4.09e-04 NA
2. P A7YWM2 Keratin, type I cytoskeletal 40 2.59e-03 9.30e-03 NA
2. P Q02600 Nuclear export protein NA 3.77e-03 NA
2. P A1A4Q8 Mediator of RNA polymerase II transcription subunit 29 1.73e-04 1.31e-02 NA
2. P Q7KBL8 Mediator of RNA polymerase II transcription subunit 29 1.92e-04 2.99e-02 NA
2. P Q7Z3Y9 Keratin, type I cytoskeletal 26 6.95e-03 8.36e-04 NA
2. P C5DUB3 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 2.75e-06 2.55e-04 NA
2. P Q0A2Q9 Nuclear export protein NA 1.67e-03 NA
2. P Q9NVX0 HAUS augmin-like complex subunit 2 1.79e-03 5.21e-06 NA
2. P Q08955 Chromosome segregation in meiosis protein 4 1.46e-06 3.52e-06 NA
2. P Q77IX1 Nuclear export protein NA 1.24e-03 NA
2. P Q1K9P8 Nuclear export protein NA 1.30e-03 NA
2. P Q8H960 Tobamovirus multiplication protein 2B 1.05e-06 1.76e-02 NA
2. P P03509 Nuclear export protein NA 2.75e-03 NA
2. P P13148 Nuclear export protein NA 4.72e-03 NA
2. P Q6GPT7 Protein MIX23 2.36e-05 9.16e-04 NA
2. P Q756L2 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 6.13e-06 1.27e-02 NA
2. P O09680 Nuclear export protein NA 2.75e-03 NA
2. P C6Y4C9 Sporulation-specific protein 13 3.25e-06 1.26e-05 NA
2. P Q4V8A6 Biogenesis of lysosome-related organelles complex 1 subunit 6 1.27e-05 1.05e-03 NA
2. P A8C8J9 Nuclear export protein NA 1.36e-04 NA
2. P A3DRP5 Nuclear export protein NA 6.26e-03 NA
2. P Q6XTD9 Nuclear export protein NA 6.97e-03 NA
2. P Q76S20 Nuclear export protein NA 2.75e-03 NA
2. P Q6IFW3 Keratin, type I cytoskeletal 39 3.72e-03 7.31e-03 NA
2. P P32489 Meiosis protein 5 4.95e-05 4.08e-02 NA
2. P Q755V6 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 1.30e-05 9.12e-03 NA
2. P Q9D9F8 Mirror-image polydactyly gene 1 protein homolog 7.94e-05 5.48e-04 NA
2. P Q920D3 Mediator of RNA polymerase II transcription subunit 28 6.62e-05 3.55e-03 NA
2. P P68943 Mediator of RNA polymerase II transcription subunit 28 1.38e-04 7.67e-03 NA
2. P Q0HD55 Nuclear export protein NA 1.10e-02 NA
2. P C6Y4C2 Sporulation-specific protein 2 1.92e-07 6.14e-04 NA
2. P Q566R4 Leucine repeat adapter protein 25 1.66e-03 6.26e-04 NA
2. P A4GCL3 Nuclear export protein NA 1.36e-03 NA
2. P Q2RFA1 Nuclear export protein NA 2.44e-02 NA
2. P Q5RBZ4 Mediator of RNA polymerase II transcription subunit 29 8.34e-04 1.51e-03 NA
2. P Q2VNC8 Nuclear export protein NA 2.44e-02 NA
2. P Q9UL45 Biogenesis of lysosome-related organelles complex 1 subunit 6 1.09e-05 8.33e-07 NA
2. P Q06333 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 4.69e-06 3.93e-05 NA
2. P Q7VQX3 UPF0265 protein Bfl460 1.15e-06 5.74e-03 NA
2. P Q2VNE8 Nuclear export protein NA 2.44e-02 NA
2. P A6NF36 Coiled-coil domain-containing protein 182 6.45e-06 1.51e-02 NA
2. P Q5BK57 HAUS augmin-like complex subunit 8 5.00e-04 5.58e-03 NA
2. P F4K657 Biogenesis of lysosome-related organelles complex 1 subunit 2 2.44e-06 4.99e-02 NA
2. P Q6AYA0 RILP-like protein 2 2.99e-04 5.63e-03 NA
2. P E7NG53 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.12e-05 4.30e-05 NA
2. P Q6DP69 Nuclear export protein NA 4.09e-04 NA
2. P Q9D495 Synaptonemal complex central element protein 1 5.01e-04 1.02e-02 NA
2. P Q77ZM4 Nuclear export protein NA 7.76e-05 NA
2. P P0C7N2 Glutamate-rich protein 4 2.54e-03 2.22e-02 NA
2. P Q6CMB6 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 6.35e-06 2.04e-02 NA
2. P P48232 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 3.92e-06 3.80e-07 NA
2. P Q6DP65 Nuclear export protein NA 4.09e-04 NA
2. P O70591 Prefoldin subunit 2 1.65e-04 4.73e-02 NA
2. P O04211 Protein EARLY FLOWERING 4 4.27e-04 8.53e-04 NA
2. P Q20NC0 Nuclear export protein NA 1.50e-04 NA
2. P Q6R649 Keratin, type I cytoskeletal 27 4.29e-03 6.20e-03 NA
2. P Q08DU8 Biogenesis of lysosome-related organelles complex 1 subunit 6 4.14e-06 5.15e-06 NA
2. P Q6UDH8 Tegument protein UL14 NA 8.13e-03 NA
2. P O94483 High osmolarity sensitivity protein 3 2.73e-04 1.35e-02 NA
2. P C5DJH5 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 5.26e-06 1.45e-04 NA
2. P P0C5U1 Nuclear export protein NA 9.07e-04 NA
2. P Q14BJ1 Protein FAM89A 1.29e-03 2.88e-02 NA
2. P Q3TRJ4 Keratin, type I cytoskeletal 26 3.20e-03 3.83e-02 NA
2. P Q8N5H3 Leucine repeat adapter protein 25 1.55e-03 2.77e-02 NA
2. P Q5RKN3 Mediator of RNA polymerase II transcription subunit 28 5.60e-05 4.12e-03 NA
2. P Q9CR81 Testis-expressed protein 12 3.45e-05 1.68e-02 NA
2. P C7GMH9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.55e-05 4.30e-05 NA
2. P P03506 Nuclear export protein NA 8.53e-04 NA
2. P P36350 Nuclear export protein NA 5.42e-04 NA
2. P Q17Q97 Required for excision 1-B domain-containing protein 1.92e-04 3.90e-02 NA
2. P O76014 Keratin, type I cuticular Ha7 1.97e-04 4.86e-03 NA
2. P O57269 Nuclear export protein NA 2.21e-03 NA
2. P A6ZYV6 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 4.05e-06 4.30e-05 NA
2. P Q04266 Nuclear export protein NA 1.67e-04 NA
2. P Q92JL7 Uncharacterized protein RC0050 2.20e-02 2.23e-03 NA
2. P B3LNU5 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 3.83e-06 7.30e-07 NA
2. P A4GCM4 Nuclear export protein NA 1.79e-03 NA
2. P Q570U6 Protein ELF4-LIKE 4 2.76e-07 5.81e-08 NA
2. P P21527 Nuclear export protein NA 2.75e-03 NA
2. P Q86XT2 Vacuolar protein sorting-associated protein 37D 3.52e-04 1.19e-02 NA
2. P O73881 Bublin coiled-coil protein 3.34e-03 1.82e-02 NA
2. P Q9TSV3 Coiled-coil alpha-helical rod protein 1 (Fragment) 1.62e-04 2.77e-02 NA
2. P E7QDA1 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 2.29e-06 4.30e-05 NA
2. P Q95XD3 Biogenesis of lysosome-related organelles complex 1 subunit 2 1.26e-06 2.25e-03 NA
2. P Q94BS8 Protein ELF4-LIKE 2 2.61e-06 7.30e-07 NA
2. P Q5FVJ5 bMERB domain-containing protein 1 3.23e-04 7.09e-04 NA
2. P A4U7B1 Nuclear export protein NA 1.30e-03 NA
2. P Q9CQI9 Mediator of RNA polymerase II transcription subunit 30 2.75e-04 3.55e-03 NA
2. P Q9D9C6 Coiled-coil domain-containing protein 182 1.22e-05 1.14e-02 NA
2. P Q2RCH1 Nuclear export protein NA 2.44e-02 NA
2. P Q288Z1 Nuclear export protein NA 2.44e-02 NA
2. P Q04265 Nuclear export protein NA 1.66e-02 NA
2. P E7Q2L9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 2.24e-06 2.32e-04 NA
2. P C8ZGE4 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 3.57e-06 3.80e-07 NA
2. P O76015 Keratin, type I cuticular Ha8 3.84e-03 3.66e-02 NA
2. P Q30NP6 Nuclear export protein NA 2.44e-02 NA
2. P Q9BXU0 Testis-expressed protein 12 3.52e-05 2.50e-02 NA
3. B Q86UD0 Suppressor APC domain-containing protein 2 5.70e-03 NA 7.48e-04
3. B Q9D818 Suppressor APC domain-containing protein 2 6.69e-03 NA 0.003