Summary

Q5T089

Homolog: Q641X6.
Function: MORN repeat-containing protein 1.

Statistics

Total GO Annotation: 136
Unique PROST Go: 14
Unique BLAST Go: 74

Total Homologs: 68
Unique PROST Homologs: 4
Unique BLAST Homologs: 38

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q641X6 (MORN repeat-containing protein 1) with a FATCAT P-Value: 2.01e-12 and RMSD of 3.40 angstrom. The sequence alignment identity is 64.8%.
Structural alignment shown in left. Query protein Q5T089 colored as red in alignment, homolog Q641X6 colored as blue. Query protein Q5T089 is also shown in right top, homolog Q641X6 showed in right bottom. They are colored based on secondary structures. 

  Q5T089 MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGV 100
  Q641X6 MAAAEDQNPASLQPLRHSPRLRPRNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVNGEITGEGYQHWAWSGNTYSGQFVLGEPQGHGI 100

  Q5T089 MEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGVT 200
  Q641X6 MKYKAGGHYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMVFKNGDKYEGDWVRDQRQGHGVLFCADGSTYKGQWHNDVFSGLGSLVHCSGVT 200

  Q5T089 YYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRD-NQETLIQTPFGFECIPYPV 299
  Q641X6 YCGMFINGHPAAQAKKIVVLGPELLEVVQGSPFTLSVQLQQDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMD-DAHMETPIQTPFGFQCIPYPL 299

  Q5T089 S-SPAAGV-PGPRAAKGGAEADVPLPRGDLE--LHLGALHGQEDTPGGLLARGHAPHCPGACQRVEQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGR 395
  Q641X6 SVSTSWGLEPGSTVE--SARADLLLSKKDSEPVLDSEAFHGKGDTLSILPARRHEPCCSAAYQRVDQGCAEFVDIHLGAPPPGMQPYLFLPSMLEKAGNR 397

  Q5T089 SRGGLHPRG--TPP----TAQEP-PGGSRPEGRATEEQAAAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRVVAKRAG--QPPHVLEEGPEASSSWQAA 486
  Q641X6 ------PKGDRSPPEVLSTAQEPLRGTNRSDG-TTAEPSTAAYLGEYVLMVCDVTSPPFLGHRLPTTFKHLRILAR--GDIHLPHVPEDHPEALS----- 483

  Q5T089 HSCTPEPPAPR 497
  Q641X6 ----------- 483

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
1. PB GO:0048767 root hair elongation
1. PB GO:0035082 axoneme assembly
1. PB GO:0055024 regulation of cardiac muscle tissue development
1. PB GO:0043198 dendritic shaft
1. PB GO:0007612 learning
1. PB GO:0000122 negative regulation of transcription by RNA polymerase II
1. PB GO:0001786 phosphatidylserine binding
1. PB GO:0070273 phosphatidylinositol-4-phosphate binding
1. PB GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
1. PB GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity
1. PB GO:0055074 calcium ion homeostasis
1. PB GO:0072687 meiotic spindle
1. PB GO:0000794 condensed nuclear chromosome
1. PB GO:0007204 positive regulation of cytosolic calcium ion concentration
1. PB GO:0008307 structural constituent of muscle
1. PB GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
1. PB GO:0007286 spermatid development
1. PB GO:0005790 smooth endoplasmic reticulum
1. PB GO:2000114 regulation of establishment of cell polarity
1. PB GO:0070300 phosphatidic acid binding
1. PB GO:0031514 motile cilium
1. PB GO:0030314 junctional membrane complex
1. PB GO:0048167 regulation of synaptic plasticity
1. PB GO:0033017 sarcoplasmic reticulum membrane
1. PB GO:0051321 meiotic cell cycle
1. PB GO:0001520 outer dense fiber
1. PB GO:0060402 calcium ion transport into cytosol
1. PB GO:0007517 muscle organ development
1. PB GO:2001256 regulation of store-operated calcium entry
1. PB GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
1. PB GO:0010314 phosphatidylinositol-5-phosphate binding
1. PB GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
1. PB GO:0040011 locomotion
1. PB GO:0005789 endoplasmic reticulum membrane
1. PB GO:0014701 junctional sarcoplasmic reticulum membrane
1. PB GO:0030018 Z disc
1. PB GO:0016529 sarcoplasmic reticulum
1. PB GO:0001046 core promoter sequence-specific DNA binding
1. PB GO:0001817 regulation of cytokine production
1. PB GO:0032266 phosphatidylinositol-3-phosphate binding
1. PB GO:0048168 regulation of neuronal synaptic plasticity
1. PB GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity
1. PB GO:0048766 root hair initiation
1. PB GO:0007613 memory
1. PB GO:0035640 exploration behavior
1. PB GO:0050885 neuromuscular process controlling balance
1. PB GO:0048768 root hair cell tip growth
2. P GO:0036126 sperm flagellum
2. P GO:0072327 vulval cell fate specification
2. P GO:0060298 positive regulation of sarcomere organization
2. P GO:0005886 plasma membrane
2. P GO:0055120 striated muscle dense body
2. P GO:0031430 M band
2. P GO:0040017 positive regulation of locomotion
2. P GO:0046716 muscle cell cellular homeostasis
2. P GO:0008305 integrin complex
2. P GO:1903354 regulation of distal tip cell migration
2. P GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0040028 regulation of vulval development
2. P GO:1901076 positive regulation of engulfment of apoptotic cell
3. B GO:0018026 peptidyl-lysine monomethylation
3. B GO:0045860 positive regulation of protein kinase activity
3. B GO:0005096 GTPase activator activity
3. B GO:0032426 stereocilium tip
3. B GO:0051260 protein homooligomerization
3. B GO:0051570 regulation of histone H3-K9 methylation
3. B GO:0001662 behavioral fear response
3. B GO:0030154 cell differentiation
3. B GO:0048678 response to axon injury
3. B GO:0016324 apical plasma membrane
3. B GO:0032483 regulation of Rab protein signal transduction
3. B GO:0033583 rhabdomere membrane
3. B GO:0018022 peptidyl-lysine methylation
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0005769 early endosome
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0032433 filopodium tip
3. B GO:0005085 guanyl-nucleotide exchange factor activity
3. B GO:0043197 dendritic spine
3. B GO:0043087 regulation of GTPase activity
3. B GO:0006479 protein methylation
3. B GO:0035011 melanotic encapsulation of foreign target
3. B GO:0035249 synaptic transmission, glutamatergic
3. B GO:0007283 spermatogenesis
3. B GO:0003006 developmental process involved in reproduction
3. B GO:0070828 heterochromatin organization
3. B GO:0007626 locomotory behavior
3. B GO:0043025 neuronal cell body
3. B GO:0031267 small GTPase binding
3. B GO:0007041 lysosomal transport
3. B GO:0001701 in utero embryonic development
3. B GO:0007409 axonogenesis
3. B GO:0009958 positive gravitropism
3. B GO:0016197 endosomal transport
3. B GO:0030027 lamellipodium
3. B GO:0010020 chloroplast fission
3. B GO:0009827 plant-type cell wall modification
3. B GO:0016601 Rac protein signal transduction
3. B GO:0043539 protein serine/threonine kinase activator activity
3. B GO:0045471 response to ethanol
3. B GO:0010311 lateral root formation
3. B GO:0005813 centrosome
3. B GO:0090406 pollen tube
3. B GO:0032991 protein-containing complex
3. B GO:0010118 stomatal movement
3. B GO:0035452 extrinsic component of plastid membrane
3. B GO:0030426 growth cone
3. B GO:0008104 protein localization
3. B GO:0035022 positive regulation of Rac protein signal transduction
3. B GO:0016028 rhabdomere
3. B GO:0005694 chromosome
3. B GO:0009860 pollen tube growth
3. B GO:0030425 dendrite
3. B GO:0014069 postsynaptic density
3. B GO:0018024 histone-lysine N-methyltransferase activity
3. B GO:0007528 neuromuscular junction development
3. B GO:0001669 acrosomal vesicle
3. B GO:0002039 p53 binding
3. B GO:1901555 response to paclitaxel
3. B GO:0016307 phosphatidylinositol phosphate kinase activity
3. B GO:0051036 regulation of endosome size
3. B GO:0006979 response to oxidative stress
3. B GO:0009707 chloroplast outer membrane
3. B GO:0007032 endosome organization
3. B GO:0009846 pollen germination
3. B GO:0007164 establishment of tissue polarity
3. B GO:0031982 vesicle
3. B GO:0016050 vesicle organization
3. B GO:0001881 receptor recycling
3. B GO:0008219 cell death
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0001726 ruffle
3. B GO:0046488 phosphatidylinositol metabolic process
3. B GO:0043547 positive regulation of GTPase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C881 Radial spoke head 10 homolog B 8.09e-03 8.40e-08 1.21e-17
1. PB Q9ET78 Junctophilin-2 5.99e-03 1.35e-04 1.53e-06
1. PB Q9SUI2 Phosphatidylinositol 4-phosphate 5-kinase 7 2.01e-04 3.01e-03 1.02e-16
1. PB Q5T089 MORN repeat-containing protein 1 0 5.86e-153 0.0
1. PB Q8RY89 Phosphatidylinositol 4-phosphate 5-kinase 8 2.15e-04 2.87e-02 4.07e-18
1. PB Q96JJ6 Junctophilin-4 4.98e-03 1.34e-02 8.67e-05
1. PB Q9BR39 Junctophilin-2 5.96e-04 5.58e-04 1.43e-06
1. PB Q69FB3 Junctophilin-4 6.26e-03 1.69e-02 9.72e-05
1. PB Q9ET77 Junctophilin-3 5.35e-02 3.46e-06 1.15e-07
1. PB Q641X6 MORN repeat-containing protein 1 2.01e-12 5.66e-74 0.0
1. PB B2RC85 Radial spoke head 10 homolog B2 3.66e-03 4.60e-08 1.09e-17
1. PB Q9HDC5 Junctophilin-1 2.67e-03 6.61e-04 5.22e-06
1. PB Q9GKY7 Junctophilin-2 3.85e-02 1.75e-04 9.02e-07
1. PB E9PYQ0 Radial spoke head 10 homolog B 1.87e-04 5.23e-06 2.73e-18
1. PB Q80WT0 Junctophilin-4 3.96e-02 1.55e-02 1.12e-04
1. PB O48709 Phosphatidylinositol 4-phosphate 5-kinase 3 2.01e-03 3.92e-02 1.93e-20
1. PB Q8WXH2 Junctophilin-3 6.40e-02 3.04e-07 7.74e-08
1. PB Q9GKY8 Junctophilin-1 6.49e-03 9.73e-04 3.86e-06
1. PB Q08CH7 Radial spoke head 10 homolog B 8.34e-08 2.99e-10 3.67e-19
1. PB Q66HB5 Radial spoke head 10 homolog B 1.06e-03 8.98e-07 8.33e-18
1. PB Q9ET80 Junctophilin-1 3.77e-02 1.81e-03 5.54e-06
1. PB Q8VIG3 Radial spoke head 1 homolog 1.77e-05 4.32e-03 1.30e-14
1. PB Q8WYR4 Radial spoke head 1 homolog 4.03e-06 2.57e-06 3.16e-15
1. PB Q8L850 Phosphatidylinositol 4-phosphate 5-kinase 9 1.07e-03 2.77e-03 3.41e-15
1. PB Q1JPG1 Radial spoke head 10 homolog B 3.35e-02 4.45e-05 5.00e-19
1. PB Q2PS20 Junctophilin-2 2.70e-02 1.39e-04 1.33e-06
2. P A8X3A7 Integrin alpha pat-2 7.87e-01 1.36e-02 NA
2. P Q32LL6 MORN repeat-containing protein 5 7.00e-02 2.92e-03 NA
2. P Q28FE4 MORN repeat-containing protein 5 1.26e-01 5.15e-05 NA
2. P Q4VBJ9 MORN repeat-containing protein 5 4.86e-02 1.23e-02 NA
3. B Q8VHL1 Histone-lysine N-methyltransferase SETD7 8.57e-04 NA 2.65e-06
3. B A6QP75 ALS2 C-terminal-like protein 2.01e-04 NA 7.42e-14
3. B Q6EX42 Phosphatidylinositol 4-phosphate 5-kinase 1 2.86e-03 NA 4.77e-16
3. B Q60I26 ALS2 C-terminal-like protein 2.98e-04 NA 1.12e-11
3. B Q60I27 ALS2 C-terminal-like protein 3.28e-04 NA 9.61e-13
3. B Q4QQN5 Histone-lysine N-methyltransferase SETD7 9.38e-04 NA 1.21e-05
3. B Q502X0 MORN repeat-containing protein 2 6.56e-05 NA 2.83e-05
3. B P0C5Y8 Alsin 1.15e-02 NA 3.95e-12
3. B Q56YP2 Phosphatidylinositol 4-phosphate 5-kinase 1 3.96e-03 NA 2.99e-21
3. B Q5R578 MORN repeat-containing protein 4 3.50e-10 NA 3.70e-10
3. B Q9VNZ8 Alsin homolog 1.82e-02 NA 9.27e-09
3. B Q8L796 Phosphatidylinositol 4-phosphate 5-kinase 2 6.00e-03 NA 1.63e-19
3. B Q5PPV3 MORN repeat-containing protein 3 6.24e-07 NA 2.08e-12
3. B Q8C5T4 MORN repeat-containing protein 3 2.52e-07 NA 1.66e-15
3. B Q27YU0 Flagellar radial spoke protein 1 3.10e-03 NA 2.21e-10
3. B Q6UL01 MORN repeat-containing protein 2 2.66e-05 NA 5.30e-04
3. B Q0VD26 MORN repeat-containing protein 4 4.15e-10 NA 2.61e-10
3. B Q8WTS6 Histone-lysine N-methyltransferase SETD7 8.38e-04 NA 1.91e-06
3. B Q5BIW4 Alsin 3.60e-03 NA 5.84e-12
3. B Q9SLG9 Phosphatidylinositol 4-phosphate 5-kinase 5 1.00e-03 NA 4.89e-20
3. B Q6PF18 MORN repeat-containing protein 3 2.13e-07 NA 1.15e-14
3. B Q96Q42 Alsin 1.28e-02 NA 5.13e-12
3. B Q6DHG0 Histone-lysine N-methyltransferase SETD7 1.02e-03 NA 4.15e-04
3. B Q6VTH5 Radial spoke head 1 homolog 7.26e-05 NA 9.85e-15
3. B Q920R0 Alsin 1.74e-02 NA 7.19e-12
3. B Q6PGF2 MORN repeat-containing protein 4 2.10e-10 NA 2.79e-10
3. B Q6F6B5 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3 6.74e-03 NA 5.00e-08
3. B Q5BJS9 MORN repeat-containing protein 4 3.40e-10 NA 1.69e-10
3. B Q8NDC4 MORN repeat-containing protein 4 3.76e-10 NA 3.70e-10
3. B Q9M1K2 Phosphatidylinositol 4-phosphate 5-kinase 4 1.20e-03 NA 5.83e-20
3. B Q4R842 MORN repeat-containing protein 3 2.22e-07 NA 2.31e-15
3. B Q9VN91 MORN repeat-containing protein 4 homolog 9.35e-06 NA 2.86e-07
3. B Q8C0W1 Ankyrin repeat and MYND domain-containing protein 1 4.74e-01 NA 0.006
3. B Q9P2S6 Ankyrin repeat and MYND domain-containing protein 1 3.45e-01 NA 4.85e-05
3. B Q9SFB8 Phosphatidylinositol 4-phosphate 5-kinase 6 8.61e-04 NA 3.43e-22
3. B Q32KU3 MORN repeat-containing protein 2 1.97e-05 NA 6.58e-05
3. B Q7Z0G7 Histone-lysine N-methyltransferase SETD7 8.66e-04 NA 0.002
3. B Q32KM6 MORN repeat-containing protein 3 1.44e-07 NA 6.98e-14