Summary

Q5T870

Homolog: A6QNZ4.
Function: Proline-rich protein 9.

Statistics

Total GO Annotation: 33
Unique PROST Go: 29
Unique BLAST Go: 4

Total Homologs: 85
Unique PROST Homologs: 79
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6QNZ4 (Proline-rich protein 9) with a FATCAT P-Value: 3.16e-06 and RMSD of 2.77 angstrom. The sequence alignment identity is 77.6%.
Structural alignment shown in left. Query protein Q5T870 colored as red in alignment, homolog A6QNZ4 colored as blue. Query protein Q5T870 is also shown in right top, homolog A6QNZ4 showed in right bottom. They are colored based on secondary structures. 

  Q5T870 MSFSEQQCKQPCVPPPCLPKTQEQCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEV 100
  A6QNZ4 MSFNEQQCKQPCVPPPCLQKTQEQCQAKAEEVCLPPCQDPCQEKCPTKVQEVCVPQCQALSQDNCPQQSQDPCLPLCPDQCPSQCTEPCQELSQTKCVEV 100

  Q5T870 CPQKVQEKCSSPGKGK 116
  A6QNZ4 CPQKIQEKCLPPGKGK 116

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0008585 female gonad development
2. P GO:0045735 nutrient reservoir activity
2. P GO:0005198 structural molecule activity
2. P GO:0018149 peptide cross-linking
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0005829 cytosol
2. P GO:0030216 keratinocyte differentiation
2. P GO:0005874 microtubule
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0003785 actin monomer binding
2. P GO:0032355 response to estradiol
2. P GO:0005882 intermediate filament
2. P GO:0045095 keratin filament
2. P GO:0008544 epidermis development
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0007010 cytoskeleton organization
2. P GO:0033172 gas vesicle shell
2. P GO:0046870 cadmium ion binding
2. P GO:0071944 cell periphery
2. P GO:0042098 T cell proliferation
2. P GO:0031424 keratinization
2. P GO:0006952 defense response
2. P GO:0004867 serine-type endopeptidase inhibitor activity
2. P GO:0005773 vacuole
2. P GO:0005938 cell cortex
2. P GO:0031412 gas vesicle organization
2. P GO:0008284 positive regulation of cell population proliferation
2. P GO:0031514 motile cilium
2. P GO:0001533 cornified envelope
3. B GO:0042262 DNA protection
3. B GO:0061631 ubiquitin conjugating enzyme activity
3. B GO:0030430 host cell cytoplasm
3. B GO:0005743 mitochondrial inner membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5T870 Proline-rich protein 9 0 1.90e-152 5.35e-71
1. PB A6QNZ4 Proline-rich protein 9 3.16e-06 2.06e-48 6.01e-50
1. PB Q8BV84 Proline-rich protein 9 3.35e-03 3.03e-50 2.70e-50
2. P O70557 Small proline-rich protein 2F 3.19e-01 6.65e-08 NA
2. P Q4W7G7 Keratin-associated protein 13-4 9.75e-01 5.57e-06 NA
2. P Q9CQK8 Small proline-rich protein 2A1 6.50e-01 1.23e-06 NA
2. P J9VL95 Copper metallothionein 2 9.17e-01 4.18e-06 NA
2. P Q3LI81 Keratin-associated protein 27-1 9.13e-01 6.35e-06 NA
2. P P02805 Metallothionein-1 8.79e-01 4.64e-03 NA
2. P O70560 Small proline-rich protein 2I 4.56e-01 1.40e-05 NA
2. P Q25298 Kinetoplastid membrane protein 11C 8.11e-04 1.65e-03 NA
2. P P08416 Zein-alpha GZ19AB11 1.42e-02 4.07e-02 NA
2. P Q6L8G9 Keratin-associated protein 5-6 9.21e-01 4.03e-03 NA
2. P Q4W7G8 Keratin-associated protein 13-4 9.87e-01 5.57e-06 NA
2. P Q9BYE4 Small proline-rich protein 2G 4.37e-01 1.53e-03 NA
2. P P0C7H8 Keratin-associated protein 2-3 8.40e-01 2.88e-03 NA
2. P Q4W7H0 Keratin-associated protein 13-4 9.84e-01 2.07e-04 NA
2. P O97388 Metallothionein-1 9.77e-01 8.68e-04 NA
2. P P22528 Cornifin-B 7.51e-01 4.79e-05 NA
2. P P35322 Cornifin 6.48e-01 7.85e-06 NA
2. P P80394 Metallothionein-1 9.42e-01 1.79e-03 NA
2. P P51902 Metallothionein 8.69e-01 3.46e-02 NA
2. P P55949 Metallothionein-1B 8.99e-01 1.82e-02 NA
2. P Q925I0 Keratin-associated protein 19-2 9.82e-01 1.76e-04 NA
2. P J9VXB3 Copper metallothionein 1 8.97e-01 1.57e-05 NA
2. P P35326 Small proline-rich protein 2A 3.53e-01 1.02e-03 NA
2. P Q4W7G9 Keratin-associated protein 13-4 9.89e-01 5.57e-06 NA
2. P Q03968 Late embryogenesis abundant protein, group 3 3.54e-03 4.07e-03 NA
2. P Q925H6 Keratin-associated protein 19-3 7.86e-01 1.02e-02 NA
2. P O70558 Small proline-rich protein 2G 3.22e-01 3.66e-06 NA
2. P Q62266 Cornifin-A 9.70e-01 8.15e-04 NA
2. P O70555 Small proline-rich protein 2D 6.37e-01 1.52e-04 NA
2. P O70556 Small proline-rich protein 2E 3.30e-01 8.33e-06 NA
2. P Q3SY46 Keratin-associated protein 13-3 9.85e-01 2.94e-03 NA
2. P O21436 Kinetoplastid membrane protein 11 8.00e-04 9.96e-04 NA
2. P P33187 Cadmium-metallothionein 9.36e-01 3.42e-03 NA
2. P O70554 Small proline-rich protein 2B 4.05e-01 2.52e-03 NA
2. P Q3LI77 Keratin-associated protein 13-4 9.91e-01 5.68e-05 NA
2. P Q8NC38 Putative uncharacterized protein ZNF436-AS1 3.30e-01 1.00e-02 NA
2. P P80367 Metallothionein 7.16e-01 4.78e-03 NA
2. P P81695 Cadmium-metallothionein 9.53e-01 3.95e-02 NA
2. P Q25297 Kinetoplastid membrane protein 11B 9.02e-04 2.70e-02 NA
2. P P56679 Seed trypsin/chymotrypsin inhibitor IVB 8.03e-01 4.91e-02 NA
2. P Q9BYR5 Keratin-associated protein 4-2 3.67e-01 4.69e-02 NA
2. P Q9BYU5 Keratin-associated protein 2-1 8.96e-01 2.37e-03 NA
2. P Q63532 Cornifin-A 9.83e-01 2.36e-04 NA
2. P Q8T6B3 Metallothionein-1 9.28e-01 2.84e-04 NA
2. P O70559 Small proline-rich protein 2H 5.96e-01 3.15e-02 NA
2. P P55952 Metallothionein 8.54e-01 2.55e-02 NA
2. P C9JFL3 Proline, histidine and glycine-rich protein 1 9.19e-01 2.36e-07 NA
2. P P02961 Small, acid-soluble spore protein gamma-type 6.32e-04 7.00e-03 NA
2. P Q8K0G7 Proline, histidine and glycine-rich protein 1 8.64e-01 2.32e-06 NA
2. P P83442 Late embryogenesis abundant protein Dc3 1.04e-03 1.99e-02 NA
2. P O17389 Thymosin beta 2.73e-02 1.54e-02 NA
2. P Q9BYT5 Keratin-associated protein 2-2 9.38e-01 3.00e-04 NA
2. P P55950 Metallothionein-2B 8.75e-01 2.88e-03 NA
2. P P06675 Zein-alpha 19B1 1.37e-02 3.43e-02 NA
2. P Q9BYR9 Keratin-associated protein 2-4 8.31e-01 2.88e-03 NA
2. P P02443 Keratin, high-sulfur matrix protein, IIIA3A 9.25e-01 1.57e-02 NA
2. P O70562 Small proline-rich protein 2K 5.53e-01 5.62e-03 NA
2. P P22531 Small proline-rich protein 2E 3.66e-01 2.14e-04 NA
2. P Q52LG2 Keratin-associated protein 13-2 9.95e-01 4.18e-05 NA
2. P Q96RM1 Small proline-rich protein 2F 3.51e-01 7.40e-07 NA
2. P Q8YUS9 Gas vesicle protein C 2.52e-04 8.98e-03 NA
2. P P35325 Small proline-rich protein 2B 3.46e-01 4.63e-04 NA
2. P P07786 Small, acid-soluble spore protein gamma-type 5.49e-03 2.39e-02 NA
2. P Q40561 Proteinase inhibitor type-2 2.03e-01 7.15e-03 NA
2. P Q02400 Late embryogenesis abundant protein B19.3 9.14e-03 2.01e-03 NA
2. P Q4W7H1 Keratin-associated protein 13-4 9.83e-01 2.07e-04 NA
2. P Q8IUC0 Keratin-associated protein 13-1 9.88e-01 5.44e-06 NA
2. P P26907 Glucose starvation-inducible protein B 3.73e-03 3.67e-02 NA
2. P Q3LHN0 Keratin-associated protein 25-1 8.70e-01 4.60e-02 NA
2. P Q4KL71 Small proline-rich protein 2A3 6.81e-01 1.23e-06 NA
2. P P08041 Gas vesicle protein C 7.29e-04 2.81e-02 NA
2. P Q925H2 Keratin-associated protein 19-1 8.78e-01 7.62e-05 NA
2. P P60329 Keratin-associated protein 12-4 6.86e-01 1.40e-07 NA
2. P P80247 Metallothionein 10-II 9.30e-01 5.51e-03 NA
2. P Q36736 Kinetoplastid membrane protein 11 7.70e-04 1.17e-02 NA
2. P P35321 Cornifin-A 5.90e-01 4.90e-05 NA
2. P P22532 Small proline-rich protein 2D 3.61e-01 1.15e-05 NA
2. P P35324 Cornifin alpha 9.65e-01 7.08e-03 NA
2. P P35323 Cornifin 9.19e-01 1.53e-06 NA
3. B Q65169 Protein B602L NA NA 0.030
3. B Q8I335 Translation factor GUF1 homolog, mitochondrial 8.86e-01 NA 0.008
3. B Q5UQ88 Probable ubiquitin-conjugating enzyme E2 R521 NA NA 0.009