Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q640L5
(Coiled-coil domain-containing protein 18) with a FATCAT P-Value: 1.7e-12 and RMSD of 15.12 angstrom. The sequence alignment identity is 84.2%.
Structural alignment shown in left. Query protein Q5T9S5 colored as red in alignment, homolog Q640L5 colored as blue.
Query protein Q5T9S5 is also shown in right top, homolog Q640L5 showed in right bottom. They are colored based on secondary structures.
Q5T9S5 MESSSSDYYNK--DNEEESLLANVASLRHELKITEWSLQSLGEELSSVSPSENSDYAPNPSRSEKLILD--VQPSHPGLLNYSPYENVCKISGSSTDFQK 96 Q640L5 MEFISSDYCTKDNDNEEESLLANVASLRHELKITEWSLHNLGEELSSVSPSENSEYVCSPSRSERLILEELTQPSHLGRLIYPPYKKVCKTS-DSTDYQK 99 Q5T9S5 KPRDKMFSSSAPVDQEIKSLREKLNKLRQQNACLVTQNHSLMTKFESIHFELTQSRAKVSMLESAQQQAASVPILEEQIINLEAEVSAQDKVLREAENKL 196 Q640L5 KSRDQVSFSSVSMDQEVKNLREKLHKLRQQNACLVTQNHSLMTKIESVHFELTQSKAKIAMLESAQEQAANIPILEEQIINLEAEVSAQDKVLREAEDKL 199 Q5T9S5 EQSQKMVIEKEQSLQESKEECIKLKVDLLEQTKQGKRAERQRNEALYNAEELSKAFQQYKKKVAEKLEKVQAEEEILERNLTNCEKENKRLQERCGLYKS 296 Q640L5 EQSQKMVIEKEHSLQEAKEECIKLKVDLLEQSKQGKRAERQRNEALYNAEELSKAFQLYKEKVAEKLEKVQDEEEILERNLSNCEKENKRLQEKCNLYKS 299 Q5T9S5 ELEILKEKLRQLKEENNNGKEKLRIMAVKNSEVMAQLTESRQSILKLESELENKDEILRDKFSLMNENRELKVRVAAQNERLDLCQQEIESSRVELRSLE 396 Q640L5 ELEILKEKFRELKEEHYSGKEKLMIMAMKNSEVMSQLTESRQCILKLERELEDKDEIVREKFSLLNENRELKVRVATQNERLELCQQDIDNSRVELKSLE 399 Q5T9S5 KIISQLPLKRELFGFKSYLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQESSKLSSLETEPVKLGGH 496 Q640L5 KLITQIPLKREIVGFRSSLCKHQRSSVSDKEDKCIGCCEANKLMISELRIKLAIREAEIQKLHANLTVNQLSQNV--ANDSQECGKVNTLETEPVKLGGS 497 Q5T9S5 QVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKIVAYSS 596 Q640L5 QVESIKDGDQQTVNKQYEREKQRLATGIEELRAKLTQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNASKLENEMTKKCSQLLILEKQLEEKIIAYSS 597 Q5T9S5 IAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLEKKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTES 696 Q640L5 IAAKNAELEQELMEKNEKIRSLESNINTEHEKICFAFEKAKKIHLEQHKEMEKQIEQLETQLEKRDQQFKEQEKTMSILQQDILCKQHHLESLDRLLTES 697 Q5T9S5 KGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNKEKFEKQLKKKSEEVYCLQKELKIKNHSLQETSEQNVILQHTLQQQQ 796 Q640L5 KVEMEKENMKKDEALKALQIHVSEETIKVRQLDSALEICKEELALHLNQLERNKEKFERQLKKKSEEVYCLQKELKIKTHNLEETSEQNAILQHTLQQQQ 797 Q5T9S5 QMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRKMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGEN 896 Q640L5 QMLQQETMRNGELEDTQSKLEKQVSKQEQELQKQRESSTEKLRKMEEKYETAIREVDLKRQKIIELTGTARQAKLEMDQYKEELSKMEKEIIHLKRDGEN 897 Q5T9S5 KAMHLSQLDMILDQTKTELEKKTNAVKELEKLQHSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECK 996 Q640L5 KSMQLSQLDMVLDQTKTELEKTTNSVKELERLQHHTETELTETMQKREALENELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECK 997 Q5T9S5 MEIEDKKQELLEMDQALKERNWELKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQ 1096 Q640L5 MEIEDKKQELIEMDQALKERNWELKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQVESLNEKLQNAKEQLREKEFIMLQNEQEISQ 1097 Q5T9S5 LKKEIERTQQRMKEMESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASK 1196 Q640L5 LKKEIERTQQRMKEMESVIKEQEDYIATQYKEVIDLGQELRLTQEQMQNTHSELVEARRQEVQAQREIERLAGELEDIKQLSKEKEAHGNRLAEELGASQ 1197 Q5T9S5 VREAHLEARMQAEIKKLSAEVESLKEAYHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANEALLTKES 1296 Q640L5 VREAHLEARMQAEIKKLSSEVDSLKEAYQIEMISHQENHAKWKLSAESQKTSVQQLNEQLEKAKQELEEAQDTVSNLHQQVQDRNEVIEAANEALLIKES 1297 Q5T9S5 ELTRLQAKISGHEKAEDIKFLPAPFTSPTEIMPDVQDPKFAKCFHTSFS--KCTKLRRSISASDLTFKIHGDEDLSEELLQDLKKMQLEQPSTLEESHKN 1394 Q640L5 ELTRLQAKISGHEKTEDTKYLPAPFTTLTEIIPDSQHPNFAK--HSQISLFKCRKLRRSISASDLSFKSHGNDDLSEELLQDLKKMQFEQTSAIESGHKD 1395 Q5T9S5 LTYTQPDSFKPLTYNLEADSSENNDFNTLSGMLRYINKEVRLLKKSSMQTGAGLNQGENV 1454 Q640L5 LPLTHSESFKPLPYNLEDDSSESNDFSTLSGMLRYINKEVRLLKKSSLQTATGLSQGGKL 1455
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0000139 | Golgi membrane |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0005856 | cytoskeleton |
| 2. P | GO:0097539 | ciliary transition fiber |
| 2. P | GO:0070530 | K63-linked polyubiquitin modification-dependent protein binding |
| 2. P | GO:0019904 | protein domain specific binding |
| 2. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 2. P | GO:0051656 | establishment of organelle localization |
| 2. P | GO:0051260 | protein homooligomerization |
| 2. P | GO:0090161 | Golgi ribbon formation |
| 2. P | GO:0034499 | late endosome to Golgi transport |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0005080 | protein kinase C binding |
| 2. P | GO:0051026 | chiasma assembly |
| 2. P | GO:1903251 | multi-ciliated epithelial cell differentiation |
| 2. P | GO:0048786 | presynaptic active zone |
| 2. P | GO:0044615 | nuclear pore nuclear basket |
| 2. P | GO:0048874 | host-mediated regulation of intestinal microbiota composition |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0009101 | glycoprotein biosynthetic process |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0030426 | growth cone |
| 2. P | GO:0071907 | determination of digestive tract left/right asymmetry |
| 2. P | GO:0035092 | sperm DNA condensation |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0007020 | microtubule nucleation |
| 2. P | GO:0090543 | Flemming body |
| 2. P | GO:0048790 | maintenance of presynaptic active zone structure |
| 2. P | GO:0032982 | myosin filament |
| 2. P | GO:0120103 | centriolar subdistal appendage |
| 2. P | GO:0032663 | regulation of interleukin-2 production |
| 2. P | GO:0032680 | regulation of tumor necrosis factor production |
| 2. P | GO:0001673 | male germ cell nucleus |
| 2. P | GO:0097431 | mitotic spindle pole |
| 2. P | GO:0090166 | Golgi disassembly |
| 2. P | GO:0034067 | protein localization to Golgi apparatus |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:0005154 | epidermal growth factor receptor binding |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0051496 | positive regulation of stress fiber assembly |
| 2. P | GO:0051301 | cell division |
| 2. P | GO:0002756 | MyD88-independent toll-like receptor signaling pathway |
| 2. P | GO:0008356 | asymmetric cell division |
| 2. P | GO:0005136 | interleukin-4 receptor binding |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0000802 | transverse filament |
| 2. P | GO:0071910 | determination of liver left/right asymmetry |
| 2. P | GO:0032053 | ciliary basal body organization |
| 2. P | GO:0007283 | spermatogenesis |
| 2. P | GO:0051878 | lateral element assembly |
| 2. P | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 2. P | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 2. P | GO:0071955 | recycling endosome to Golgi transport |
| 2. P | GO:0098998 | extrinsic component of postsynaptic early endosome membrane |
| 2. P | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production |
| 2. P | GO:0042130 | negative regulation of T cell proliferation |
| 2. P | GO:0120229 | protein localization to motile cilium |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0032815 | negative regulation of natural killer cell activation |
| 2. P | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 2. P | GO:0008104 | protein localization |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0036159 | inner dynein arm assembly |
| 2. P | GO:0051649 | establishment of localization in cell |
| 2. P | GO:0005816 | spindle pole body |
| 2. P | GO:0010975 | regulation of neuron projection development |
| 2. P | GO:0005863 | striated muscle myosin thick filament |
| 2. P | GO:0001965 | G-protein alpha-subunit binding |
| 2. P | GO:0042734 | presynaptic membrane |
| 2. P | GO:0001917 | photoreceptor inner segment |
| 2. P | GO:0006412 | translation |
| 2. P | GO:0036126 | sperm flagellum |
| 2. P | GO:0000151 | ubiquitin ligase complex |
| 2. P | GO:0110120 | gamma-tubulin complex localization to nuclear side of mitotic spindle pole body |
| 2. P | GO:1990450 | linear polyubiquitin binding |
| 2. P | GO:0020035 | cytoadherence to microvasculature, mediated by symbiont protein |
| 2. P | GO:1902857 | positive regulation of non-motile cilium assembly |
| 2. P | GO:0002079 | inner acrosomal membrane |
| 2. P | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0008022 | protein C-terminus binding |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0061024 | membrane organization |
| 2. P | GO:0001947 | heart looping |
| 2. P | GO:0043515 | kinetochore binding |
| 2. P | GO:0043621 | protein self-association |
| 2. P | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 2. P | GO:0032148 | activation of protein kinase B activity |
| 2. P | GO:0000242 | pericentriolar material |
| 2. P | GO:0031593 | polyubiquitin modification-dependent protein binding |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0031682 | G-protein gamma-subunit binding |
| 2. P | GO:0030276 | clathrin binding |
| 2. P | GO:0016064 | immunoglobulin mediated immune response |
| 2. P | GO:0120317 | sperm mitochondrial sheath assembly |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0001782 | B cell homeostasis |
| 2. P | GO:0051660 | establishment of centrosome localization |
| 2. P | GO:0097225 | sperm midpiece |
| 2. P | GO:0045742 | positive regulation of epidermal growth factor receptor signaling pathway |
| 2. P | GO:0003146 | heart jogging |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0010669 | epithelial structure maintenance |
| 2. P | GO:0042803 | protein homodimerization activity |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0030031 | cell projection assembly |
| 2. P | GO:0051289 | protein homotetramerization |
| 2. P | GO:0005969 | serine-pyruvate aminotransferase complex |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:1900017 | positive regulation of cytokine production involved in inflammatory response |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0050862 | positive regulation of T cell receptor signaling pathway |
| 2. P | GO:0098837 | postsynaptic recycling endosome |
| 2. P | GO:0043330 | response to exogenous dsRNA |
| 2. P | GO:0051650 | establishment of vesicle localization |
| 2. P | GO:0000794 | condensed nuclear chromosome |
| 2. P | GO:0061760 | antifungal innate immune response |
| 2. P | GO:0043276 | anoikis |
| 2. P | GO:0030241 | skeletal muscle myosin thick filament assembly |
| 2. P | GO:1902426 | deactivation of mitotic spindle assembly checkpoint |
| 2. P | GO:0003356 | regulation of cilium beat frequency |
| 2. P | GO:0032495 | response to muramyl dipeptide |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0097228 | sperm principal piece |
| 2. P | GO:0000795 | synaptonemal complex |
| 2. P | GO:0032740 | positive regulation of interleukin-17 production |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:0000137 | Golgi cis cisterna |
| 2. P | GO:0005801 | cis-Golgi network |
| 2. P | GO:0099152 | regulation of neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 2. P | GO:1902236 | negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
| 2. P | GO:0051220 | cytoplasmic sequestering of protein |
| 2. P | GO:0007274 | neuromuscular synaptic transmission |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0032147 | activation of protein kinase activity |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0000077 | DNA damage checkpoint signaling |
| 2. P | GO:0034453 | microtubule anchoring |
| 2. P | GO:0048788 | cytoskeleton of presynaptic active zone |
| 2. P | GO:0099041 | vesicle tethering to Golgi |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0098831 | presynaptic active zone cytoplasmic component |
| 2. P | GO:0060050 | positive regulation of protein glycosylation |
| 2. P | GO:0030705 | cytoskeleton-dependent intracellular transport |
| 2. P | GO:0071539 | protein localization to centrosome |
| 2. P | GO:0003413 | chondrocyte differentiation involved in endochondral bone morphogenesis |
| 2. P | GO:0032755 | positive regulation of interleukin-6 production |
| 2. P | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:2000318 | positive regulation of T-helper 17 type immune response |
| 2. P | GO:0001819 | positive regulation of cytokine production |
| 2. P | GO:0055037 | recycling endosome |
| 2. P | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:0098882 | structural constituent of presynaptic active zone |
| 2. P | GO:0045171 | intercellular bridge |
| 2. P | GO:0085032 | modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade |
| 2. P | GO:1902254 | negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:1902440 | protein localization to mitotic spindle pole body |
| 2. P | GO:0030032 | lamellipodium assembly |
| 2. P | GO:0006974 | cellular response to DNA damage stimulus |
| 2. P | GO:0007030 | Golgi organization |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0051645 | Golgi localization |
| 2. P | GO:0042975 | peroxisome proliferator activated receptor binding |
| 2. P | GO:0098535 | de novo centriole assembly involved in multi-ciliated epithelial cell differentiation |
| 2. P | GO:0006622 | protein targeting to lysosome |
| 2. P | GO:0098978 | glutamatergic synapse |
| 2. P | GO:0000711 | meiotic DNA repair synthesis |
| 2. P | GO:0032494 | response to peptidoglycan |
| 2. P | GO:0005815 | microtubule organizing center |
| 2. P | GO:0045184 | establishment of protein localization |
| 2. P | GO:0051315 | attachment of mitotic spindle microtubules to kinetochore |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0031023 | microtubule organizing center organization |
| 2. P | GO:0019901 | protein kinase binding |
| 2. P | GO:0032880 | regulation of protein localization |
| 2. P | GO:0051959 | dynein light intermediate chain binding |
| 2. P | GO:0065003 | protein-containing complex assembly |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:0050700 | CARD domain binding |
| 2. P | GO:0007250 | activation of NF-kappaB-inducing kinase activity |
| 2. P | GO:0005802 | trans-Golgi network |
| 2. P | GO:0005823 | central plaque of spindle pole body |
| 2. P | GO:0007129 | homologous chromosome pairing at meiosis |
| 2. P | GO:0060285 | cilium-dependent cell motility |
| 2. P | GO:0045089 | positive regulation of innate immune response |
| 2. P | GO:0048167 | regulation of synaptic plasticity |
| 2. P | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0010457 | centriole-centriole cohesion |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0090306 | meiotic spindle assembly |
| 2. P | GO:0051298 | centrosome duplication |
| 2. P | GO:0007130 | synaptonemal complex assembly |
| 2. P | GO:1905515 | non-motile cilium assembly |
| 2. P | GO:0061676 | importin-alpha family protein binding |
| 2. P | GO:0090235 | regulation of metaphase plate congression |
| 2. P | GO:0032722 | positive regulation of chemokine production |
| 2. P | GO:0009620 | response to fungus |
| 2. P | GO:0032580 | Golgi cisterna membrane |
| 2. P | GO:0000801 | central element |
| 2. P | GO:1904888 | cranial skeletal system development |
| 2. P | GO:0097729 | 9+2 motile cilium |
| 2. P | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0051225 | spindle assembly |
| 2. P | GO:0030997 | regulation of centriole-centriole cohesion |
| 2. P | GO:0002081 | outer acrosomal membrane |
| 2. P | GO:0097298 | regulation of nucleus size |
| 2. P | GO:0032760 | positive regulation of tumor necrosis factor production |
| 2. P | GO:0072660 | maintenance of protein location in plasma membrane |
| 2. P | GO:0002446 | neutrophil mediated immunity |
| 2. P | GO:0061512 | protein localization to cilium |
| 2. P | GO:0030142 | COPI-coated Golgi to ER transport vesicle |
| 2. P | GO:0070286 | axonemal dynein complex assembly |
| 2. P | GO:0016189 | synaptic vesicle to endosome fusion |
| 2. P | GO:0045162 | clustering of voltage-gated sodium channels |
| 2. P | GO:0007131 | reciprocal meiotic recombination |
| 2. P | GO:0050908 | detection of light stimulus involved in visual perception |
| 2. P | GO:0090660 | cerebrospinal fluid circulation |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:1903003 | positive regulation of protein deubiquitination |
| 2. P | GO:0005092 | GDP-dissociation inhibitor activity |
| 2. P | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 2. P | GO:0006486 | protein glycosylation |
| 2. P | GO:0033365 | protein localization to organelle |
| 2. P | GO:0008385 | IkappaB kinase complex |
| 2. P | GO:0097733 | photoreceptor cell cilium |
| 2. P | GO:0048278 | vesicle docking |
| 2. P | GO:0007099 | centriole replication |
| 2. P | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0035469 | determination of pancreatic left/right asymmetry |
| 2. P | GO:0061966 | establishment of left/right asymmetry |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:0032675 | regulation of interleukin-6 production |
| 2. P | GO:0043422 | protein kinase B binding |
| 2. P | GO:0016459 | myosin complex |
| 2. P | GO:1904781 | positive regulation of protein localization to centrosome |
| 2. P | GO:1903566 | positive regulation of protein localization to cilium |
| 2. P | GO:0042147 | retrograde transport, endosome to Golgi |
| 2. P | GO:0051019 | mitogen-activated protein kinase binding |
| 2. P | GO:1901990 | regulation of mitotic cell cycle phase transition |
| 2. P | GO:0099158 | regulation of recycling endosome localization within postsynapse |
| 2. P | GO:0035686 | sperm fibrous sheath |
| 2. P | GO:0098536 | deuterosome |
| 2. P | GO:0005158 | insulin receptor binding |
| 2. P | GO:0031393 | negative regulation of prostaglandin biosynthetic process |
| 2. P | GO:0016082 | synaptic vesicle priming |
| 2. P | GO:0007159 | leukocyte cell-cell adhesion |
| 2. P | GO:0005798 | Golgi-associated vesicle |
| 2. P | GO:0005822 | inner plaque of spindle pole body |
| 2. P | GO:0048538 | thymus development |
| 2. P | GO:0098982 | GABA-ergic synapse |
| 2. P | GO:0005794 | Golgi apparatus |
| 2. P | GO:0001932 | regulation of protein phosphorylation |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0060271 | cilium assembly |
| 2. P | GO:0007252 | I-kappaB phosphorylation |
| 2. P | GO:1990459 | transferrin receptor binding |
| 2. P | GO:0099635 | voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels |
| 2. P | GO:0043184 | vascular endothelial growth factor receptor 2 binding |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0002755 | MyD88-dependent toll-like receptor signaling pathway |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0031929 | TOR signaling |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0032991 | protein-containing complex |
| 2. P | GO:1904951 | positive regulation of establishment of protein localization |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0061952 | midbody abscission |
| 2. P | GO:0044458 | motile cilium assembly |
| 2. P | GO:0070861 | regulation of protein exit from endoplasmic reticulum |
| 2. P | GO:0032449 | CBM complex |
| 2. P | GO:0044308 | axonal spine |
| 2. P | GO:0042169 | SH2 domain binding |
| 2. P | GO:0042770 | signal transduction in response to DNA damage |
| 2. P | GO:1902017 | regulation of cilium assembly |
| 2. P | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 2. P | GO:0045724 | positive regulation of cilium assembly |
| 2. P | GO:0019905 | syntaxin binding |
| 2. P | GO:1905244 | regulation of modification of synaptic structure |
| 2. P | GO:0017080 | sodium channel regulator activity |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0120219 | subapical part of cell |
| 2. P | GO:0071439 | clathrin complex |
| 2. P | GO:0005654 | nucleoplasm |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0005198 | structural molecule activity |
| 3. B | GO:0048280 | vesicle fusion with Golgi apparatus |
| 3. B | GO:0048211 | Golgi vesicle docking |
| 3. B | GO:0045056 | transcytosis |
| 3. B | GO:0035493 | SNARE complex assembly |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0012507 | ER to Golgi transport vesicle membrane |
| 3. B | GO:0005795 | Golgi stack |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0006886 | intracellular protein transport |
| 3. B | GO:0009908 | flower development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5T9S5 | Coiled-coil domain-containing protein 18 | 0 | 4.57e-164 | 0.0 |
| 1. PB | Q640L5 | Coiled-coil domain-containing protein 18 | 1.70e-12 | 1.21e-75 | 0.0 |
| 1. PB | Q9PW73 | Cytoskeletal protein Sojo | 1.25e-05 | 1.46e-26 | 0.0 |
| 2. P | Q3UPP8 | Centrosomal protein of 63 kDa | 1.40e-04 | 2.53e-03 | NA |
| 2. P | P21249 | Major antigen | 1.53e-03 | 1.12e-06 | NA |
| 2. P | Q86SQ7 | Serologically defined colon cancer antigen 8 | 7.58e-05 | 1.66e-02 | NA |
| 2. P | Q5T655 | Cilia- and flagella-associated protein 58 | 1.99e-06 | 3.67e-03 | NA |
| 2. P | Q62209 | Synaptonemal complex protein 1 | 2.32e-04 | 8.62e-07 | NA |
| 2. P | Q02171 | Paramyosin | 2.49e-04 | 2.84e-05 | NA |
| 2. P | Q9Y6K9 | NF-kappa-B essential modulator | 1.22e-03 | 2.46e-02 | NA |
| 2. P | P75395 | Uncharacterized protein MG269 homolog | 1.29e-02 | 2.99e-02 | NA |
| 2. P | P35415 | Paramyosin, long form | 7.20e-08 | 6.36e-04 | NA |
| 2. P | Q9UTK5 | Nucleoporin alm1 | 7.17e-03 | 5.64e-03 | NA |
| 2. P | Q9D5Y1 | Coiled-coil domain-containing protein 39 | 1.48e-06 | 1.28e-04 | NA |
| 2. P | A9QT41 | NF-kappa-B essential modulator | 2.09e-03 | 1.36e-03 | NA |
| 2. P | P39921 | Tropomyosin-1 | 3.40e-03 | 6.50e-03 | NA |
| 2. P | P35417 | Paramyosin | 2.23e-08 | 5.65e-06 | NA |
| 2. P | Q6ZU80 | Centrosomal protein of 128 kDa | 2.00e-06 | 1.17e-04 | NA |
| 2. P | Q9H257 | Caspase recruitment domain-containing protein 9 | 7.63e-03 | 1.09e-03 | NA |
| 2. P | A2AIV8 | Caspase recruitment domain-containing protein 9 | 8.75e-03 | 3.75e-03 | NA |
| 2. P | Q5ZKK5 | Outer dense fiber protein 2 | 1.84e-05 | 2.74e-04 | NA |
| 2. P | Q5M9N0 | Coiled-coil domain-containing protein 158 | 1.74e-06 | 8.85e-05 | NA |
| 2. P | Q8CDI7 | Coiled-coil domain-containing protein 150 | 8.59e-08 | 1.97e-04 | NA |
| 2. P | Q6NY15 | Testis-specific gene 10 protein | 1.92e-05 | 1.53e-06 | NA |
| 2. P | Q6PH08 | ERC protein 2 | 4.21e-02 | 6.71e-04 | NA |
| 2. P | D3Z8K2 | Coiled-coil domain-containing protein 39 | 1.29e-06 | 1.45e-03 | NA |
| 2. P | Q15643 | Thyroid receptor-interacting protein 11 | 3.57e-05 | 4.48e-02 | NA |
| 2. P | Q96KP6 | TNFAIP3-interacting protein 3 | 2.21e-02 | 4.97e-02 | NA |
| 2. P | O15083 | ERC protein 2 | 9.59e-06 | 7.56e-04 | NA |
| 2. P | F1R4Y7 | Centrosomal protein of 83 kDa | 7.31e-08 | 1.06e-09 | NA |
| 2. P | Q15431 | Synaptonemal complex protein 1 | 4.06e-04 | 2.99e-02 | NA |
| 2. P | Q15025 | TNFAIP3-interacting protein 1 | 3.87e-04 | 1.46e-02 | NA |
| 2. P | Q6DFC2 | Coiled-coil domain-containing protein 77 | 1.98e-04 | 1.54e-03 | NA |
| 2. P | O88522 | NF-kappa-B essential modulator | 6.88e-03 | 5.70e-03 | NA |
| 2. P | Q01202 | Paramyosin | 1.88e-07 | 3.18e-05 | NA |
| 2. P | Q8WP33 | Coiled-coil domain-containing protein 30 | 5.16e-05 | 2.05e-02 | NA |
| 2. P | Q6FY25 | Spindle pole body component 110 | 2.04e-02 | 1.35e-03 | NA |
| 2. P | Q9D5R3 | Centrosomal protein of 83 kDa | 4.39e-04 | 1.18e-06 | NA |
| 2. P | Q498G2 | Centrosomal protein of 152 kDa | 8.49e-05 | 4.11e-05 | NA |
| 2. P | Q92805 | Golgin subfamily A member 1 | 2.34e-06 | 1.85e-03 | NA |
| 2. P | Q8CDI6 | Coiled-coil domain-containing protein 158 | 3.60e-06 | 2.90e-04 | NA |
| 2. P | Q75AF5 | Golgin IMH1 | 7.19e-06 | 2.32e-03 | NA |
| 2. P | Q5U3Z6 | Deuterosome assembly protein 1 | 6.74e-05 | 1.21e-02 | NA |
| 2. P | Q8CJ40 | Rootletin | 3.29e-06 | 6.50e-03 | NA |
| 2. P | Q80YF0 | Mitotic spindle assembly checkpoint protein MAD1 | 3.67e-05 | 1.51e-02 | NA |
| 2. P | Q15075 | Early endosome antigen 1 | 3.32e-07 | 1.87e-02 | NA |
| 2. P | Q9NJA9 | Paramyosin | 9.51e-06 | 1.86e-06 | NA |
| 2. P | Q9EPY0 | Caspase recruitment domain-containing protein 9 | 9.18e-03 | 2.40e-04 | NA |
| 2. P | P35418 | Paramyosin | 5.37e-08 | 8.51e-07 | NA |
| 2. P | Q6PGZ0 | Centrosomal protein of 63 kDa | 2.94e-07 | 5.20e-06 | NA |
| 2. P | A8HUA1 | Cilia- and flagella-associated protein 58 | 9.18e-04 | 3.75e-05 | NA |
| 2. P | Q66GS9 | Centrosomal protein of 135 kDa | 1.36e-07 | 4.23e-02 | NA |
| 2. P | Q9SAF6 | Protein CROWDED NUCLEI 2 | 1.01e-05 | 3.66e-02 | NA |
| 2. P | C5DY19 | Spindle pole body component 110 | 5.69e-07 | 2.08e-04 | NA |
| 2. P | Q95JK1 | Deuterosome assembly protein 1 | 3.91e-05 | 4.96e-04 | NA |
| 2. P | Q9Z220 | Testis-specific gene 10 protein | 2.17e-06 | 1.87e-07 | NA |
| 2. P | Q2T9Z6 | Coiled-coil domain-containing protein 175 | 3.27e-06 | 2.61e-03 | NA |
| 2. P | Q9Y6D9 | Mitotic spindle assembly checkpoint protein MAD1 | 6.24e-06 | 2.32e-02 | NA |
| 2. P | Q8IYT3 | Coiled-coil domain-containing protein 170 | 1.32e-05 | 4.11e-03 | NA |
| 2. P | C5DJH6 | Spindle pole body component 110 | 3.00e-07 | 3.14e-02 | NA |
| 2. P | Q86RN8 | Paramyosin | 1.44e-07 | 4.09e-09 | NA |
| 2. P | Q811U3 | ELKS/Rab6-interacting/CAST family member 1 | 1.26e-06 | 9.26e-03 | NA |
| 2. P | Q96CN9 | GRIP and coiled-coil domain-containing protein 1 | 1.39e-04 | 1.93e-02 | NA |
| 2. P | Q4R8C3 | Outer dense fiber protein 2 | 3.12e-07 | 2.21e-02 | NA |
| 2. P | Q8NCX0 | Coiled-coil domain-containing protein 150 | 2.21e-05 | 1.02e-03 | NA |
| 2. P | Q8BT07 | Centrosomal protein of 55 kDa | 1.41e-03 | 3.11e-02 | NA |
| 2. P | Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 | 1.73e-03 | 2.98e-09 | NA |
| 2. P | I1RGD4 | Autophagy-related protein 23 | 4.07e-06 | 2.82e-02 | NA |
| 2. P | Q7NBF8 | Cytadherence high molecular weight protein 2 | 3.33e-06 | 4.11e-05 | NA |
| 2. P | Q8CHG3 | GRIP and coiled-coil domain-containing protein 2 | 1.30e-02 | 1.55e-02 | NA |
| 2. P | A6ZYV5 | Spindle pole body component 110 | 7.83e-05 | 4.94e-03 | NA |
| 2. P | A7THU9 | Spindle pole body component 110 | 1.76e-05 | 2.82e-02 | NA |
| 2. P | Q3V6T2 | Girdin | 7.09e-06 | 1.09e-02 | NA |
| 2. P | Q05870 | Paramyosin | 3.77e-07 | 8.09e-07 | NA |
| 2. P | Q9BV73 | Centrosome-associated protein CEP250 | 3.17e-04 | 9.93e-03 | NA |
| 2. P | Q56A40 | Coiled-coil domain-containing protein 40 | 1.77e-05 | 1.44e-02 | NA |
| 2. P | Q8WXW3 | Progesterone-induced-blocking factor 1 | 1.99e-06 | 1.56e-03 | NA |
| 2. P | Q921M4 | Golgin subfamily A member 2 | 1.49e-04 | 2.13e-06 | NA |
| 2. P | Q9WUU8 | TNFAIP3-interacting protein 1 | 7.23e-04 | 1.39e-02 | NA |
| 2. P | Q8T305 | Paramyosin | NA | 1.38e-06 | NA |
| 2. P | Q9UTJ3 | Meiotic expression up-regulated protein 1/2 | 8.35e-02 | 4.35e-02 | NA |
| 2. P | B3LFU6 | Spindle pole body component 110 | 2.71e-05 | 1.60e-02 | NA |
| 2. P | O61308 | 227 kDa spindle- and centromere-associated protein | 9.90e-03 | 9.77e-04 | NA |
| 2. P | A8WG43 | Coiled-coil domain-containing protein 89 | 7.63e-07 | 1.26e-02 | NA |
| 2. P | Q08379 | Golgin subfamily A member 2 | 9.04e-06 | 8.71e-06 | NA |
| 2. P | Q5PQJ9 | Coiled-coil domain-containing protein 175 | 1.78e-05 | 1.03e-06 | NA |
| 2. P | O94986 | Centrosomal protein of 152 kDa | 1.17e-04 | 3.75e-03 | NA |
| 2. P | Q5SNZ0 | Girdin | 8.57e-06 | 3.05e-03 | NA |
| 2. P | Q9CW79 | Golgin subfamily A member 1 | 2.39e-03 | 9.67e-04 | NA |
| 2. P | Q8I659 | Uncharacterized protein PFB0765w | 6.54e-04 | 6.08e-06 | NA |
| 2. P | Q8IYE0 | Coiled-coil domain-containing protein 146 | 1.34e-06 | 3.13e-04 | NA |
| 2. P | O96064 | Paramyosin | 2.73e-07 | 2.25e-07 | NA |
| 2. P | P06198 | Paramyosin | 1.98e-07 | 2.50e-06 | NA |
| 2. P | P61430 | Synaptonemal complex protein 2 | 1.11e-05 | 4.33e-03 | NA |
| 2. P | Q60563 | Synaptonemal complex protein 1 (Fragment) | 1.05e-02 | 7.27e-03 | NA |
| 2. P | Q9WTX8 | Mitotic spindle assembly checkpoint protein MAD1 | 2.11e-03 | 1.13e-03 | NA |
| 2. P | B9V5F5 | Centrosomal protein of 63 kDa-A | 6.68e-02 | 7.80e-03 | NA |
| 2. P | H7BZ55 | Ciliary rootlet coiled-coil protein 2 | 6.55e-09 | 1.53e-06 | NA |
| 2. P | B2RW38 | Cilia- and flagella-associated protein 58 | 5.70e-08 | 2.37e-02 | NA |
| 2. P | P13392 | Paramyosin (Fragment) | 3.43e-08 | 6.25e-03 | NA |
| 2. P | Q9UPV0 | Centrosomal protein of 164 kDa | 1.21e-01 | 6.25e-03 | NA |
| 2. P | D3ZZL9 | GRIP and coiled-coil domain-containing protein 2 | 1.16e-02 | 1.17e-05 | NA |
| 2. P | F6XLV1 | Ciliary rootlet coiled-coil protein 2 | 7.39e-06 | 3.24e-06 | NA |
| 2. P | Q8CJ99 | Sodium channel and clathrin linker 1 | 2.84e-02 | 3.53e-04 | NA |
| 2. P | Q96NL6 | Sodium channel and clathrin linker 1 | 2.91e-07 | 7.21e-05 | NA |
| 2. P | Q5BJF6 | Outer dense fiber protein 2 | 5.07e-03 | 5.52e-04 | NA |
| 2. P | Q53EZ4 | Centrosomal protein of 55 kDa | 2.74e-05 | 3.67e-03 | NA |
| 2. P | Q29RS0 | Coiled-coil domain-containing protein 89 | 3.32e-07 | 2.23e-02 | NA |
| 2. P | Q06VD6 | Structural protein ORF147 | NA | 4.40e-04 | NA |
| 2. P | Q9BZW7 | Testis-specific gene 10 protein | 1.63e-06 | 8.08e-05 | NA |
| 2. P | Q62839 | Golgin subfamily A member 2 | 9.50e-05 | 7.35e-08 | NA |
| 2. P | P22311 | Puff II/9-1 protein | 7.32e-03 | 1.61e-04 | NA |
| 2. P | Q7YS99 | Optineurin | 1.53e-01 | 1.70e-03 | NA |
| 2. P | Q84WU4 | Golgin candidate 3 | 3.11e-05 | 1.10e-03 | NA |
| 2. P | Q95JI9 | Coiled-coil domain-containing protein 89 | 1.64e-04 | 1.37e-02 | NA |
| 2. P | Q9Z221 | Polyamine-modulated factor 1-binding protein 1 | 2.80e-06 | 7.34e-03 | NA |
| 2. P | Q05D60 | Deuterosome assembly protein 1 | 1.63e-05 | 9.54e-03 | NA |
| 2. P | Q05000 | Myosin heavy chain (Fragment) | 2.00e-08 | 3.02e-02 | NA |
| 2. P | Q90Z16 | Optineurin | 3.21e-05 | 3.94e-04 | NA |
| 2. P | A3KGV1 | Outer dense fiber protein 2 | 3.65e-06 | 7.21e-05 | NA |
| 2. P | Q5HZK9 | Centrosomal protein of 63 kDa-B | 5.38e-07 | 4.65e-03 | NA |
| 2. P | P32380 | Spindle pole body component 110 | 3.23e-04 | 7.49e-03 | NA |
| 2. P | Q8MUF6 | Paramyosin | 7.11e-08 | 2.00e-08 | NA |
| 2. P | Q8K3M6 | ERC protein 2 | 1.23e-04 | 2.58e-03 | NA |
| 2. P | P10567 | Paramyosin | 8.69e-06 | 5.86e-06 | NA |
| 2. P | Q8VYU6 | Golgin candidate 4 | 4.12e-04 | 1.06e-02 | NA |
| 2. P | E9PVB3 | Coiled-coil domain-containing protein 175 | 5.67e-05 | 9.89e-07 | NA |
| 2. P | Q9BMM8 | Paramyosin | 4.56e-07 | 3.29e-08 | NA |
| 2. P | Q8S2T0 | Protein GRIP | 7.01e-07 | 3.31e-04 | NA |
| 2. P | Q8N998 | Coiled-coil domain-containing protein 89 | 1.52e-04 | 3.39e-02 | NA |
| 2. P | Q99MI1 | ELKS/Rab6-interacting/CAST family member 1 | 3.85e-06 | 9.94e-09 | NA |
| 2. P | Q8IYE1 | Coiled-coil domain-containing protein 13 | 6.99e-03 | 1.58e-03 | NA |
| 2. P | Q8BI22 | Centrosomal protein of 128 kDa | 2.20e-06 | 7.55e-06 | NA |
| 2. P | A8IQE0 | Coiled-coil domain-containing protein 39 | 1.48e-05 | 2.44e-02 | NA |
| 2. P | P0CK98 | Coiled-coil domain-containing protein 39 | 9.12e-07 | 1.54e-03 | NA |
| 2. P | Q95XR4 | Ectopic P granules protein 2 | 4.60e-08 | 4.42e-07 | NA |
| 2. P | P22312 | Puff II/9-2 protein | 2.00e-04 | 6.36e-04 | NA |
| 2. P | Q60952 | Centrosome-associated protein CEP250 | 2.67e-04 | 5.42e-05 | NA |
| 2. P | C8Z5R8 | Spindle pole body component 110 | 1.58e-04 | 4.07e-03 | NA |
| 2. P | G5E861 | Sodium channel and clathrin linker 1 | 2.91e-02 | 2.51e-04 | NA |
| 2. P | Q6TMG5 | NF-kappa-B essential modulator | 2.36e-04 | 3.26e-02 | NA |
| 2. P | Q4R6W3 | Testis-specific gene 10 protein | 7.45e-03 | 5.04e-03 | NA |
| 2. P | Q66H60 | Coiled-coil domain-containing protein 146 | 8.33e-04 | 4.25e-04 | NA |
| 2. P | Q8BVF4 | Coiled-coil domain-containing protein 30 | 1.60e-07 | 1.00e-06 | NA |
| 2. P | Q8VD04 | GRIP1-associated protein 1 | 6.37e-03 | 2.64e-02 | NA |
| 2. P | Q4V328 | GRIP1-associated protein 1 | 2.74e-03 | 4.52e-02 | NA |
| 2. P | Q9ULE4 | Protein FAM184B | 1.09e-05 | 3.36e-02 | NA |
| 2. P | D3YV10 | Coiled-coil domain-containing protein 13 | 5.43e-04 | 3.05e-02 | NA |
| 2. P | P0C221 | Coiled-coil domain-containing protein 175 | 1.40e-03 | 9.70e-06 | NA |
| 2. P | Q5DU05 | Centrosomal protein of 164 kDa | 1.85e-03 | 1.34e-02 | NA |
| 2. P | Q9Y592 | Centrosomal protein of 83 kDa | 4.82e-07 | 1.17e-08 | NA |
| 2. P | Q8K2J4 | Coiled-coil domain-containing protein 14 | 6.32e-03 | 4.61e-02 | NA |
| 2. P | Q03410 | Synaptonemal complex protein 1 | 4.50e-02 | 2.83e-04 | NA |
| 2. P | Q66H89 | Centrosomal protein of 83 kDa | 1.52e-08 | 1.57e-06 | NA |
| 2. P | E1BM70 | Coiled-coil domain-containing protein 39 | 6.19e-05 | 3.49e-02 | NA |
| 3. B | P25386 | Intracellular protein transport protein USO1 | 1.48e-02 | NA | 0.026 |
| 3. B | Q04766 | Structural protein (Fragment) | NA | NA | 0.031 |
| 3. B | Q84TD8 | Protein FLX-like 2 | 7.35e-03 | NA | 0.040 |