Summary

Q5T8I3

Homolog: Q78T81.
Function: Protein FAM102A.

Statistics

Total GO Annotation: 63
Unique PROST Go: 61
Unique BLAST Go: 1

Total Homologs: 37
Unique PROST Homologs: 31
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q78T81 (Protein FAM102A) with a FATCAT P-Value: 7.8e-10 and RMSD of 2.61 angstrom. The sequence alignment identity is 58.9%.
Structural alignment shown in left. Query protein Q5T8I3 colored as red in alignment, homolog Q78T81 colored as blue. Query protein Q5T8I3 is also shown in right top, homolog Q78T81 showed in right bottom. They are colored based on secondary structures. 

  Q5T8I3 ---MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKL 97
  Q78T81 MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKL 100

  Q5T8I3 GFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGET----------L------KVH 181
  Q78T81 GFTDLNLAEFAGSGSTVRCCLLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTPPSTAKSISIPGQDSSLQLTCKGGGTSSGGSSSTNSLTGSRPPKTR 200

  Q5T8I3 ---L--GIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTST-GVESILE-PCDEIEQKIAEPNLDTADKEDT 274
  Q78T81 PTILGSGLPEEPDQSLSSPEEVFHSGHSRNSSYASQQSKLSGYSTEHSRSSSLSDLTHRRNTSTSSSASGGLSMAVEGP-EGMERE-HRP----SEKPPR 294

  Q5T8I3 ASEKLSRC--PV---------KQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLD-SSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR- 360
  Q78T81 PPEKPPRPPRPLHLSDRSFRRKKDSVESHPTWVDDTRIDADDIVEKIMQSQDFT-DGSNTEDSNLRLFVSRDGSTTLSGIQLGNRVSSGVYEPVVIESH 392

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0008289 lipid binding
2. P GO:0009637 response to blue light
2. P GO:0031307 integral component of mitochondrial outer membrane
2. P GO:0097224 sperm connecting piece
2. P GO:0009787 regulation of abscisic acid-activated signaling pathway
2. P GO:0031396 regulation of protein ubiquitination
2. P GO:0006337 nucleosome disassembly
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0030154 cell differentiation
2. P GO:0030048 actin filament-based movement
2. P GO:0044697 HICS complex
2. P GO:0030136 clathrin-coated vesicle
2. P GO:0061245 establishment or maintenance of bipolar cell polarity
2. P GO:0051285 cell cortex of cell tip
2. P GO:0007283 spermatogenesis
2. P GO:0034497 protein localization to phagophore assembly site
2. P GO:0000326 protein storage vacuole
2. P GO:0032027 myosin light chain binding
2. P GO:0120105 mitotic actomyosin contractile ring, intermediate layer
2. P GO:0110085 mitotic actomyosin contractile ring
2. P GO:0016573 histone acetylation
2. P GO:0000142 cellular bud neck contractile ring
2. P GO:1990344 secondary cell septum biogenesis
2. P GO:0031022 nuclear migration along microfilament
2. P GO:0005829 cytosol
2. P GO:0051276 chromosome organization
2. P GO:0051666 actin cortical patch localization
2. P GO:0098780 response to mitochondrial depolarisation
2. P GO:0032586 protein storage vacuole membrane
2. P GO:0019898 extrinsic component of membrane
2. P GO:0034727 piecemeal microautophagy of the nucleus
2. P GO:0005780 extrinsic component of intraperoxisomal membrane
2. P GO:0000407 phagophore assembly site
2. P GO:0071211 protein targeting to vacuole involved in autophagy
2. P GO:0045033 peroxisome inheritance
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0015031 protein transport
2. P GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering
2. P GO:0019887 protein kinase regulator activity
2. P GO:0015914 phospholipid transport
2. P GO:0006623 protein targeting to vacuole
2. P GO:0032865 ERMES complex
2. P GO:0044458 motile cilium assembly
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:0000423 mitophagy
2. P GO:1902265 abscisic acid homeostasis
2. P GO:0006970 response to osmotic stress
2. P GO:0071255 Cvt vesicle assembly
2. P GO:0044805 late nucleophagy
2. P GO:0051286 cell tip
2. P GO:0007032 endosome organization
2. P GO:1990274 mitotic actomyosin contractile ring disassembly
2. P GO:0010029 regulation of seed germination
2. P GO:0001881 receptor recycling
2. P GO:0032147 activation of protein kinase activity
2. P GO:0000045 autophagosome assembly
2. P GO:0009902 chloroplast relocation
2. P GO:0032154 cleavage furrow
2. P GO:1990316 Atg1/ULK1 kinase complex
2. P GO:0106006 cytoskeletal protein-membrane anchor activity
2. P GO:0000002 mitochondrial genome maintenance
2. P GO:1902406 mitotic actomyosin contractile ring maintenance
3. B GO:0005938 cell cortex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O60082 Uncharacterized protein C1494.08c 2.32e-04 2.93e-12 0.032
1. PB Q6GNM6 Protein FAM102A 4.47e-08 9.76e-54 5.57e-128
1. PB Q78T81 Protein FAM102A 7.80e-10 2.77e-52 2.58e-130
1. PB Q5T9C2 Protein FAM102A 3.10e-07 2.09e-50 1.33e-128
1. PB Q8BQS4 Protein FAM102B 8.78e-08 2.09e-40 0.0
1. PB Q5T8I3 Protein FAM102B 0 7.22e-145 0.0
2. P Q3U6K5 Spermatogenesis-associated protein 6 1.70e-02 3.12e-08 NA
2. P F4J8V5 Autophagy-related protein 13b 1.66e-01 9.13e-04 NA
2. P Q6CL25 Inheritance of peroxisomes protein 1 3.20e-01 2.83e-02 NA
2. P W1QCN1 Autophagy-related protein 13 5.09e-01 2.35e-03 NA
2. P Q9C8E6 Protein PLASTID MOVEMENT IMPAIRED 1 9.46e-03 3.95e-06 NA
2. P O36019 Autophagy protein 13 6.39e-01 1.51e-04 NA
2. P A7KAM4 Autophagy-related protein 13 8.01e-01 1.97e-02 NA
2. P Q9NWH7 Spermatogenesis-associated protein 6 1.08e-02 1.09e-07 NA
2. P Q6ICG6 Uncharacterized protein KIAA0930 1.01e-01 1.89e-04 NA
2. P Q8BH49 Sesquipedalian-1 5.16e-01 1.13e-02 NA
2. P P53901 Ingression protein 1 4.06e-03 5.47e-11 NA
2. P Q53TS8 C2 calcium-dependent domain-containing protein 6 1.45e-01 4.55e-09 NA
2. P A5DQA8 Autophagy-related protein 13 3.67e-01 4.14e-02 NA
2. P Q8SRM1 Histone chaperone ASF1 2.18e-01 2.52e-03 NA
2. P Q6AYJ3 Spermatogenesis associated 6-like protein 2.17e-02 5.05e-09 NA
2. P Q2KJG1 Spermatogenesis-associated protein 6 1.53e-02 1.24e-07 NA
2. P A5A6N3 Autophagy-related protein 13 4.08e-01 1.81e-03 NA
2. P Q1E891 Autophagy-related protein 13 8.00e-01 3.54e-03 NA
2. P A7KAJ8 Autophagy-related protein 13 4.08e-01 1.55e-03 NA
2. P P34379 Autophagy-related protein 13 homolog 2.81e-01 2.24e-03 NA
2. P O94701 Ingression protein fic1 1.36e-04 5.26e-12 NA
2. P Q8N4H0 Spermatogenesis associated 6-like protein 1.76e-02 3.71e-15 NA
2. P P38177 Uncharacterized protein YBL086C 6.98e-02 2.66e-18 NA
2. P Q08DY8 Autophagy-related protein 13 1.28e-01 6.27e-03 NA
2. P O04023 Protein SRC2 homolog 9.37e-05 6.21e-03 NA
2. P Q2UM46 Probable HECT-type ubiquitin ligase-interacting protein creD 2.29e-01 4.22e-02 NA
2. P Q6FSJ9 Autophagy-related protein 13 6.09e-01 5.36e-03 NA
2. P Q5BBM5 Mitochondrial distribution and morphology protein 34 3.32e-01 4.63e-02 NA
2. P Q801S4 Uncharacterized protein KIAA0930 homolog 5.20e-02 7.66e-04 NA
2. P C5FRB0 Mitochondrial distribution and morphology protein 34 2.36e-01 2.00e-02 NA
2. P Q99MU5 Spermatogenesis-associated protein 6 1.77e-01 8.33e-09 NA