Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A6QNZ4
(Proline-rich protein 9) with a FATCAT P-Value: 3.16e-06 and RMSD of 2.77 angstrom. The sequence alignment identity is 77.6%.
Structural alignment shown in left. Query protein Q5T870 colored as red in alignment, homolog A6QNZ4 colored as blue.
Query protein Q5T870 is also shown in right top, homolog A6QNZ4 showed in right bottom. They are colored based on secondary structures.
Q5T870 MSFSEQQCKQPCVPPPCLPKTQEQCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEV 100 A6QNZ4 MSFNEQQCKQPCVPPPCLQKTQEQCQAKAEEVCLPPCQDPCQEKCPTKVQEVCVPQCQALSQDNCPQQSQDPCLPLCPDQCPSQCTEPCQELSQTKCVEV 100 Q5T870 CPQKVQEKCSSPGKGK 116 A6QNZ4 CPQKIQEKCLPPGKGK 116
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0008585 | female gonad development |
| 2. P | GO:0045735 | nutrient reservoir activity |
| 2. P | GO:0005198 | structural molecule activity |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0030280 | structural constituent of skin epidermis |
| 2. P | GO:0003785 | actin monomer binding |
| 2. P | GO:0032355 | response to estradiol |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0008544 | epidermis development |
| 2. P | GO:0030435 | sporulation resulting in formation of a cellular spore |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0033172 | gas vesicle shell |
| 2. P | GO:0046870 | cadmium ion binding |
| 2. P | GO:0071944 | cell periphery |
| 2. P | GO:0042098 | T cell proliferation |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0006952 | defense response |
| 2. P | GO:0004867 | serine-type endopeptidase inhibitor activity |
| 2. P | GO:0005773 | vacuole |
| 2. P | GO:0005938 | cell cortex |
| 2. P | GO:0031412 | gas vesicle organization |
| 2. P | GO:0008284 | positive regulation of cell population proliferation |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0001533 | cornified envelope |
| 3. B | GO:0042262 | DNA protection |
| 3. B | GO:0061631 | ubiquitin conjugating enzyme activity |
| 3. B | GO:0030430 | host cell cytoplasm |
| 3. B | GO:0005743 | mitochondrial inner membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5T870 | Proline-rich protein 9 | 0 | 1.90e-152 | 5.35e-71 |
| 1. PB | A6QNZ4 | Proline-rich protein 9 | 3.16e-06 | 2.06e-48 | 6.01e-50 |
| 1. PB | Q8BV84 | Proline-rich protein 9 | 3.35e-03 | 3.03e-50 | 2.70e-50 |
| 2. P | O70557 | Small proline-rich protein 2F | 3.19e-01 | 6.65e-08 | NA |
| 2. P | Q4W7G7 | Keratin-associated protein 13-4 | 9.75e-01 | 5.57e-06 | NA |
| 2. P | Q9CQK8 | Small proline-rich protein 2A1 | 6.50e-01 | 1.23e-06 | NA |
| 2. P | J9VL95 | Copper metallothionein 2 | 9.17e-01 | 4.18e-06 | NA |
| 2. P | Q3LI81 | Keratin-associated protein 27-1 | 9.13e-01 | 6.35e-06 | NA |
| 2. P | P02805 | Metallothionein-1 | 8.79e-01 | 4.64e-03 | NA |
| 2. P | O70560 | Small proline-rich protein 2I | 4.56e-01 | 1.40e-05 | NA |
| 2. P | Q25298 | Kinetoplastid membrane protein 11C | 8.11e-04 | 1.65e-03 | NA |
| 2. P | P08416 | Zein-alpha GZ19AB11 | 1.42e-02 | 4.07e-02 | NA |
| 2. P | Q6L8G9 | Keratin-associated protein 5-6 | 9.21e-01 | 4.03e-03 | NA |
| 2. P | Q4W7G8 | Keratin-associated protein 13-4 | 9.87e-01 | 5.57e-06 | NA |
| 2. P | Q9BYE4 | Small proline-rich protein 2G | 4.37e-01 | 1.53e-03 | NA |
| 2. P | P0C7H8 | Keratin-associated protein 2-3 | 8.40e-01 | 2.88e-03 | NA |
| 2. P | Q4W7H0 | Keratin-associated protein 13-4 | 9.84e-01 | 2.07e-04 | NA |
| 2. P | O97388 | Metallothionein-1 | 9.77e-01 | 8.68e-04 | NA |
| 2. P | P22528 | Cornifin-B | 7.51e-01 | 4.79e-05 | NA |
| 2. P | P35322 | Cornifin | 6.48e-01 | 7.85e-06 | NA |
| 2. P | P80394 | Metallothionein-1 | 9.42e-01 | 1.79e-03 | NA |
| 2. P | P51902 | Metallothionein | 8.69e-01 | 3.46e-02 | NA |
| 2. P | P55949 | Metallothionein-1B | 8.99e-01 | 1.82e-02 | NA |
| 2. P | Q925I0 | Keratin-associated protein 19-2 | 9.82e-01 | 1.76e-04 | NA |
| 2. P | J9VXB3 | Copper metallothionein 1 | 8.97e-01 | 1.57e-05 | NA |
| 2. P | P35326 | Small proline-rich protein 2A | 3.53e-01 | 1.02e-03 | NA |
| 2. P | Q4W7G9 | Keratin-associated protein 13-4 | 9.89e-01 | 5.57e-06 | NA |
| 2. P | Q03968 | Late embryogenesis abundant protein, group 3 | 3.54e-03 | 4.07e-03 | NA |
| 2. P | Q925H6 | Keratin-associated protein 19-3 | 7.86e-01 | 1.02e-02 | NA |
| 2. P | O70558 | Small proline-rich protein 2G | 3.22e-01 | 3.66e-06 | NA |
| 2. P | Q62266 | Cornifin-A | 9.70e-01 | 8.15e-04 | NA |
| 2. P | O70555 | Small proline-rich protein 2D | 6.37e-01 | 1.52e-04 | NA |
| 2. P | O70556 | Small proline-rich protein 2E | 3.30e-01 | 8.33e-06 | NA |
| 2. P | Q3SY46 | Keratin-associated protein 13-3 | 9.85e-01 | 2.94e-03 | NA |
| 2. P | O21436 | Kinetoplastid membrane protein 11 | 8.00e-04 | 9.96e-04 | NA |
| 2. P | P33187 | Cadmium-metallothionein | 9.36e-01 | 3.42e-03 | NA |
| 2. P | O70554 | Small proline-rich protein 2B | 4.05e-01 | 2.52e-03 | NA |
| 2. P | Q3LI77 | Keratin-associated protein 13-4 | 9.91e-01 | 5.68e-05 | NA |
| 2. P | Q8NC38 | Putative uncharacterized protein ZNF436-AS1 | 3.30e-01 | 1.00e-02 | NA |
| 2. P | P80367 | Metallothionein | 7.16e-01 | 4.78e-03 | NA |
| 2. P | P81695 | Cadmium-metallothionein | 9.53e-01 | 3.95e-02 | NA |
| 2. P | Q25297 | Kinetoplastid membrane protein 11B | 9.02e-04 | 2.70e-02 | NA |
| 2. P | P56679 | Seed trypsin/chymotrypsin inhibitor IVB | 8.03e-01 | 4.91e-02 | NA |
| 2. P | Q9BYR5 | Keratin-associated protein 4-2 | 3.67e-01 | 4.69e-02 | NA |
| 2. P | Q9BYU5 | Keratin-associated protein 2-1 | 8.96e-01 | 2.37e-03 | NA |
| 2. P | Q63532 | Cornifin-A | 9.83e-01 | 2.36e-04 | NA |
| 2. P | Q8T6B3 | Metallothionein-1 | 9.28e-01 | 2.84e-04 | NA |
| 2. P | O70559 | Small proline-rich protein 2H | 5.96e-01 | 3.15e-02 | NA |
| 2. P | P55952 | Metallothionein | 8.54e-01 | 2.55e-02 | NA |
| 2. P | C9JFL3 | Proline, histidine and glycine-rich protein 1 | 9.19e-01 | 2.36e-07 | NA |
| 2. P | P02961 | Small, acid-soluble spore protein gamma-type | 6.32e-04 | 7.00e-03 | NA |
| 2. P | Q8K0G7 | Proline, histidine and glycine-rich protein 1 | 8.64e-01 | 2.32e-06 | NA |
| 2. P | P83442 | Late embryogenesis abundant protein Dc3 | 1.04e-03 | 1.99e-02 | NA |
| 2. P | O17389 | Thymosin beta | 2.73e-02 | 1.54e-02 | NA |
| 2. P | Q9BYT5 | Keratin-associated protein 2-2 | 9.38e-01 | 3.00e-04 | NA |
| 2. P | P55950 | Metallothionein-2B | 8.75e-01 | 2.88e-03 | NA |
| 2. P | P06675 | Zein-alpha 19B1 | 1.37e-02 | 3.43e-02 | NA |
| 2. P | Q9BYR9 | Keratin-associated protein 2-4 | 8.31e-01 | 2.88e-03 | NA |
| 2. P | P02443 | Keratin, high-sulfur matrix protein, IIIA3A | 9.25e-01 | 1.57e-02 | NA |
| 2. P | O70562 | Small proline-rich protein 2K | 5.53e-01 | 5.62e-03 | NA |
| 2. P | P22531 | Small proline-rich protein 2E | 3.66e-01 | 2.14e-04 | NA |
| 2. P | Q52LG2 | Keratin-associated protein 13-2 | 9.95e-01 | 4.18e-05 | NA |
| 2. P | Q96RM1 | Small proline-rich protein 2F | 3.51e-01 | 7.40e-07 | NA |
| 2. P | Q8YUS9 | Gas vesicle protein C | 2.52e-04 | 8.98e-03 | NA |
| 2. P | P35325 | Small proline-rich protein 2B | 3.46e-01 | 4.63e-04 | NA |
| 2. P | P07786 | Small, acid-soluble spore protein gamma-type | 5.49e-03 | 2.39e-02 | NA |
| 2. P | Q40561 | Proteinase inhibitor type-2 | 2.03e-01 | 7.15e-03 | NA |
| 2. P | Q02400 | Late embryogenesis abundant protein B19.3 | 9.14e-03 | 2.01e-03 | NA |
| 2. P | Q4W7H1 | Keratin-associated protein 13-4 | 9.83e-01 | 2.07e-04 | NA |
| 2. P | Q8IUC0 | Keratin-associated protein 13-1 | 9.88e-01 | 5.44e-06 | NA |
| 2. P | P26907 | Glucose starvation-inducible protein B | 3.73e-03 | 3.67e-02 | NA |
| 2. P | Q3LHN0 | Keratin-associated protein 25-1 | 8.70e-01 | 4.60e-02 | NA |
| 2. P | Q4KL71 | Small proline-rich protein 2A3 | 6.81e-01 | 1.23e-06 | NA |
| 2. P | P08041 | Gas vesicle protein C | 7.29e-04 | 2.81e-02 | NA |
| 2. P | Q925H2 | Keratin-associated protein 19-1 | 8.78e-01 | 7.62e-05 | NA |
| 2. P | P60329 | Keratin-associated protein 12-4 | 6.86e-01 | 1.40e-07 | NA |
| 2. P | P80247 | Metallothionein 10-II | 9.30e-01 | 5.51e-03 | NA |
| 2. P | Q36736 | Kinetoplastid membrane protein 11 | 7.70e-04 | 1.17e-02 | NA |
| 2. P | P35321 | Cornifin-A | 5.90e-01 | 4.90e-05 | NA |
| 2. P | P22532 | Small proline-rich protein 2D | 3.61e-01 | 1.15e-05 | NA |
| 2. P | P35324 | Cornifin alpha | 9.65e-01 | 7.08e-03 | NA |
| 2. P | P35323 | Cornifin | 9.19e-01 | 1.53e-06 | NA |
| 3. B | Q65169 | Protein B602L | NA | NA | 0.030 |
| 3. B | Q8I335 | Translation factor GUF1 homolog, mitochondrial | 8.86e-01 | NA | 0.008 |
| 3. B | Q5UQ88 | Probable ubiquitin-conjugating enzyme E2 R521 | NA | NA | 0.009 |