Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q99J55
(Immediate early response gene 5-like protein) with a FATCAT P-Value: 7.79e-08 and RMSD of 5.72 angstrom. The sequence alignment identity is 93.2%.
Structural alignment shown in left. Query protein Q5T953 colored as red in alignment, homolog Q99J55 colored as blue.
Query protein Q5T953 is also shown in right top, homolog Q99J55 showed in right bottom. They are colored based on secondary structures.
Q5T953 MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDA 100 Q99J55 MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDA 100 Q5T953 EAREPAARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCAAA---AAAGAPAGGAGALSELPGCAALQPPHGAPHRGQPLEPLQPGPAPLPLPLPPPAPAAL 197 Q99J55 EAREPVARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCTAAAPVAVAGAPAGCAGALSELPGCAALQPPHGAPHRGQHLEPLQPGPA----PLPPPAPAAL 196 Q5T953 CPRDPRAPAACSAP---PGAAP-PAAAASPPASPAPASSPGFYRGAYPTPSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPG 293 Q99J55 CPRDPRVPAACSAPSVLPGAAPSTVAASSPPASTAPSSSTGFYRGAYPAPSDFGVHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPG 296 Q5T953 LASAAGCKRKYYPGQEEEEDDEEDAGGLGAEPPGGAPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS 393 Q99J55 LASAAGCKRKYYPGQ-EEEDDEEDAGDLGAEPPGGTPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS 395 Q5T953 LGAWTRAIVAF 404 Q99J55 LGAWTRAIVAF 406
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0042127 | regulation of cell population proliferation |
| 1. PB | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 1. PB | GO:1900036 | positive regulation of cellular response to heat |
| 1. PB | GO:0000159 | protein phosphatase type 2A complex |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0034605 | cellular response to heat |
| 2. P | GO:0005522 | profilin binding |
| 2. P | GO:0007281 | germ cell development |
| 2. P | GO:0080092 | regulation of pollen tube growth |
| 2. P | GO:0006357 | regulation of transcription by RNA polymerase II |
| 2. P | GO:0007530 | sex determination |
| 2. P | GO:0035282 | segmentation |
| 2. P | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 2. P | GO:0016199 | axon midline choice point recognition |
| 2. P | GO:0060261 | positive regulation of transcription initiation from RNA polymerase II promoter |
| 2. P | GO:1990837 | sequence-specific double-stranded DNA binding |
| 2. P | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 2. P | GO:0009741 | response to brassinosteroid |
| 2. P | GO:0008154 | actin polymerization or depolymerization |
| 2. P | GO:0010865 | stipule development |
| 2. P | GO:0009742 | brassinosteroid mediated signaling pathway |
| 2. P | GO:0007485 | imaginal disc-derived male genitalia development |
| 2. P | GO:0048086 | negative regulation of developmental pigmentation |
| 2. P | GO:0019827 | stem cell population maintenance |
| 2. P | GO:0018993 | somatic sex determination |
| 2. P | GO:0046661 | male sex differentiation |
| 2. P | GO:0040008 | regulation of growth |
| 2. P | GO:0007141 | male meiosis I |
| 2. P | GO:1900111 | positive regulation of histone H3-K9 dimethylation |
| 2. P | GO:0001741 | XY body |
| 2. P | GO:0003700 | DNA-binding transcription factor activity |
| 2. P | GO:0045433 | male courtship behavior, veined wing generated song production |
| 2. P | GO:0010482 | regulation of epidermal cell division |
| 2. P | GO:0007619 | courtship behavior |
| 2. P | GO:0090406 | pollen tube |
| 2. P | GO:0045498 | sex comb development |
| 2. P | GO:0003712 | transcription coregulator activity |
| 2. P | GO:0009860 | pollen tube growth |
| 2. P | GO:0046660 | female sex differentiation |
| 2. P | GO:0046872 | metal ion binding |
| 2. P | GO:0099402 | plant organ development |
| 2. P | GO:0035215 | genital disc development |
| 2. P | GO:0008049 | male courtship behavior |
| 2. P | GO:0007486 | imaginal disc-derived female genitalia development |
| 2. P | GO:0070358 | actin polymerization-dependent cell motility |
| 2. P | GO:0036033 | mediator complex binding |
| 2. P | GO:0045497 | female analia development |
| 2. P | GO:0009943 | adaxial/abaxial axis specification |
| 2. P | GO:0016592 | mediator complex |
| 2. P | GO:0006351 | transcription, DNA-templated |
| 2. P | GO:0009947 | centrolateral axis specification |
| 2. P | GO:1900114 | positive regulation of histone H3-K9 trimethylation |
| 2. P | GO:0007521 | muscle cell fate determination |
| 2. P | GO:0007548 | sex differentiation |
| 2. P | GO:0007290 | spermatid nucleus elongation |
| 2. P | GO:0048071 | sex-specific pigmentation |
| 2. P | GO:0019101 | female somatic sex determination |
| 2. P | GO:0050699 | WW domain binding |
| 2. P | GO:0048235 | pollen sperm cell differentiation |
| 2. P | GO:0045496 | male analia development |
| 2. P | GO:0003677 | DNA binding |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0030182 | neuron differentiation |
| 3. B | GO:0005730 | nucleolus |
| 3. B | GO:0070121 | Kupffer's vesicle development |
| 3. B | GO:0071774 | response to fibroblast growth factor |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:0060026 | convergent extension |
| 3. B | GO:0048870 | cell motility |
| 3. B | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q99J55 | Immediate early response gene 5-like protein | 7.79e-08 | 1.03e-96 | 0.0 |
| 1. PB | Q6PBC9 | Immediate early response gene 5-like protein | 2.57e-02 | 5.82e-13 | 3.99e-45 |
| 1. PB | Q5T953 | Immediate early response gene 5-like protein | 0 | 7.38e-165 | 0.0 |
| 1. PB | Q6NYT3 | Immediate early response gene 5-like protein | 2.91e-03 | 6.20e-09 | 1.12e-48 |
| 1. PB | Q5VY09 | Immediate early response gene 5 protein | 1.31e-02 | 1.75e-11 | 1.21e-14 |
| 1. PB | Q5PQP0 | Immediate early response gene 5-like protein | 9.69e-07 | 3.04e-108 | 0.0 |
| 1. PB | Q66IT9 | Immediate early response gene 5-like protein | 7.10e-03 | 3.42e-08 | 9.32e-32 |
| 1. PB | O89113 | Immediate early response gene 5 protein | 1.48e-03 | 4.60e-14 | 7.65e-15 |
| 2. P | O46234 | Protein hunchback (Fragments) | 3.86e-01 | 1.39e-02 | NA |
| 2. P | Q8CGW9 | Doublesex- and mab-3-related transcription factor C2 | 8.50e-02 | 3.16e-04 | NA |
| 2. P | O46232 | Protein hunchback (Fragments) | 4.81e-01 | 3.16e-02 | NA |
| 2. P | O46256 | Protein hunchback (Fragments) | 9.31e-02 | 4.62e-02 | NA |
| 2. P | Q96RN5 | Mediator of RNA polymerase II transcription subunit 15 | 4.52e-02 | 2.67e-03 | NA |
| 2. P | O46236 | Protein hunchback (Fragments) | 1.72e-01 | 6.99e-04 | NA |
| 2. P | O46254 | Protein hunchback (Fragments) | 2.27e-01 | 1.66e-02 | NA |
| 2. P | Q924H2 | Mediator of RNA polymerase II transcription subunit 15 | 2.67e-02 | 2.78e-02 | NA |
| 2. P | O46244 | Protein hunchback (Fragments) | 4.03e-01 | 4.57e-02 | NA |
| 2. P | P23023 | Protein doublesex | 8.19e-02 | 9.55e-03 | NA |
| 2. P | Q6S3I3 | WUSCHEL-related homeobox 3B | 6.42e-02 | 1.92e-05 | NA |
| 2. P | O46258 | Protein hunchback (Fragments) | 6.74e-01 | 1.54e-04 | NA |
| 2. P | Q70UV1 | WUSCHEL-related homeobox 3A | 5.07e-02 | 4.11e-02 | NA |
| 2. P | Q6EUF1 | Protein BZR1 homolog 4 | 6.20e-01 | 2.41e-03 | NA |
| 2. P | O46238 | Protein hunchback (Fragments) | 1.22e-01 | 3.02e-04 | NA |
| 2. P | B8B7S5 | Protein BZR1 homolog 1 | 1.51e-01 | 4.48e-02 | NA |
| 2. P | P22807 | Homeobox protein slou | 2.51e-01 | 5.87e-04 | NA |
| 2. P | Q8IXT2 | Doublesex- and mab-3-related transcription factor C2 | 4.57e-02 | 3.42e-02 | NA |
| 2. P | Q7XI96 | Protein BZR1 homolog 1 | 1.13e-01 | 4.48e-02 | NA |
| 2. P | Q94FL7 | Transcription factor MYB120 | 3.47e-01 | 5.84e-03 | NA |
| 2. P | O46248 | Protein hunchback (Fragments) | 2.11e-01 | 1.51e-03 | NA |
| 2. P | Q9SIB4 | WUSCHEL-related homeobox 3 | 6.06e-02 | 4.07e-02 | NA |
| 2. P | Q9Y808 | Mediator of RNA polymerase II transcription subunit 15 | 1.12e-01 | 1.37e-02 | NA |
| 2. P | O46260 | Protein hunchback (Fragments) | 2.01e-01 | 1.46e-02 | NA |
| 2. P | Q8N8S7 | Protein enabled homolog | 8.50e-03 | 1.68e-02 | NA |
| 2. P | Q94A43 | BES1/BZR1 homolog protein 2 | 3.59e-01 | 1.20e-02 | NA |
| 2. P | O46250 | Protein hunchback (Fragments) | 7.24e-02 | 1.11e-02 | NA |
| 3. B | Q6P7D3 | Immediate early response gene 2 protein | 1.57e-01 | NA | 9.19e-09 |
| 3. B | B7SXM5 | Immediate early response gene 2 protein | 1.90e-01 | NA | 1.71e-06 |
| 3. B | Q9BTL4 | Immediate early response gene 2 protein | 4.90e-02 | NA | 3.98e-09 |
| 3. B | P17950 | Immediate early response gene 2 protein | 1.56e-01 | NA | 2.12e-08 |