Summary

Q5T0U0

Homolog: Q8BVN0.
Function: Coiled-coil domain-containing protein 122.

Statistics

Total GO Annotation: 165
Unique PROST Go: 165
Unique BLAST Go: 0

Total Homologs: 202
Unique PROST Homologs: 200
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BVN0 (Coiled-coil domain-containing protein 122) with a FATCAT P-Value: 0.0 and RMSD of 3.09 angstrom. The sequence alignment identity is 65.6%.
Structural alignment shown in left. Query protein Q5T0U0 colored as red in alignment, homolog Q8BVN0 colored as blue. Query protein Q5T0U0 is also shown in right top, homolog Q8BVN0 showed in right bottom. They are colored based on secondary structures. 

  Q5T0U0 MSDNKERKSQGFP-KEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKNELHELEKEIAAISAETKETERQIYQQDSAIENTKLHCDSLETQIKS 99
  Q8BVN0 MSGDTERKNEVIPTKAAVKDTSALTDAVEQVAKQQQSQTSEIEKHKKILFQLQIELHELEKQIATIAEEAKETDRQMHRQDAAMENSKLQCGRLEAQIES 100

  Q5T0U0 LHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHKNSLGEVESKWSFMTELHEKRDFVKKLKTMKEELMQDLQNPGGNRIT-QVQEDITNLKDKIITV 198
  Q8BVN0 LYSESLKLKFDTETAQEKFEEQMIKYNAYYVKIKAYKDNLGEIKSQCPFMTELYEKRDLIKNLKTMKEDLMENLQDSQGN-CTIQIQEDISEIKNKIMTV 199

  Q5T0U0 KESIIEKTCFLEEEKKTHEKLRKEIEVQHKRYDAILKRLHCQVNKLQSNRRQWQWNIQQLEKTAAELRKCIGMQE---------------- 273
  Q8BVN0 KESITEKTSFVEEEKKTHEKLRKEIEVQHKRYDAILKRLHCQMNKIQLNRRKWQWNIQQLEKTAAELKKRIREKEASEIQSRPAAPWERIL 290

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0045616 regulation of keratinocyte differentiation
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0005874 microtubule
2. P GO:0000346 transcription export complex
2. P GO:0045111 intermediate filament cytoskeleton
2. P GO:1901588 dendritic microtubule
2. P GO:0006937 regulation of muscle contraction
2. P GO:0045095 keratin filament
2. P GO:0048156 tau protein binding
2. P GO:1901800 positive regulation of proteasomal protein catabolic process
2. P GO:0006406 mRNA export from nucleus
2. P GO:0045109 intermediate filament organization
2. P GO:0034451 centriolar satellite
2. P GO:0090404 pollen tube tip
2. P GO:0034361 very-low-density lipoprotein particle
2. P GO:0071957 old mitotic spindle pole body
2. P GO:0032091 negative regulation of protein binding
2. P GO:0007017 microtubule-based process
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0007021 tubulin complex assembly
2. P GO:0016272 prefoldin complex
2. P GO:0007052 mitotic spindle organization
2. P GO:0010954 positive regulation of protein processing
2. P GO:0042975 peroxisome proliferator activated receptor binding
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0005844 polysome
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0006397 mRNA processing
2. P GO:0005815 microtubule organizing center
2. P GO:0051301 cell division
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0005884 actin filament
2. P GO:0000818 nuclear MIS12/MIND complex
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0050708 regulation of protein secretion
2. P GO:0003341 cilium movement
2. P GO:0048066 developmental pigmentation
2. P GO:0030863 cortical cytoskeleton
2. P GO:0019901 protein kinase binding
2. P GO:0010073 meristem maintenance
2. P GO:0034364 high-density lipoprotein particle
2. P GO:0042157 lipoprotein metabolic process
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0050942 positive regulation of pigment cell differentiation
2. P GO:0031069 hair follicle morphogenesis
2. P GO:0070840 dynein complex binding
2. P GO:0005198 structural molecule activity
2. P GO:0061303 cornea development in camera-type eye
2. P GO:0006936 muscle contraction
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0031072 heat shock protein binding
2. P GO:0030030 cell projection organization
2. P GO:0036159 inner dynein arm assembly
2. P GO:0051300 spindle pole body organization
2. P GO:0005694 chromosome
2. P GO:0006914 autophagy
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0035646 endosome to melanosome transport
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0060298 positive regulation of sarcomere organization
2. P GO:0051255 spindle midzone assembly
2. P GO:0044183 protein folding chaperone
2. P GO:1904669 ATP export
2. P GO:0007568 aging
2. P GO:0000801 central element
2. P GO:0005635 nuclear envelope
2. P GO:0097545 axonemal outer doublet
2. P GO:0051225 spindle assembly
2. P GO:0036126 sperm flagellum
2. P GO:0002081 outer acrosomal membrane
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0007015 actin filament organization
2. P GO:0005824 outer plaque of spindle pole body
2. P GO:0051087 chaperone binding
2. P GO:0034501 protein localization to kinetochore
2. P GO:0005654 nucleoplasm
2. P GO:0015629 actin cytoskeleton
2. P GO:1990450 linear polyubiquitin binding
2. P GO:0002080 acrosomal membrane
2. P GO:1903394 protein localization to kinetochore involved in kinetochore assembly
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0042633 hair cycle
2. P GO:0051383 kinetochore organization
2. P GO:0000813 ESCRT I complex
2. P GO:0000774 adenyl-nucleotide exchange factor activity
2. P GO:0072686 mitotic spindle
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0043515 kinetochore binding
2. P GO:0000707 meiotic DNA recombinase assembly
2. P GO:0043621 protein self-association
2. P GO:0035630 bone mineralization involved in bone maturation
2. P GO:0044325 transmembrane transporter binding
2. P GO:0008385 IkappaB kinase complex
2. P GO:0030496 midbody
2. P GO:0019538 protein metabolic process
2. P GO:0061509 asymmetric protein localization to old mitotic spindle pole body
2. P GO:0005634 nucleus
2. P GO:0010496 intercellular transport
2. P GO:0036064 ciliary basal body
2. P GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0051382 kinetochore assembly
2. P GO:0005930 axoneme
2. P GO:0000445 THO complex part of transcription export complex
2. P GO:0055120 striated muscle dense body
2. P GO:0007010 cytoskeleton organization
2. P GO:0097225 sperm midpiece
2. P GO:0003146 heart jogging
2. P GO:0061499 outer plaque of mitotic spindle pole body
2. P GO:0031030 negative regulation of septation initiation signaling
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0044732 mitotic spindle pole body
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0060294 cilium movement involved in cell motility
2. P GO:0055039 trichocyst
2. P GO:0042803 protein homodimerization activity
2. P GO:0000347 THO complex
2. P GO:0034045 phagophore assembly site membrane
2. P GO:0051015 actin filament binding
2. P GO:0046784 viral mRNA export from host cell nucleus
2. P GO:0030154 cell differentiation
2. P GO:0098536 deuterosome
2. P GO:0005814 centriole
2. P GO:0050862 positive regulation of T cell receptor signaling pathway
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0009908 flower development
2. P GO:0051455 monopolar spindle attachment to meiosis I kinetochore
2. P GO:1904667 negative regulation of ubiquitin protein ligase activity
2. P GO:0003143 embryonic heart tube morphogenesis
2. P GO:0051650 establishment of vesicle localization
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0001725 stress fiber
2. P GO:0043276 anoikis
2. P GO:0007286 spermatid development
2. P GO:0000444 MIS12/MIND type complex
2. P GO:0060271 cilium assembly
2. P GO:0008380 RNA splicing
2. P GO:1990459 transferrin receptor binding
2. P GO:0030317 flagellated sperm motility
2. P GO:0031514 motile cilium
2. P GO:0042627 chylomicron
2. P GO:0032991 protein-containing complex
2. P GO:2000012 regulation of auxin polar transport
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0005637 nuclear inner membrane
2. P GO:0005829 cytosol
2. P GO:0000795 synaptonemal complex
2. P GO:0070652 HAUS complex
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0016607 nuclear speck
2. P GO:0005882 intermediate filament
2. P GO:0031617 NMS complex
2. P GO:0002102 podosome
2. P GO:0002693 positive regulation of cellular extravasation
2. P GO:0015631 tubulin binding
2. P GO:0000776 kinetochore
2. P GO:0051233 spindle midzone
2. P GO:0090443 FAR/SIN/STRIPAK complex
2. P GO:0042802 identical protein binding
2. P GO:0032474 otolith morphogenesis
2. P GO:0060378 regulation of brood size
2. P GO:0030017 sarcomere
2. P GO:0046982 protein heterodimerization activity
2. P GO:0101031 chaperone complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5T0U0 Coiled-coil domain-containing protein 122 0 3.80e-156 0.0
1. PB Q8BVN0 Coiled-coil domain-containing protein 122 0.00e+00 3.21e-56 3.41e-131
2. P A6NI56 Coiled-coil domain-containing protein 154 2.67e-07 1.89e-02 NA
2. P Q3KPU6 Coiled-coil domain-containing protein 172 1.04e-11 5.57e-05 NA
2. P P54214 SF-assemblin 1.19e-11 3.83e-02 NA
2. P Q49407 Uncharacterized protein MG269 8.37e-11 2.96e-02 NA
2. P Q9FH51 Protein FLX-like 4 5.77e-10 3.35e-02 NA
2. P Q5XHZ2 Synaptonemal complex central element protein 1 2.51e-10 1.42e-07 NA
2. P A8KB59 Coiled-coil domain-containing protein 153 4.30e-07 7.29e-03 NA
2. P Q9FWW5 WEB family protein At1g12150 3.14e-09 1.10e-02 NA
2. P D3Z5T1 Coiled-coil domain-containing protein 78 6.43e-08 4.39e-03 NA
2. P Q2T9Q6 Tektin-2 4.52e-09 1.93e-02 NA
2. P Q9Y6K9 NF-kappa-B essential modulator 1.50e-10 2.46e-02 NA
2. P Q3Y8M6 Tropomyosin Pen a 1.0102 3.62e-13 4.60e-02 NA
2. P A1KYZ2 Tropomyosin 1.42e-13 4.60e-02 NA
2. P Q27182 Trichocyst matrix protein T4-A 9.38e-13 7.63e-06 NA
2. P Q28706 Keratin, type I cytoskeletal 12 (Fragment) 7.46e-08 5.76e-04 NA
2. P Q27180 Trichocyst matrix protein T1-B 1.91e-08 6.63e-04 NA
2. P A9QT41 NF-kappa-B essential modulator 5.10e-11 5.49e-03 NA
2. P Q6DFL0 Coiled-coil domain-containing protein 102A 1.95e-08 1.62e-02 NA
2. P P39921 Tropomyosin-1 3.82e-14 1.12e-05 NA
2. P Q7SZ78 THO complex subunit 7 homolog 2.72e-09 2.31e-03 NA
2. P Q5D525 Synaptonemal complex central element protein 1-like 1.47e-09 4.78e-02 NA
2. P Q6IFX0 Keratin, type I cytoskeletal 25 5.45e-08 4.87e-02 NA
2. P A6NI79 Coiled-coil domain-containing protein 69 7.63e-10 4.96e-02 NA
2. P Q9NSB4 Keratin, type II cuticular Hb2 6.04e-09 3.20e-02 NA
2. P Q9BX97 Plasmalemma vesicle-associated protein 5.72e-10 4.64e-02 NA
2. P Q6DCD4 Coiled-coil domain-containing protein 69-A 9.92e-10 5.60e-03 NA
2. P I1RFS8 Autophagy-related protein 16 7.68e-08 8.49e-04 NA
2. P Q9LK53 WEB family protein At3g13190 5.27e-11 7.24e-05 NA
2. P Q4R5V1 Tektin-2 2.86e-09 4.90e-04 NA
2. P P42636 Tropomyosin-1 4.96e-13 4.06e-02 NA
2. P Q2YDH9 Coiled-coil domain-containing protein 172 1.07e-10 3.85e-04 NA
2. P A0C767 Trichocyst matrix protein T4-B 7.42e-13 8.49e-06 NA
2. P P02561 Tropomyosin alpha-4 chain 7.10e-13 1.17e-02 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 5.25e-09 8.70e-06 NA
2. P Q8LE98 Interactor of constitutive active ROPs 1 1.15e-06 9.46e-03 NA
2. P P34665 Uncharacterized protein ZK652.8 4.64e-07 2.90e-04 NA
2. P Q9UIF3 Tektin-2 6.77e-09 3.29e-03 NA
2. P Q6DGZ3 THO complex subunit 7 homolog 1.28e-09 1.63e-02 NA
2. P O88522 NF-kappa-B essential modulator 5.63e-12 4.18e-02 NA
2. P Q6C452 Spindle assembly checkpoint component MAD1 4.46e-07 5.22e-03 NA
2. P Q6AXT4 Coiled-coil domain-containing protein 172 9.92e-10 3.92e-10 NA
2. P Q9N5M2 Prefoldin subunit 2 1.22e-04 1.43e-03 NA
2. P Q4V8G8 Tektin-3 1.02e-08 1.89e-02 NA
2. P Q10006 Uncharacterized protein hal-3 1.71e-06 2.15e-08 NA
2. P P09495 Tropomyosin alpha-4 chain 5.96e-13 2.23e-02 NA
2. P A5A6P3 Keratin, type I cuticular Ha3-I 1.96e-08 4.38e-02 NA
2. P Q9FMN1 Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 3 1.14e-07 1.20e-02 NA
2. P Q1PE49 Protein At-4/1 8.55e-15 4.33e-06 NA
2. P P42638 Tropomyosin-2 1.24e-11 2.53e-02 NA
2. P Q810N9 Coiled-coil domain-containing protein 172 9.08e-12 7.53e-08 NA
2. P Q9CPR7 Suppressor of IKBKE 1 5.11e-10 3.59e-02 NA
2. P Q8T380 Tropomyosin Lep s 1.0101 1.84e-12 4.79e-04 NA
2. P P25030 Keratin, type I cytoskeletal 20 1.62e-09 1.16e-03 NA
2. P O96764 Tropomyosin 8.92e-12 1.67e-02 NA
2. P Q7TMY4 THO complex subunit 7 homolog 3.42e-10 2.27e-03 NA
2. P O95816 BAG family molecular chaperone regulator 2 3.85e-05 1.60e-02 NA
2. P Q25145 Tropomyosin 1.15e-13 4.55e-02 NA
2. P P0DSM7 Tropomyosin Per a 7.0102 6.58e-14 1.58e-04 NA
2. P Q9M9L3 Nuclear envelope-associated protein 1 4.65e-12 1.42e-06 NA
2. P Q5SV66 Coiled-coil domain-containing protein 42 4.30e-10 1.02e-05 NA
2. P A7UMC0 Tropomyosin 2.70e-11 1.18e-02 NA
2. P Q6KB66 Keratin, type II cytoskeletal 80 6.54e-09 1.25e-02 NA
2. P Q1HPU0 Tropomyosin-1 8.85e-12 5.70e-04 NA
2. P Q8IT89 Tropomyosin 5.35e-14 3.43e-03 NA
2. P P57741 Probable prefoldin subunit 3 1.02e-04 9.15e-04 NA
2. P O54887 Testis-specific serine kinase substrate 8.87e-08 1.34e-02 NA
2. P Q6P926 Spermatogenesis-associated protein 24 5.92e-11 2.88e-03 NA
2. P A9UQN0 Coiled-coil domain-containing protein 42 homolog 1.99e-13 3.13e-05 NA
2. P Q96M29 Tektin-5 9.06e-08 6.46e-03 NA
2. P Q54LS2 Probable prefoldin subunit 3 1.81e-06 1.11e-03 NA
2. P Q6AYM2 Tektin-2 2.96e-09 1.78e-02 NA
2. P P9WMA1 Uncharacterized protein Rv0025 1.30e-06 2.01e-02 NA
2. P F4IK01 AUGMIN subunit 1 3.07e-08 2.62e-03 NA
2. P Q26503 Tropomyosin 2.09e-12 1.25e-02 NA
2. P Q6RCE1 Intraflagellar transport protein 74 7.14e-06 1.37e-03 NA
2. P Q7Z3Z0 Keratin, type I cytoskeletal 25 4.78e-08 4.55e-02 NA
2. P Q95VA8 Tropomyosin 5.33e-12 2.17e-02 NA
2. P A8J8F6 Tektin 4.49e-09 2.44e-02 NA
2. P A6NFT4 Cilia- and flagella-associated protein 73 1.05e-09 1.93e-08 NA
2. P Q27172 Trichocyst matrix protein T1-F 2.01e-08 1.38e-03 NA
2. P P09491 Tropomyosin-2 2.08e-11 2.37e-05 NA
2. P Q4R353 Tektin-5 7.83e-09 3.32e-02 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 3.35e-10 1.20e-08 NA
2. P Q9U389 Allophagy receptor allo-1 6.28e-09 4.58e-05 NA
2. P Q9BXF9 Tektin-3 8.86e-08 5.66e-03 NA
2. P Q23758 Tropomyosin 1.93e-11 2.11e-03 NA
2. P Q5K2P6 Keratin, type 1 cytoskeletal 11 1.21e-07 4.34e-02 NA
2. P Q25457 Tropomyosin 1.37e-13 1.16e-02 NA
2. P Q3UXZ6 Protein FAM81A 3.35e-10 5.22e-03 NA
2. P Q8WR63 Tropomyosin 6.24e-12 2.71e-02 NA
2. P C0H4K2 Uncharacterized protein 2.73e-13 9.18e-03 NA
2. P Q520U5 Autophagy protein 16 2.38e-07 4.90e-04 NA
2. P Q9NG56 Tropomyosin 1.62e-13 4.91e-05 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 4.02e-10 2.30e-12 NA
2. P Q56A40 Coiled-coil domain-containing protein 40 3.79e-05 1.70e-04 NA
2. P Q9GZ69 Tropomyosin 5.55e-16 3.17e-04 NA
2. P Q3UYG1 Coiled-coil domain-containing protein 160 6.17e-08 6.72e-03 NA
2. P Q99176 Protein SRN2 5.03e-05 6.14e-03 NA
2. P Q3T0L1 Centromere protein H 1.37e-08 4.34e-02 NA
2. P P0DUI5 Apolipoprotein E 3.05e-07 4.26e-02 NA
2. P Q9U8G7 Hydatid disease diagnostic antigen P-29 1.40e-07 2.85e-02 NA
2. P P60531 Testis-specific serine kinase substrate 9.59e-08 4.21e-03 NA
2. P O97162 Tropomyosin 1.64e-13 1.45e-02 NA
2. P Q27174 Trichocyst matrix protein T2-B 9.16e-12 1.51e-02 NA
2. P Q9U2T3 Uncharacterized protein Y116A8C.11 8.91e-12 1.69e-04 NA
2. P Q6I9Y2 THO complex subunit 7 homolog 1.66e-10 7.62e-04 NA
2. P Q23939 Tropomyosin 2.74e-12 1.21e-02 NA
2. P Q8T6L5 Tropomyosin 7.59e-14 8.00e-06 NA
2. P A8WG43 Coiled-coil domain-containing protein 89 2.57e-13 3.92e-10 NA
2. P Q9D312 Keratin, type I cytoskeletal 20 2.85e-09 1.20e-02 NA
2. P Q6IRU2 Tropomyosin alpha-4 chain 1.55e-12 1.97e-02 NA
2. P U3H042 Kinetochore protein Sos7 2.06e-11 5.72e-06 NA
2. P Q5XJN6 Coiled-coil domain-containing protein 113 3.70e-09 1.07e-03 NA
2. P Q9P7J4 THO complex subunit mft1 1.39e-06 1.57e-03 NA
2. P Q4PT37 Nuclear envelope-associated protein 3 1.33e-15 3.28e-06 NA
2. P Q5XVC7 WEB family protein At2g40480 7.27e-06 4.87e-02 NA
2. P Q6IMF1 Keratin, type II cytoskeletal 80 8.73e-08 1.65e-02 NA
2. P P9WMA0 Uncharacterized protein MT0028 1.69e-06 2.01e-02 NA
2. P Q149S1 Tektin-4 1.16e-08 2.15e-02 NA
2. P Q54M71 Probable prefoldin subunit 6 7.48e-06 4.16e-04 NA
2. P Q9NVX0 HAUS augmin-like complex subunit 2 1.15e-07 2.45e-05 NA
2. P O74324 Uncharacterized protein C1685.04 4.43e-09 1.40e-03 NA
2. P A6NGH7 Coiled-coil domain-containing protein 160 3.37e-10 9.51e-05 NA
2. P Q6P643 THO complex subunit 7 homolog 1.02e-08 1.35e-04 NA
2. P Q3ZBG5 BAG family molecular chaperone regulator 2 2.14e-06 5.23e-04 NA
2. P Q91YN9 BAG family molecular chaperone regulator 2 2.87e-05 1.19e-02 NA
2. P P0DSM6 Tropomyosin Per a 7.0101 6.15e-14 2.48e-05 NA
2. P O23564 Putative WEB family protein At4g17210 8.78e-09 4.95e-04 NA
2. P Q6BH63 Autophagy protein 16 1.05e-11 1.29e-03 NA
2. P P55925 SF-assemblin 7.72e-12 2.06e-04 NA
2. P Q8R015 Biogenesis of lysosome-related organelles complex 1 subunit 5 1.11e-06 3.05e-02 NA
2. P Q5PPV2 Tektin-4 4.47e-09 5.33e-03 NA
2. P Q8WW24 Tektin-4 1.77e-08 1.82e-02 NA
2. P Q27181 Trichocyst matrix protein T2-C 1.12e-11 3.10e-02 NA
2. P Q9USR5 Uncharacterized THOC5 family protein 2.32e-09 3.60e-08 NA
2. P Q86W54 Spermatogenesis-associated protein 24 1.23e-06 1.77e-02 NA
2. P Q29RS0 Coiled-coil domain-containing protein 89 1.34e-10 4.40e-08 NA
2. P P32489 Meiosis protein 5 1.54e-05 4.44e-04 NA
2. P Q95JI9 Coiled-coil domain-containing protein 89 9.82e-11 5.87e-09 NA
2. P C5J049 Tropomyosin Per a 7.0103 1.10e-13 5.44e-07 NA
2. P O67453 Uncharacterized protein aq_1476 1.66e-10 6.28e-09 NA
2. P F4K1B4 Nuclear envelope-associated protein 2 6.66e-16 1.24e-06 NA
2. P Q0VCF3 Suppressor of IKBKE 1 1.06e-09 3.50e-03 NA
2. P Q9QYM8 Centromere protein H 1.57e-06 3.77e-07 NA
2. P Q32LK9 Synaptonemal complex central element protein 1 2.78e-09 1.90e-09 NA
2. P Q9H0I3 Coiled-coil domain-containing protein 113 2.09e-09 9.18e-03 NA
2. P M1V4Y8 Cilia- and flagella-associated protein 73 1.80e-09 1.54e-04 NA
2. P O02389 Tropomyosin 2.27e-11 7.82e-03 NA
2. P Q9C075 Keratin, type I cytoskeletal 23 9.73e-09 1.68e-02 NA
2. P Q96M95 Coiled-coil domain-containing protein 42 2.76e-09 6.39e-05 NA
2. P Q19782 Intermediate filament protein ifd-2 3.90e-10 1.61e-04 NA
2. P P15518 Giardin subunit beta 1.15e-10 1.75e-02 NA
2. P Q8C5T8 Coiled-coil domain-containing protein 113 1.30e-08 5.23e-04 NA
2. P P31816 Tropomyosin 2.89e-13 4.39e-03 NA
2. P Q9D495 Synaptonemal complex central element protein 1 2.54e-09 4.71e-09 NA
2. P B1AQ75 Keratin, type I cuticular Ha6 4.99e-10 5.27e-03 NA
2. P Q10143 Probable prefoldin subunit 3 1.30e-07 4.86e-03 NA
2. P Q8LDS5 THO complex subunit 7A 4.93e-09 7.62e-04 NA
2. P Q95PU1 Tropomyosin 4.82e-12 4.13e-03 NA
2. P Q93V84 Protein FLX-like 1 1.35e-09 2.82e-03 NA
2. P Q9ZSZ8 FKBP12-interacting protein of 37 kDa 1.95e-08 1.46e-04 NA
2. P Q9N2R3 Tropomyosin (Fragment) 2.29e-12 1.65e-02 NA
2. P Q7ZW57 Coiled-coil domain-containing protein 89 5.35e-12 3.49e-04 NA
2. P A8WVJ9 Prefoldin subunit 2 1.41e-04 2.94e-03 NA
2. P Q08AV7 Coiled-coil domain-containing protein 69-B 2.97e-10 8.95e-09 NA
2. P Q8N998 Coiled-coil domain-containing protein 89 1.08e-11 4.92e-07 NA
2. P A7RX34 THO complex subunit 7 homolog 5.51e-09 1.08e-04 NA
2. P A7KAK0 Autophagy-related protein 16 4.16e-11 8.86e-04 NA
2. P Q39490 SF-assemblin 1.77e-10 3.29e-02 NA
2. P P53865 Chaotic nuclear migration protein 67 3.10e-07 2.25e-02 NA
2. P Q9GZ70 Tropomyosin 1.48e-11 2.03e-02 NA
2. P Q8VYU8 Interactor of constitutive active ROPs 5 5.35e-10 1.81e-05 NA
2. P Q9DA73 Coiled-coil domain-containing protein 89 1.01e-09 9.44e-09 NA
2. P A6QQM8 Coiled-coil domain-containing protein 42 4.32e-10 1.47e-03 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 4.23e-12 7.44e-06 NA
2. P Q0VBK2 Keratin, type II cytoskeletal 80 2.93e-08 6.26e-03 NA
2. P A6H782 Tektin-3 1.09e-08 2.37e-02 NA
2. P B2RZ86 Coiled-coil domain-containing protein 89 3.64e-13 1.87e-07 NA
2. P B8F426 UPF0265 protein HAPS_0398 9.66e-06 1.85e-02 NA
2. P P0DUI6 Apolipoprotein E 3.42e-07 4.26e-02 NA
2. P Q8TBF8 Protein FAM81A 2.99e-11 4.04e-05 NA
2. P A4URH3 Tropomyosin 1.41e-13 2.07e-02 NA
2. P O14043 Uncharacterized protein C2C4.10c 1.75e-10 2.13e-03 NA
2. P Q9M8T6 THO complex subunit 7B 2.48e-09 1.55e-03 NA
2. P Q61806 X-linked lymphocyte-regulated protein 3C 1.23e-07 8.73e-03 NA
2. P P34606 Uncharacterized protein ZK1098.6 1.30e-07 1.26e-05 NA
2. P Q1HPQ0 Tropomyosin-2 3.39e-12 1.82e-04 NA
2. P J3QPZ5 Cilia- and flagella-associated protein 73 6.75e-11 1.27e-05 NA
2. P Q9NUD7 Uncharacterized protein C20orf96 4.28e-10 1.01e-03 NA
2. P Q5FWT9 Suppressor of IKBKE 1 7.91e-11 4.66e-03 NA
2. P Q9TSV3 Coiled-coil alpha-helical rod protein 1 (Fragment) 8.78e-10 5.22e-03 NA
2. P Q0P5J4 Keratin, type I cytoskeletal 25 6.80e-08 3.59e-02 NA
2. P Q6X6Z7 Tektin-3 7.80e-08 2.82e-03 NA
2. P Q7TQ72 Protein MIS12 homolog 4.98e-07 4.82e-02 NA
2. P O44119 Tropomyosin 1.79e-13 2.51e-03 NA
2. P P91958 Tropomyosin 7.18e-13 4.78e-02 NA
2. P Q494R4 Coiled-coil domain-containing protein 153 7.56e-10 1.84e-03 NA
2. P Q3SZ60 THO complex subunit 7 homolog 2.49e-10 7.62e-04 NA
2. P A6BLY7 Keratin, type I cytoskeletal 28 3.63e-08 2.28e-02 NA
2. P A8MT33 Synaptonemal complex central element protein 1-like 2.61e-08 7.49e-05 NA