Summary

Q5T5S1

Homolog: A2AJB1.
Function: Coiled-coil domain-containing protein 183.

Statistics

Total GO Annotation: 67
Unique PROST Go: 52
Unique BLAST Go: 2

Total Homologs: 54
Unique PROST Homologs: 49
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A2AJB1 (Coiled-coil domain-containing protein 183) with a FATCAT P-Value: 3.04e-12 and RMSD of 6.23 angstrom. The sequence alignment identity is 76.0%.
Structural alignment shown in left. Query protein Q5T5S1 colored as red in alignment, homolog A2AJB1 colored as blue. Query protein Q5T5S1 is also shown in right top, homolog A2AJB1 showed in right bottom. They are colored based on secondary structures. 

  Q5T5S1 MRRHSETDVEEQTQELKTITQLQEQCRALQIQGVKENMDQNKATLALLRSNIRRGAQDWALAKKYDQWTISKACGKNLPLRLAHCRSTMEVVREKLRKYV 100
  A2AJB1 MKVHNEAAVEAQITELRTITRLQEQCRALQIQGVKEKTAQNKATMGILRSNLRRGAQDWALAKKHDQWTISKACGKDTSMRLAHGRSTLEVAREKLRKYV 100

  Q5T5S1 FDRVNMHNLLIHLVRRRGQKLESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIKIITSQNIHLLYLDLLDYLKTVLAGYPIELDKLQNLVVNY 200
  A2AJB1 FDRVNTHNILIHLVRRRGQKLESLQLELASLRNQPDATKDELRQLQIIRQLENNIEKTVIKITTSQNIHTLYKVLLDYLKKVLAEYPTELDKLQNLVANY 200

  Q5T5S1 CSELSDMKIMSQDAMMITDEVKRNMRQREASFIEERRARENRLNQQKKLIDKIHTKETSEKYRRGQMDLDFPSNLMSTETLKLRRKETSTAEMEYQSGVT 300
  A2AJB1 CSELSDMTVMSQDAMMITDEVKRNMRQGEATFIEERRARENRLNQQKKLIDKIHTKETSEKYRRGRRDLDFPSNLMTMENVKVKKRKTSVADIQYQTKVT 300

  Q5T5S1 AVVEKVKSAVRCSHVWDITSRFLAQRNTEENLELQMEDCEEWRVQLKALVKQLELEEAVLKFRQKPSSISFKSVEKKMTDMLKEEEERLQLAHSNMTKGQ 400
  A2AJB1 TLVERVKSAVQCSHLWDIAGRFLAQKNTEENLELQMEDCEERRTQLEALMKKLELEEAVLKFHQTPSAVGFNSIQKKMKNMLEEEEARLKQAQNNMNKGQ 400

  Q5T5S1 ELLLTIQMGIDNLYVRLMGINLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENREEDMIDTFQF 500
  A2AJB1 QLLLVIQTGIDNLYIRLIGITLPTFQKEIAVSNTLDVYGKLDYCEGKLIYLAERMQTLSRNEEVDTKVRDTLESSTLKEKHNTRITFEDPEEDMIETFQF 500

  Q5T5S1 PDMDHSYVPSRAEIKRQAQRLIEGKLKAAKKKKK 534
  A2AJB1 ADVDHSYVPSRAEIKKQAQQLIEAKLKGAKKKKK 534

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005929 cilium
1. PB GO:0005930 axoneme
1. PB GO:0036158 outer dynein arm assembly
1. PB GO:0003341 cilium movement
1. PB GO:1902017 regulation of cilium assembly
1. PB GO:0007368 determination of left/right symmetry
1. PB GO:0061371 determination of heart left/right asymmetry
1. PB GO:0090660 cerebrospinal fluid circulation
1. PB GO:0007507 heart development
1. PB GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
1. PB GO:0005814 centriole
1. PB GO:0036064 ciliary basal body
1. PB GO:0030317 flagellated sperm motility
2. P GO:0032258 cytoplasm to vacuole transport by the Cvt pathway
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0005874 microtubule
2. P GO:0061512 protein localization to cilium
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:0005819 spindle
2. P GO:0009524 phragmoplast
2. P GO:0001947 heart looping
2. P GO:0034727 piecemeal microautophagy of the nucleus
2. P GO:0071907 determination of digestive tract left/right asymmetry
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0048870 cell motility
2. P GO:0007099 centriole replication
2. P GO:0008017 microtubule binding
2. P GO:0035469 determination of pancreatic left/right asymmetry
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0000045 autophagosome assembly
2. P GO:1990316 Atg1/ULK1 kinase complex
2. P GO:0060294 cilium movement involved in cell motility
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0034045 phagophore assembly site membrane
2. P GO:0007420 brain development
2. P GO:0060090 molecular adaptor activity
2. P GO:0036157 outer dynein arm
2. P GO:0071910 determination of liver left/right asymmetry
2. P GO:0030242 autophagy of peroxisome
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0030324 lung development
2. P GO:0000922 spindle pole
2. P GO:0034497 protein localization to phagophore assembly site
2. P GO:0007286 spermatid development
2. P GO:0031514 motile cilium
2. P GO:0070840 dynein complex binding
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0003356 regulation of cilium beat frequency
2. P GO:0005813 centrosome
2. P GO:0000407 phagophore assembly site
2. P GO:0036159 inner dynein arm assembly
2. P GO:0000795 synaptonemal complex
2. P GO:0030295 protein kinase activator activity
2. P GO:0044458 motile cilium assembly
2. P GO:0051649 establishment of localization in cell
2. P GO:0044805 late nucleophagy
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005856 cytoskeleton
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:0032147 activation of protein kinase activity
2. P GO:0000801 central element
2. P GO:0097729 9+2 motile cilium
2. P GO:0097545 axonemal outer doublet
2. P GO:0006914 autophagy
3. B GO:0035264 multicellular organism growth
3. B GO:0007283 spermatogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5T5S1 Coiled-coil domain-containing protein 183 0 8.10e-169 0.0
1. PB A7MBH5 Outer dynein arm-docking complex subunit 3 8.73e-10 1.13e-16 2.27e-09
1. PB A2AJB1 Coiled-coil domain-containing protein 183 3.04e-12 6.89e-78 0.0
1. PB Q8BSN3 outer dynein arm-docking complex subunit 3 1.57e-10 1.64e-16 1.63e-15
1. PB A5D8V7 Outer dynein arm-docking complex subunit 3 1.24e-07 9.80e-15 4.41e-12
2. P Q6CWA7 Autophagy-related protein 23 1.80e-04 2.43e-03 NA
2. P Q9UFE4 Coiled-coil domain-containing protein 39 5.51e-06 5.89e-05 NA
2. P Q3KPZ2 Coiled-coil domain-containing protein 42-like 1 3.08e-07 1.87e-08 NA
2. P Q5SV66 Coiled-coil domain-containing protein 42 2.73e-07 7.07e-04 NA
2. P Q8NA47 Coiled-coil domain-containing protein 63 1.49e-06 8.21e-18 NA
2. P P22225 69 kDa paraflagellar rod protein 1.35e-06 1.25e-02 NA
2. P Q3UZ57 Axonemal dynein light chain domain-containing protein 1 9.14e-08 1.04e-02 NA
2. P Q95JL6 Coiled-coil domain-containing protein 38 1.70e-04 4.50e-03 NA
2. P A2QCV0 Autophagy-related protein 17 7.92e-05 1.67e-02 NA
2. P Q5PQJ9 Coiled-coil domain-containing protein 175 1.68e-08 1.93e-02 NA
2. P Q2UFN7 Autophagy-related protein 17 7.20e-06 2.05e-02 NA
2. P Q4V8F7 Coiled-coil domain-containing protein 63 1.17e-06 1.95e-14 NA
2. P A8IQE0 Coiled-coil domain-containing protein 39 7.14e-08 1.79e-03 NA
2. P P0CK98 Coiled-coil domain-containing protein 39 5.39e-05 5.72e-04 NA
2. P Q9D5Y1 Coiled-coil domain-containing protein 39 5.90e-06 1.14e-07 NA
2. P Q6AYM2 Tektin-2 1.77e-09 8.08e-03 NA
2. P Q8IYE0 Coiled-coil domain-containing protein 146 1.74e-05 4.40e-03 NA
2. P A6QQM8 Coiled-coil domain-containing protein 42 1.16e-08 2.36e-02 NA
2. P Q4R8V8 Cilia- and flagella-associated protein 100 NA 3.88e-02 NA
2. P B9V5F5 Centrosomal protein of 63 kDa-A 3.62e-07 1.59e-03 NA
2. P A6NFT4 Cilia- and flagella-associated protein 73 8.65e-09 4.52e-04 NA
2. P Q6FK56 Autophagy-related protein 23 3.95e-05 6.56e-03 NA
2. P Q502W7 Coiled-coil domain-containing protein 38 3.33e-04 6.47e-04 NA
2. P E2R1I5 Coiled-coil domain-containing protein 39 6.59e-06 5.18e-05 NA
2. P Q2T9W3 Coiled-coil domain-containing protein 63 2.76e-06 6.91e-23 NA
2. P A8JF70 Outer dynein arm protein 1 2.01e-07 4.15e-16 NA
2. P Q756Z7 Autophagy-related protein 23 4.93e-04 9.84e-04 NA
2. P Q66H60 Coiled-coil domain-containing protein 146 4.14e-05 2.88e-03 NA
2. P D3Z8K2 Coiled-coil domain-containing protein 39 1.01e-05 2.94e-08 NA
2. P Q06671 Autophagy-related protein 23 4.47e-05 1.04e-02 NA
2. P Q8CDV6 Coiled-coil domain-containing protein 63 1.57e-06 2.49e-20 NA
2. P Q494V2 Cilia- and flagella-associated protein 100 4.23e-07 1.35e-02 NA
2. P Q5AZC0 Autophagy-related protein 17 9.64e-06 4.37e-02 NA
2. P Q0V9R4 Coiled-coil domain-containing protein 39 5.66e-06 6.53e-06 NA
2. P A1C7E5 Autophagy-related protein 17 4.85e-05 2.46e-02 NA
2. P Q32LK9 Synaptonemal complex central element protein 1 7.33e-06 5.38e-03 NA
2. P M1V4Y8 Cilia- and flagella-associated protein 73 3.25e-08 2.73e-03 NA
2. P Q8MT08 Dynein regulatory complex subunit 4 9.22e-08 2.71e-02 NA
2. P Q96M95 Coiled-coil domain-containing protein 42 5.06e-07 1.49e-03 NA
2. P A8I4E9 Cilia- and flagella-associated protein 100 1.46e-05 7.03e-06 NA
2. P Q8CDN8 Coiled-coil domain-containing protein 38 2.14e-04 1.66e-05 NA
2. P Q9C7G0 65-kDa microtubule-associated protein 8 1.40e-02 3.33e-05 NA
2. P Q80VN0 Cilia- and flagella-associated protein 100 3.91e-05 1.34e-02 NA
2. P Q9D495 Synaptonemal complex central element protein 1 8.19e-06 4.73e-04 NA
2. P Q4PSA3 65-kDa microtubule-associated protein 9 3.49e-03 2.04e-03 NA
2. P E9PVB3 Coiled-coil domain-containing protein 175 3.44e-06 1.12e-02 NA
2. P Q5AI71 Autophagy-related protein 17 5.21e-06 1.02e-03 NA
2. P E1BM70 Coiled-coil domain-containing protein 39 6.70e-06 1.62e-06 NA
2. P Q56336 Cytoplasmic filament protein A 2.11e-03 1.34e-02 NA