Summary

Q5T953

Homolog: Q99J55.
Function: Immediate early response gene 5-like protein.

Statistics

Total GO Annotation: 71
Unique PROST Go: 55
Unique BLAST Go: 9

Total Homologs: 39
Unique PROST Homologs: 27
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q99J55 (Immediate early response gene 5-like protein) with a FATCAT P-Value: 7.79e-08 and RMSD of 5.72 angstrom. The sequence alignment identity is 93.2%.
Structural alignment shown in left. Query protein Q5T953 colored as red in alignment, homolog Q99J55 colored as blue. Query protein Q5T953 is also shown in right top, homolog Q99J55 showed in right bottom. They are colored based on secondary structures. 

  Q5T953 MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDA 100
  Q99J55 MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDA 100

  Q5T953 EAREPAARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCAAA---AAAGAPAGGAGALSELPGCAALQPPHGAPHRGQPLEPLQPGPAPLPLPLPPPAPAAL 197
  Q99J55 EAREPVARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCTAAAPVAVAGAPAGCAGALSELPGCAALQPPHGAPHRGQHLEPLQPGPA----PLPPPAPAAL 196

  Q5T953 CPRDPRAPAACSAP---PGAAP-PAAAASPPASPAPASSPGFYRGAYPTPSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPG 293
  Q99J55 CPRDPRVPAACSAPSVLPGAAPSTVAASSPPASTAPSSSTGFYRGAYPAPSDFGVHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPG 296

  Q5T953 LASAAGCKRKYYPGQEEEEDDEEDAGGLGAEPPGGAPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS 393
  Q99J55 LASAAGCKRKYYPGQ-EEEDDEEDAGDLGAEPPGGTPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS 395

  Q5T953 LGAWTRAIVAF 404
  Q99J55 LGAWTRAIVAF 406

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0042127 regulation of cell population proliferation
1. PB GO:0045944 positive regulation of transcription by RNA polymerase II
1. PB GO:1900036 positive regulation of cellular response to heat
1. PB GO:0000159 protein phosphatase type 2A complex
1. PB GO:0005634 nucleus
1. PB GO:0042802 identical protein binding
1. PB GO:0034605 cellular response to heat
2. P GO:0005522 profilin binding
2. P GO:0007281 germ cell development
2. P GO:0080092 regulation of pollen tube growth
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0007530 sex determination
2. P GO:0035282 segmentation
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0016199 axon midline choice point recognition
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter
2. P GO:1990837 sequence-specific double-stranded DNA binding
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0009741 response to brassinosteroid
2. P GO:0008154 actin polymerization or depolymerization
2. P GO:0010865 stipule development
2. P GO:0009742 brassinosteroid mediated signaling pathway
2. P GO:0007485 imaginal disc-derived male genitalia development
2. P GO:0048086 negative regulation of developmental pigmentation
2. P GO:0019827 stem cell population maintenance
2. P GO:0018993 somatic sex determination
2. P GO:0046661 male sex differentiation
2. P GO:0040008 regulation of growth
2. P GO:0007141 male meiosis I
2. P GO:1900111 positive regulation of histone H3-K9 dimethylation
2. P GO:0001741 XY body
2. P GO:0003700 DNA-binding transcription factor activity
2. P GO:0045433 male courtship behavior, veined wing generated song production
2. P GO:0010482 regulation of epidermal cell division
2. P GO:0007619 courtship behavior
2. P GO:0090406 pollen tube
2. P GO:0045498 sex comb development
2. P GO:0003712 transcription coregulator activity
2. P GO:0009860 pollen tube growth
2. P GO:0046660 female sex differentiation
2. P GO:0046872 metal ion binding
2. P GO:0099402 plant organ development
2. P GO:0035215 genital disc development
2. P GO:0008049 male courtship behavior
2. P GO:0007486 imaginal disc-derived female genitalia development
2. P GO:0070358 actin polymerization-dependent cell motility
2. P GO:0036033 mediator complex binding
2. P GO:0045497 female analia development
2. P GO:0009943 adaxial/abaxial axis specification
2. P GO:0016592 mediator complex
2. P GO:0006351 transcription, DNA-templated
2. P GO:0009947 centrolateral axis specification
2. P GO:1900114 positive regulation of histone H3-K9 trimethylation
2. P GO:0007521 muscle cell fate determination
2. P GO:0007548 sex differentiation
2. P GO:0007290 spermatid nucleus elongation
2. P GO:0048071 sex-specific pigmentation
2. P GO:0019101 female somatic sex determination
2. P GO:0050699 WW domain binding
2. P GO:0048235 pollen sperm cell differentiation
2. P GO:0045496 male analia development
2. P GO:0003677 DNA binding
3. B GO:0007368 determination of left/right symmetry
3. B GO:0030182 neuron differentiation
3. B GO:0005730 nucleolus
3. B GO:0070121 Kupffer's vesicle development
3. B GO:0071774 response to fibroblast growth factor
3. B GO:0060271 cilium assembly
3. B GO:0060026 convergent extension
3. B GO:0048870 cell motility
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q99J55 Immediate early response gene 5-like protein 7.79e-08 1.03e-96 0.0
1. PB Q6PBC9 Immediate early response gene 5-like protein 2.57e-02 5.82e-13 3.99e-45
1. PB Q5T953 Immediate early response gene 5-like protein 0 7.38e-165 0.0
1. PB Q6NYT3 Immediate early response gene 5-like protein 2.91e-03 6.20e-09 1.12e-48
1. PB Q5VY09 Immediate early response gene 5 protein 1.31e-02 1.75e-11 1.21e-14
1. PB Q5PQP0 Immediate early response gene 5-like protein 9.69e-07 3.04e-108 0.0
1. PB Q66IT9 Immediate early response gene 5-like protein 7.10e-03 3.42e-08 9.32e-32
1. PB O89113 Immediate early response gene 5 protein 1.48e-03 4.60e-14 7.65e-15
2. P O46234 Protein hunchback (Fragments) 3.86e-01 1.39e-02 NA
2. P Q8CGW9 Doublesex- and mab-3-related transcription factor C2 8.50e-02 3.16e-04 NA
2. P O46232 Protein hunchback (Fragments) 4.81e-01 3.16e-02 NA
2. P O46256 Protein hunchback (Fragments) 9.31e-02 4.62e-02 NA
2. P Q96RN5 Mediator of RNA polymerase II transcription subunit 15 4.52e-02 2.67e-03 NA
2. P O46236 Protein hunchback (Fragments) 1.72e-01 6.99e-04 NA
2. P O46254 Protein hunchback (Fragments) 2.27e-01 1.66e-02 NA
2. P Q924H2 Mediator of RNA polymerase II transcription subunit 15 2.67e-02 2.78e-02 NA
2. P O46244 Protein hunchback (Fragments) 4.03e-01 4.57e-02 NA
2. P P23023 Protein doublesex 8.19e-02 9.55e-03 NA
2. P Q6S3I3 WUSCHEL-related homeobox 3B 6.42e-02 1.92e-05 NA
2. P O46258 Protein hunchback (Fragments) 6.74e-01 1.54e-04 NA
2. P Q70UV1 WUSCHEL-related homeobox 3A 5.07e-02 4.11e-02 NA
2. P Q6EUF1 Protein BZR1 homolog 4 6.20e-01 2.41e-03 NA
2. P O46238 Protein hunchback (Fragments) 1.22e-01 3.02e-04 NA
2. P B8B7S5 Protein BZR1 homolog 1 1.51e-01 4.48e-02 NA
2. P P22807 Homeobox protein slou 2.51e-01 5.87e-04 NA
2. P Q8IXT2 Doublesex- and mab-3-related transcription factor C2 4.57e-02 3.42e-02 NA
2. P Q7XI96 Protein BZR1 homolog 1 1.13e-01 4.48e-02 NA
2. P Q94FL7 Transcription factor MYB120 3.47e-01 5.84e-03 NA
2. P O46248 Protein hunchback (Fragments) 2.11e-01 1.51e-03 NA
2. P Q9SIB4 WUSCHEL-related homeobox 3 6.06e-02 4.07e-02 NA
2. P Q9Y808 Mediator of RNA polymerase II transcription subunit 15 1.12e-01 1.37e-02 NA
2. P O46260 Protein hunchback (Fragments) 2.01e-01 1.46e-02 NA
2. P Q8N8S7 Protein enabled homolog 8.50e-03 1.68e-02 NA
2. P Q94A43 BES1/BZR1 homolog protein 2 3.59e-01 1.20e-02 NA
2. P O46250 Protein hunchback (Fragments) 7.24e-02 1.11e-02 NA
3. B Q6P7D3 Immediate early response gene 2 protein 1.57e-01 NA 9.19e-09
3. B B7SXM5 Immediate early response gene 2 protein 1.90e-01 NA 1.71e-06
3. B Q9BTL4 Immediate early response gene 2 protein 4.90e-02 NA 3.98e-09
3. B P17950 Immediate early response gene 2 protein 1.56e-01 NA 2.12e-08