Summary

Q5SZB4

Homolog: Q8IWP9.
Function: Coiled-coil domain-containing protein 28A.

Statistics

Total GO Annotation: 58
Unique PROST Go: 58
Unique BLAST Go: 0

Total Homologs: 19
Unique PROST Homologs: 18
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q8IWP9 (Coiled-coil domain-containing protein 28A) with a FATCAT P-Value: 0.0453 and RMSD of 2.86 angstrom. The sequence alignment identity is 20.6%.
Structural alignment shown in left. Query protein Q5SZB4 colored as red in alignment, homolog Q8IWP9 colored as blue. Query protein Q5SZB4 is also shown in right top, homolog Q8IWP9 showed in right bottom. They are colored based on secondary structures. 

  Q5SZB4 MFWRRLRPGAQDLAPKGLPGDGDFRRSSDPRLPKLTPPALRAALGAR-GSGDWRIPGGGAAWWPEGDAKPGVGVGRLPPRLPALLTATRR--AVRKRGLL 97
  Q8IWP9 -------------------------------MPRAEP---RATLGEQEKAG---LPLG--AW-------------RL-----YLLRHFRKQTELRRSG-S 42

  Q5SZB4 RSLLPPPLLSAGASRESAPRQPGPGERERPRRRVAREDPDFLGAFLGELLPSRFREFLHQLQEKCAEEPEPL-TSPAPQHQRGVLEHCPGSPRCPNCSFL 196
  Q8IWP9 RDVTGALLVAAAVASEAV----G-------SLRVAEGGPNTL------LL-----QVLRS-WPWCNKE---LKT----MEERKVKRR---SPK----SF- 104

  Q5SZB4 PDLWGQSSHLQDSLTK-ISLQQTPILGPL-K--G---DHSQFTTVRKANHRPHGAQVPRL-KAALTHNP-SGEGSRPCRQRCPFRVRF-ADETLQDTTLR 286
  Q8IWP9 ------SAH----CTQVVNAKKNAI--PVSKSTGFSNPASQSTS-----QRP---KLKRVMKEK-T-KPQGGEGKGA--QSTPIQHSFLTD--VSD--VQ 176

  Q5SZB4 YWERRRSVQQSVIVN--QKAALPVASERVFG---SV-------G--KRLESLPKALY------PGAKEETLASSSCWDCAGLSTQKTQGYLSEDT-SMNS 365
  Q8IWP9 --EMERGLLS--LLNDFHSGKL-----QAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKT-ASDSNLD--RL--------LS-DLEELNS 255

  Q5SZB4 SLPFCSWKK---AAAQ-RPRSSLRAFLDPHRNLEQESLLPNRVLQSVLKQGCPKGYHLLLASATLQPDKR 431
  Q8IWP9 SI-----QKLHLADAQDVPNTSAS---------------------------------------------- 274

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1904251 regulation of bile acid metabolic process
2. P GO:0003682 chromatin binding
2. P GO:0019904 protein domain specific binding
2. P GO:0030177 positive regulation of Wnt signaling pathway
2. P GO:0045606 positive regulation of epidermal cell differentiation
2. P GO:0035197 siRNA binding
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0030054 cell junction
2. P GO:0070584 mitochondrion morphogenesis
2. P GO:0061436 establishment of skin barrier
2. P GO:0035563 positive regulation of chromatin binding
2. P GO:0003334 keratinocyte development
2. P GO:1990001 inhibition of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0008327 methyl-CpG binding
2. P GO:0009880 embryonic pattern specification
2. P GO:0007507 heart development
2. P GO:0010839 negative regulation of keratinocyte proliferation
2. P GO:0016331 morphogenesis of embryonic epithelium
2. P GO:0048568 embryonic organ development
2. P GO:0031062 positive regulation of histone methylation
2. P GO:0007286 spermatid development
2. P GO:0003729 mRNA binding
2. P GO:0097546 ciliary base
2. P GO:0031252 cell leading edge
2. P GO:0015939 pantothenate metabolic process
2. P GO:0003696 satellite DNA binding
2. P GO:0042711 maternal behavior
2. P GO:0008047 enzyme activator activity
2. P GO:0010482 regulation of epidermal cell division
2. P GO:0000792 heterochromatin
2. P GO:0048589 developmental growth
2. P GO:0060887 limb epidermis development
2. P GO:0005634 nucleus
2. P GO:0090207 regulation of triglyceride metabolic process
2. P GO:0051881 regulation of mitochondrial membrane potential
2. P GO:0043044
2. P GO:0019217 regulation of fatty acid metabolic process
2. P GO:0032355 response to estradiol
2. P GO:0016310 phosphorylation
2. P GO:0036064 ciliary basal body
2. P GO:0006346 DNA methylation-dependent heterochromatin assembly
2. P GO:0000118 histone deacetylase complex
2. P GO:0042127 regulation of cell population proliferation
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:2000647 negative regulation of stem cell proliferation
2. P GO:0071407 cellular response to organic cyclic compound
2. P GO:0007568 aging
2. P GO:0044030 regulation of DNA methylation
2. P GO:2001236 regulation of extrinsic apoptotic signaling pathway
2. P GO:0071168 protein localization to chromatin
2. P GO:0034401 obsolete chromatin organization involved in regulation of transcription
2. P GO:0031667 response to nutrient levels
2. P GO:0070742 C2H2 zinc finger domain binding
2. P GO:0060037 pharyngeal system development
2. P GO:0034622
2. P GO:0000785 chromatin
2. P GO:0005938 cell cortex
2. P GO:0009612 response to mechanical stimulus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5SZB4 Uncharacterized protein C9orf50 0 2.22e-161 0.0
2. P Q9UBB5 Methyl-CpG-binding domain protein 2 2.01e-01 1.56e-02 NA
2. P Q6AY88 Keratinocyte differentiation factor 1 8.53e-02 2.28e-02 NA
2. P Q9HB09 Bcl-2-like protein 12 1.44e-01 1.07e-04 NA
2. P F1MQW7 Uncharacterized protein C11orf97 homolog 2.86e-01 3.20e-03 NA
2. P Q9DAE7 Uncharacterized protein C11orf97 homolog 4.05e-01 4.07e-07 NA
2. P Q63647 Proline-rich nuclear receptor coactivator 1 2.58e-01 2.02e-04 NA
2. P A8E4N3 Radial spoke head protein 3 homolog 1.75e-01 1.80e-02 NA
2. P Q6ZV65 Protein FAM47E 1.36e-01 1.68e-03 NA
2. P Q9BQY9 Dysbindin domain-containing protein 2 3.64e-01 2.26e-02 NA
2. P Q9BZ23 Pantothenate kinase 2, mitochondrial 7.21e-01 5.38e-03 NA
2. P Q8IVV7 Glucose-induced degradation protein 4 homolog 5.64e-01 9.28e-04 NA
2. P A2A9F4 Keratinocyte differentiation factor 1 2.72e-01 2.36e-03 NA
2. P Q924S9 Protein ripply3 6.74e-01 3.45e-02 NA
2. P D3ZAQ5 Uncharacterized protein C16orf86 homolog 2.66e-01 3.35e-02 NA
2. P Q96LR7 Uncharacterized protein C2orf50 3.71e-01 3.74e-03 NA
2. P Q8IWP9 Coiled-coil domain-containing protein 28A 4.53e-02 1.84e-02 NA
2. P Q8IWD4 Coiled-coil domain-containing protein 117 8.46e-02 3.38e-02 NA
2. P Q9Z2E1 Methyl-CpG-binding domain protein 2 1.68e-01 4.46e-03 NA