Summary

Q5SXH7

Homolog: Q8BW88.
Function: Pleckstrin homology domain-containing family S member 1.

Statistics

Total GO Annotation: 40
Unique PROST Go: 18
Unique BLAST Go: 19

Total Homologs: 23
Unique PROST Homologs: 14
Unique BLAST Homologs: 6

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BW88 (Pleckstrin homology domain-containing family S member 1) with a FATCAT P-Value: 0.00106 and RMSD of 11.40 angstrom. The sequence alignment identity is 54.4%.
Structural alignment shown in left. Query protein Q5SXH7 colored as red in alignment, homolog Q8BW88 colored as blue. Query protein Q5SXH7 is also shown in right top, homolog Q8BW88 showed in right bottom. They are colored based on secondary structures. 

  Q5SXH7 MA-----G-GKQFTFSYENEVCKQDYFIKSPPSQLFSSVTSWKKRFFILSKA-GEKSFSLSYYKDHHHRGSIEIDQNSSVEVGISSQEKMQSVQKMFKCH 93
  Q8BW88 MEARPPKGPGKQFTFDYENEVHKRDYFIKSPPPQLFFSGTSWKKRLFILSQSRG-TGLSLSYYKDHQHRGSIEIDGSSTVEVGINCQEKMQSVQKMFKCH 99

  Q5SXH7 PDEVMSIRTTNREYFLIGHDREKIKDWVSFMSSFRQDIKATQQNTEEELSLGNKRTLFYSSPLLGPSSTSEAVGSSSPRNGLQDKHLMEQSSPGFRQTHL 193
  Q8BW88 PDEVMSIRTANRDYFLIGHDREKIKDWVSFMTPYCQGVKATHQRAEEKLSLGDRRPVSDPSPFLGLCSIPEGIRLASPRASLPE-HLIQKSLQRFRQAHL 198

  Q5SXH7 -QD---LSEATQDVKEENHYLTPRSV--LLELDNIIASSDSGESIETDGPDQVSG--RIECHYEPMES---SFFKETSHESVDSS--KEEPQTLPETQDG 280
  Q8BW88 HQDHDFHSEPTQDTEEE-YYLTPRSLEACLELENIAGPNDSGDSIESNSPDQ--GFKRAESNYVSMRSLRTCLLKESTSASADDNDGQAEFQT--ESELG 293

  Q5SXH7 DLHLQEQGSGIDWCLSPADVEAQTTNDQKG--------------NIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPPRLGCIFCHGDHLLA 366
  Q8BW88 PPH-QDSGTGSDPCLSPPNSKAQTTDDQKGSASLTVVKLSILLNNIPDESQVETLNVFLSPRDAIDYLALVEAAGQICVARWEGPPRLGCLFYHGDHILA 392

  Q5SXH7 VNDLKPQSLEEVSLFLTRSIQKEDSFRILSYQVAFGE--GTE-LRDRAPGFRTSDRHDVAKRACMESDWCRDSKTAPSTNLCLSFLFCKIMTNDGAGCWI 463
  Q8BW88 VNDLKPQSLEEVSLFLTRCIQKE---KV---KLSIGRIPNSEKL-HASP-CACSLRHQLAES--VQRDLPELERT-PKRSPAI-----KKSQKEAAGE-- 474

  Q5SXH7 IK 465
  Q8BW88 -- 474

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0030225 macrophage differentiation
1. PB GO:0019904 protein domain specific binding
1. PB GO:0042169 SH2 domain binding
2. P GO:0040024 dauer larval development
2. P GO:0005159 insulin-like growth factor receptor binding
2. P GO:0017124 SH3 domain binding
2. P GO:0007520 myoblast fusion
2. P GO:0005634 nucleus
2. P GO:0071888 macrophage apoptotic process
2. P GO:0036195 muscle cell projection membrane
2. P GO:0005158 insulin receptor binding
2. P GO:0008360 regulation of cell shape
2. P GO:0008286 insulin receptor signaling pathway
2. P GO:0072673 lamellipodium morphogenesis
2. P GO:0001784 phosphotyrosine residue binding
2. P GO:0048009 insulin-like growth factor receptor signaling pathway
2. P GO:1904813 ficolin-1-rich granule lumen
2. P GO:0051451 myoblast migration
2. P GO:0007165 signal transduction
2. P GO:0043548 phosphatidylinositol 3-kinase binding
2. P GO:0032587 ruffle membrane
3. B GO:0043306 positive regulation of mast cell degranulation
3. B GO:0030316 osteoclast differentiation
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:0032991 protein-containing complex
3. B GO:0045500 sevenless signaling pathway
3. B GO:0007465 R7 cell fate commitment
3. B GO:0016477 cell migration
3. B GO:0005068 transmembrane receptor protein tyrosine kinase adaptor activity
3. B GO:0019903 protein phosphatase binding
3. B GO:0048015 phosphatidylinositol-mediated signaling
3. B GO:0035556 intracellular signal transduction
3. B GO:0008293 torso signaling pathway
3. B GO:0046578 regulation of Ras protein signal transduction
3. B GO:0042461 photoreceptor cell development
3. B GO:0043325 phosphatidylinositol-3,4-bisphosphate binding
3. B GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
3. B GO:0010634 positive regulation of epithelial cell migration
3. B GO:0008595 anterior/posterior axis specification, embryo
3. B GO:0008284 positive regulation of cell population proliferation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8WWW8 GRB2-associated-binding protein 3 3.44e-01 3.99e-02 0.004
1. PB Q8BW88 Pleckstrin homology domain-containing family S member 1 1.06e-03 2.55e-50 1.08e-161
1. PB Q5SXH7 Pleckstrin homology domain-containing family S member 1 0 2.96e-146 0.0
2. P P78314 SH3 domain-binding protein 2 1.10e-01 2.45e-06 NA
2. P Q53GL0 Pleckstrin homology domain-containing family O member 1 2.58e-02 1.25e-04 NA
2. P Q5F3C8 Pleckstrin homology domain-containing family O member 1 4.58e-02 4.33e-05 NA
2. P Q8TD55 Pleckstrin homology domain-containing family O member 2 3.95e-02 5.10e-05 NA
2. P G5EDJ4 Multisubstrate adapter protein soc-1 1.13e-01 6.41e-03 NA
2. P A4IFK0 Pleckstrin homology domain-containing family O member 1 2.09e-02 1.36e-06 NA
2. P Q06649 SH3 domain-binding protein 2 1.22e-01 1.40e-06 NA
2. P Q6P4Y6 Insulin receptor substrate 1 7.90e-02 4.26e-04 NA
2. P Q32LQ1 Pleckstrin homology domain-containing family O member 2 1.27e-01 1.07e-06 NA
2. P Q8K124 Pleckstrin homology domain-containing family O member 2 2.23e-01 9.18e-04 NA
2. P Q5DU31 Interactor protein for cytohesin exchange factors 1 2.97e-02 7.55e-04 NA
2. P Q9JIY0 Pleckstrin homology domain-containing family O member 1 9.06e-02 1.61e-04 NA
2. P Q80VL0 Interactor protein for cytohesin exchange factors 1 4.06e-02 1.68e-05 NA
2. P Q5BJM5 Pleckstrin homology domain-containing family O member 1 5.75e-01 1.39e-04 NA
3. B Q2WGN9 GRB2-associated-binding protein 4 2.23e-01 NA 0.002
3. B Q9VZZ9 Protein daughter of sevenless 2.10e-01 NA 1.57e-06
3. B Q9UQC2 GRB2-associated-binding protein 2 2.53e-01 NA 0.003
3. B Q9Z1S8 GRB2-associated-binding protein 2 1.84e-01 NA 0.007
3. B Q8BSM5 GRB2-associated-binding protein 3 1.40e-02 NA 0.005
3. B Q9EQH1 GRB2-associated-binding protein 2 4.24e-02 NA 0.009