Results | PROST

Summary

Q5T9S5

Homolog: Q640L5.
Function: Coiled-coil domain-containing protein 18.

Statistics

Total GO Annotation: 300
Unique PROST Go: 285
Unique BLAST Go: 12

Total Homologs: 158
Unique PROST Homologs: 152
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q640L5 (Coiled-coil domain-containing protein 18) with a FATCAT P-Value: 1.7e-12 and RMSD of 15.12 angstrom. The sequence alignment identity is 84.2%.
Structural alignment shown in left. Query protein Q5T9S5 colored as red in alignment, homolog Q640L5 colored as blue. Query protein Q5T9S5 is also shown in right top, homolog Q640L5 showed in right bottom. They are colored based on secondary structures.

  Q5T9S5 MESSSSDYYNK--DNEEESLLANVASLRHELKITEWSLQSLGEELSSVSPSENSDYAPNPSRSEKLILD--VQPSHPGLLNYSPYENVCKISGSSTDFQK 96
  Q640L5 MEFISSDYCTKDNDNEEESLLANVASLRHELKITEWSLHNLGEELSSVSPSENSEYVCSPSRSERLILEELTQPSHLGRLIYPPYKKVCKTS-DSTDYQK 99

  Q5T9S5 KPRDKMFSSSAPVDQEIKSLREKLNKLRQQNACLVTQNHSLMTKFESIHFELTQSRAKVSMLESAQQQAASVPILEEQIINLEAEVSAQDKVLREAENKL 196
  Q640L5 KSRDQVSFSSVSMDQEVKNLREKLHKLRQQNACLVTQNHSLMTKIESVHFELTQSKAKIAMLESAQEQAANIPILEEQIINLEAEVSAQDKVLREAEDKL 199

  Q5T9S5 EQSQKMVIEKEQSLQESKEECIKLKVDLLEQTKQGKRAERQRNEALYNAEELSKAFQQYKKKVAEKLEKVQAEEEILERNLTNCEKENKRLQERCGLYKS 296
  Q640L5 EQSQKMVIEKEHSLQEAKEECIKLKVDLLEQSKQGKRAERQRNEALYNAEELSKAFQLYKEKVAEKLEKVQDEEEILERNLSNCEKENKRLQEKCNLYKS 299

  Q5T9S5 ELEILKEKLRQLKEENNNGKEKLRIMAVKNSEVMAQLTESRQSILKLESELENKDEILRDKFSLMNENRELKVRVAAQNERLDLCQQEIESSRVELRSLE 396
  Q640L5 ELEILKEKFRELKEEHYSGKEKLMIMAMKNSEVMSQLTESRQCILKLERELEDKDEIVREKFSLLNENRELKVRVATQNERLELCQQDIDNSRVELKSLE 399

  Q5T9S5 KIISQLPLKRELFGFKSYLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQESSKLSSLETEPVKLGGH 496
  Q640L5 KLITQIPLKREIVGFRSSLCKHQRSSVSDKEDKCIGCCEANKLMISELRIKLAIREAEIQKLHANLTVNQLSQNV--ANDSQECGKVNTLETEPVKLGGS 497

  Q5T9S5 QVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKIVAYSS 596
  Q640L5 QVESIKDGDQQTVNKQYEREKQRLATGIEELRAKLTQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNASKLENEMTKKCSQLLILEKQLEEKIIAYSS 597

  Q5T9S5 IAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLEKKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTES 696
  Q640L5 IAAKNAELEQELMEKNEKIRSLESNINTEHEKICFAFEKAKKIHLEQHKEMEKQIEQLETQLEKRDQQFKEQEKTMSILQQDILCKQHHLESLDRLLTES 697

  Q5T9S5 KGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNKEKFEKQLKKKSEEVYCLQKELKIKNHSLQETSEQNVILQHTLQQQQ 796
  Q640L5 KVEMEKENMKKDEALKALQIHVSEETIKVRQLDSALEICKEELALHLNQLERNKEKFERQLKKKSEEVYCLQKELKIKTHNLEETSEQNAILQHTLQQQQ 797

  Q5T9S5 QMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRKMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGEN 896
  Q640L5 QMLQQETMRNGELEDTQSKLEKQVSKQEQELQKQRESSTEKLRKMEEKYETAIREVDLKRQKIIELTGTARQAKLEMDQYKEELSKMEKEIIHLKRDGEN 897

  Q5T9S5 KAMHLSQLDMILDQTKTELEKKTNAVKELEKLQHSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECK 996
  Q640L5 KSMQLSQLDMVLDQTKTELEKTTNSVKELERLQHHTETELTETMQKREALENELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECK 997

  Q5T9S5 MEIEDKKQELLEMDQALKERNWELKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQ 1096
  Q640L5 MEIEDKKQELIEMDQALKERNWELKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQVESLNEKLQNAKEQLREKEFIMLQNEQEISQ 1097

  Q5T9S5 LKKEIERTQQRMKEMESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASK 1196
  Q640L5 LKKEIERTQQRMKEMESVIKEQEDYIATQYKEVIDLGQELRLTQEQMQNTHSELVEARRQEVQAQREIERLAGELEDIKQLSKEKEAHGNRLAEELGASQ 1197

  Q5T9S5 VREAHLEARMQAEIKKLSAEVESLKEAYHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANEALLTKES 1296
  Q640L5 VREAHLEARMQAEIKKLSSEVDSLKEAYQIEMISHQENHAKWKLSAESQKTSVQQLNEQLEKAKQELEEAQDTVSNLHQQVQDRNEVIEAANEALLIKES 1297

  Q5T9S5 ELTRLQAKISGHEKAEDIKFLPAPFTSPTEIMPDVQDPKFAKCFHTSFS--KCTKLRRSISASDLTFKIHGDEDLSEELLQDLKKMQLEQPSTLEESHKN 1394
  Q640L5 ELTRLQAKISGHEKTEDTKYLPAPFTTLTEIIPDSQHPNFAK--HSQISLFKCRKLRRSISASDLSFKSHGNDDLSEELLQDLKKMQFEQTSAIESGHKD 1395

  Q5T9S5 LTYTQPDSFKPLTYNLEADSSENNDFNTLSGMLRYINKEVRLLKKSSMQTGAGLNQGENV 1454
  Q640L5 LPLTHSESFKPLPYNLEDDSSESNDFSTLSGMLRYINKEVRLLKKSSLQTATGLSQGGKL 1455

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0000139	Golgi membrane
1. PB	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
1. PB	GO:0005856	cytoskeleton
2. P	GO:0097539	ciliary transition fiber
2. P	GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
2. P	GO:0019904	protein domain specific binding
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0051656	establishment of organelle localization
2. P	GO:0051260	protein homooligomerization
2. P	GO:0090161	Golgi ribbon formation
2. P	GO:0034499	late endosome to Golgi transport
2. P	GO:0005874	microtubule
2. P	GO:0005080	protein kinase C binding
2. P	GO:0051026	chiasma assembly
2. P	GO:1903251	multi-ciliated epithelial cell differentiation
2. P	GO:0048786	presynaptic active zone
2. P	GO:0044615	nuclear pore nuclear basket
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:0031122	cytoplasmic microtubule organization
2. P	GO:0009101	glycoprotein biosynthetic process
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0030426	growth cone
2. P	GO:0071907	determination of digestive tract left/right asymmetry
2. P	GO:0035092	sperm DNA condensation
2. P	GO:0008017	microtubule binding
2. P	GO:0007020	microtubule nucleation
2. P	GO:0090543	Flemming body
2. P	GO:0048790	maintenance of presynaptic active zone structure
2. P	GO:0032982	myosin filament
2. P	GO:0120103	centriolar subdistal appendage
2. P	GO:0032663	regulation of interleukin-2 production
2. P	GO:0032680	regulation of tumor necrosis factor production
2. P	GO:0001673	male germ cell nucleus
2. P	GO:0097431	mitotic spindle pole
2. P	GO:0090166	Golgi disassembly
2. P	GO:0034067	protein localization to Golgi apparatus
2. P	GO:0016239	positive regulation of macroautophagy
2. P	GO:0005154	epidermal growth factor receptor binding
2. P	GO:0005524	ATP binding
2. P	GO:0051496	positive regulation of stress fiber assembly
2. P	GO:0051301	cell division
2. P	GO:0002756	MyD88-independent toll-like receptor signaling pathway
2. P	GO:0008356	asymmetric cell division
2. P	GO:0005136	interleukin-4 receptor binding
2. P	GO:0010507	negative regulation of autophagy
2. P	GO:0000802	transverse filament
2. P	GO:0071910	determination of liver left/right asymmetry
2. P	GO:0032053	ciliary basal body organization
2. P	GO:0007283	spermatogenesis
2. P	GO:0051878	lateral element assembly
2. P	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
2. P	GO:0060287	epithelial cilium movement involved in determination of left/right asymmetry
2. P	GO:0071955	recycling endosome to Golgi transport
2. P	GO:0098998	extrinsic component of postsynaptic early endosome membrane
2. P	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production
2. P	GO:0042130	negative regulation of T cell proliferation
2. P	GO:0120229	protein localization to motile cilium
2. P	GO:0005886	plasma membrane
2. P	GO:0032815	negative regulation of natural killer cell activation
2. P	GO:0051092	positive regulation of NF-kappaB transcription factor activity
2. P	GO:0008104	protein localization
2. P	GO:0001520	outer dense fiber
2. P	GO:0036159	inner dynein arm assembly
2. P	GO:0051649	establishment of localization in cell
2. P	GO:0005816	spindle pole body
2. P	GO:0010975	regulation of neuron projection development
2. P	GO:0005863	striated muscle myosin thick filament
2. P	GO:0001965	G-protein alpha-subunit binding
2. P	GO:0042734	presynaptic membrane
2. P	GO:0001917	photoreceptor inner segment
2. P	GO:0006412	translation
2. P	GO:0036126	sperm flagellum
2. P	GO:0000151	ubiquitin ligase complex
2. P	GO:0110120	gamma-tubulin complex localization to nuclear side of mitotic spindle pole body
2. P	GO:1990450	linear polyubiquitin binding
2. P	GO:0020035	cytoadherence to microvasculature, mediated by symbiont protein
2. P	GO:1902857	positive regulation of non-motile cilium assembly
2. P	GO:0002079	inner acrosomal membrane
2. P	GO:0007249	I-kappaB kinase/NF-kappaB signaling
2. P	GO:0008022	protein C-terminus binding
2. P	GO:0072686	mitotic spindle
2. P	GO:0061024	membrane organization
2. P	GO:0001947	heart looping
2. P	GO:0043515	kinetochore binding
2. P	GO:0043621	protein self-association
2. P	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
2. P	GO:0032148	activation of protein kinase B activity
2. P	GO:0000242	pericentriolar material
2. P	GO:0031593	polyubiquitin modification-dependent protein binding
2. P	GO:0036064	ciliary basal body
2. P	GO:0031682	G-protein gamma-subunit binding
2. P	GO:0030276	clathrin binding
2. P	GO:0016064	immunoglobulin mediated immune response
2. P	GO:0120317	sperm mitochondrial sheath assembly
2. P	GO:0005930	axoneme
2. P	GO:0001782	B cell homeostasis
2. P	GO:0051660	establishment of centrosome localization
2. P	GO:0097225	sperm midpiece
2. P	GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0003146	heart jogging
2. P	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
2. P	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0010669	epithelial structure maintenance
2. P	GO:0042803	protein homodimerization activity
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0030031	cell projection assembly
2. P	GO:0051289	protein homotetramerization
2. P	GO:0005969	serine-pyruvate aminotransferase complex
2. P	GO:0000775	chromosome, centromeric region
2. P	GO:1900017	positive regulation of cytokine production involved in inflammatory response
2. P	GO:0005814	centriole
2. P	GO:0050862	positive regulation of T cell receptor signaling pathway
2. P	GO:0098837	postsynaptic recycling endosome
2. P	GO:0043330	response to exogenous dsRNA
2. P	GO:0051650	establishment of vesicle localization
2. P	GO:0000794	condensed nuclear chromosome
2. P	GO:0061760	antifungal innate immune response
2. P	GO:0043276	anoikis
2. P	GO:0030241	skeletal muscle myosin thick filament assembly
2. P	GO:1902426	deactivation of mitotic spindle assembly checkpoint
2. P	GO:0003356	regulation of cilium beat frequency
2. P	GO:0032495	response to muramyl dipeptide
2. P	GO:0007368	determination of left/right symmetry
2. P	GO:0097228	sperm principal piece
2. P	GO:0000795	synaptonemal complex
2. P	GO:0032740	positive regulation of interleukin-17 production
2. P	GO:0014069	postsynaptic density
2. P	GO:0000137	Golgi cis cisterna
2. P	GO:0005801	cis-Golgi network
2. P	GO:0099152	regulation of neurotransmitter receptor transport, endosome to postsynaptic membrane
2. P	GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
2. P	GO:0051220	cytoplasmic sequestering of protein
2. P	GO:0007274	neuromuscular synaptic transmission
2. P	GO:0000776	kinetochore
2. P	GO:0032147	activation of protein kinase activity
2. P	GO:0044782	cilium organization
2. P	GO:0000077	DNA damage checkpoint signaling
2. P	GO:0034453	microtubule anchoring
2. P	GO:0048788	cytoskeleton of presynaptic active zone
2. P	GO:0099041	vesicle tethering to Golgi
2. P	GO:0050772	positive regulation of axonogenesis
2. P	GO:0098831	presynaptic active zone cytoplasmic component
2. P	GO:0060050	positive regulation of protein glycosylation
2. P	GO:0030705	cytoskeleton-dependent intracellular transport
2. P	GO:0071539	protein localization to centrosome
2. P	GO:0003413	chondrocyte differentiation involved in endochondral bone morphogenesis
2. P	GO:0032755	positive regulation of interleukin-6 production
2. P	GO:0003351	epithelial cilium movement involved in extracellular fluid movement
2. P	GO:0030016	myofibril
2. P	GO:2000318	positive regulation of T-helper 17 type immune response
2. P	GO:0001819	positive regulation of cytokine production
2. P	GO:0055037	recycling endosome
2. P	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0034451	centriolar satellite
2. P	GO:0098882	structural constituent of presynaptic active zone
2. P	GO:0045171	intercellular bridge
2. P	GO:0085032	modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P	GO:1902254	negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P	GO:0032091	negative regulation of protein binding
2. P	GO:1902440	protein localization to mitotic spindle pole body
2. P	GO:0030032	lamellipodium assembly
2. P	GO:0006974	cellular response to DNA damage stimulus
2. P	GO:0007030	Golgi organization
2. P	GO:0005929	cilium
2. P	GO:0051645	Golgi localization
2. P	GO:0042975	peroxisome proliferator activated receptor binding
2. P	GO:0098535	de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P	GO:0006622	protein targeting to lysosome
2. P	GO:0098978	glutamatergic synapse
2. P	GO:0000711	meiotic DNA repair synthesis
2. P	GO:0032494	response to peptidoglycan
2. P	GO:0005815	microtubule organizing center
2. P	GO:0045184	establishment of protein localization
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0003341	cilium movement
2. P	GO:0007098	centrosome cycle
2. P	GO:0031023	microtubule organizing center organization
2. P	GO:0019901	protein kinase binding
2. P	GO:0032880	regulation of protein localization
2. P	GO:0051959	dynein light intermediate chain binding
2. P	GO:0065003	protein-containing complex assembly
2. P	GO:0000922	spindle pole
2. P	GO:0050700	CARD domain binding
2. P	GO:0007250	activation of NF-kappaB-inducing kinase activity
2. P	GO:0005802	trans-Golgi network
2. P	GO:0005823	central plaque of spindle pole body
2. P	GO:0007129	homologous chromosome pairing at meiosis
2. P	GO:0060285	cilium-dependent cell motility
2. P	GO:0045089	positive regulation of innate immune response
2. P	GO:0048167	regulation of synaptic plasticity
2. P	GO:0007288	sperm axoneme assembly
2. P	GO:0010457	centriole-centriole cohesion
2. P	GO:0030030	cell projection organization
2. P	GO:0030165	PDZ domain binding
2. P	GO:0090306	meiotic spindle assembly
2. P	GO:0051298	centrosome duplication
2. P	GO:0007130	synaptonemal complex assembly
2. P	GO:1905515	non-motile cilium assembly
2. P	GO:0061676	importin-alpha family protein binding
2. P	GO:0090235	regulation of metaphase plate congression
2. P	GO:0032722	positive regulation of chemokine production
2. P	GO:0009620	response to fungus
2. P	GO:0032580	Golgi cisterna membrane
2. P	GO:0000801	central element
2. P	GO:1904888	cranial skeletal system development
2. P	GO:0097729	9+2 motile cilium
2. P	GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0051225	spindle assembly
2. P	GO:0030997	regulation of centriole-centriole cohesion
2. P	GO:0002081	outer acrosomal membrane
2. P	GO:0097298	regulation of nucleus size
2. P	GO:0032760	positive regulation of tumor necrosis factor production
2. P	GO:0072660	maintenance of protein location in plasma membrane
2. P	GO:0002446	neutrophil mediated immunity
2. P	GO:0061512	protein localization to cilium
2. P	GO:0030142	COPI-coated Golgi to ER transport vesicle
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0016189	synaptic vesicle to endosome fusion
2. P	GO:0045162	clustering of voltage-gated sodium channels
2. P	GO:0007131	reciprocal meiotic recombination
2. P	GO:0050908	detection of light stimulus involved in visual perception
2. P	GO:0090660	cerebrospinal fluid circulation
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:1903003	positive regulation of protein deubiquitination
2. P	GO:0005092	GDP-dissociation inhibitor activity
2. P	GO:0030134	COPII-coated ER to Golgi transport vesicle
2. P	GO:0006486	protein glycosylation
2. P	GO:0033365	protein localization to organelle
2. P	GO:0008385	IkappaB kinase complex
2. P	GO:0097733	photoreceptor cell cilium
2. P	GO:0048278	vesicle docking
2. P	GO:0007099	centriole replication
2. P	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0035469	determination of pancreatic left/right asymmetry
2. P	GO:0061966	establishment of left/right asymmetry
2. P	GO:0090307	mitotic spindle assembly
2. P	GO:0032675	regulation of interleukin-6 production
2. P	GO:0043422	protein kinase B binding
2. P	GO:0016459	myosin complex
2. P	GO:1904781	positive regulation of protein localization to centrosome
2. P	GO:1903566	positive regulation of protein localization to cilium
2. P	GO:0042147	retrograde transport, endosome to Golgi
2. P	GO:0051019	mitogen-activated protein kinase binding
2. P	GO:1901990	regulation of mitotic cell cycle phase transition
2. P	GO:0099158	regulation of recycling endosome localization within postsynapse
2. P	GO:0035686	sperm fibrous sheath
2. P	GO:0098536	deuterosome
2. P	GO:0005158	insulin receptor binding
2. P	GO:0031393	negative regulation of prostaglandin biosynthetic process
2. P	GO:0016082	synaptic vesicle priming
2. P	GO:0007159	leukocyte cell-cell adhesion
2. P	GO:0005798	Golgi-associated vesicle
2. P	GO:0005822	inner plaque of spindle pole body
2. P	GO:0048538	thymus development
2. P	GO:0098982	GABA-ergic synapse
2. P	GO:0005794	Golgi apparatus
2. P	GO:0001932	regulation of protein phosphorylation
2. P	GO:0031267	small GTPase binding
2. P	GO:0060271	cilium assembly
2. P	GO:0007252	I-kappaB phosphorylation
2. P	GO:1990459	transferrin receptor binding
2. P	GO:0099635	voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P	GO:0043184	vascular endothelial growth factor receptor 2 binding
2. P	GO:0030317	flagellated sperm motility
2. P	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
2. P	GO:0031514	motile cilium
2. P	GO:0031929	TOR signaling
2. P	GO:0005813	centrosome
2. P	GO:0032991	protein-containing complex
2. P	GO:1904951	positive regulation of establishment of protein localization
2. P	GO:0005829	cytosol
2. P	GO:0061952	midbody abscission
2. P	GO:0044458	motile cilium assembly
2. P	GO:0070861	regulation of protein exit from endoplasmic reticulum
2. P	GO:0032449	CBM complex
2. P	GO:0044308	axonal spine
2. P	GO:0042169	SH2 domain binding
2. P	GO:0042770	signal transduction in response to DNA damage
2. P	GO:1902017	regulation of cilium assembly
2. P	GO:0032874	positive regulation of stress-activated MAPK cascade
2. P	GO:0045724	positive regulation of cilium assembly
2. P	GO:0019905	syntaxin binding
2. P	GO:1905244	regulation of modification of synaptic structure
2. P	GO:0017080	sodium channel regulator activity
2. P	GO:0042802	identical protein binding
2. P	GO:0120219	subapical part of cell
2. P	GO:0071439	clathrin complex
2. P	GO:0005654	nucleoplasm
3. B	GO:0016604	nuclear body
3. B	GO:0005198	structural molecule activity
3. B	GO:0048280	vesicle fusion with Golgi apparatus
3. B	GO:0048211	Golgi vesicle docking
3. B	GO:0045056	transcytosis
3. B	GO:0035493	SNARE complex assembly
3. B	GO:0061025	membrane fusion
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0005795	Golgi stack
3. B	GO:0030154	cell differentiation
3. B	GO:0006886	intracellular protein transport
3. B	GO:0009908	flower development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q5T9S5	Coiled-coil domain-containing protein 18	0	4.57e-164	0.0
1. PB	Q640L5	Coiled-coil domain-containing protein 18	1.70e-12	1.21e-75	0.0
1. PB	Q9PW73	Cytoskeletal protein Sojo	1.25e-05	1.46e-26	0.0
2. P	Q3UPP8	Centrosomal protein of 63 kDa	1.40e-04	2.53e-03	NA
2. P	P21249	Major antigen	1.53e-03	1.12e-06	NA
2. P	Q86SQ7	Serologically defined colon cancer antigen 8	7.58e-05	1.66e-02	NA
2. P	Q5T655	Cilia- and flagella-associated protein 58	1.99e-06	3.67e-03	NA
2. P	Q62209	Synaptonemal complex protein 1	2.32e-04	8.62e-07	NA
2. P	Q02171	Paramyosin	2.49e-04	2.84e-05	NA
2. P	Q9Y6K9	NF-kappa-B essential modulator	1.22e-03	2.46e-02	NA
2. P	P75395	Uncharacterized protein MG269 homolog	1.29e-02	2.99e-02	NA
2. P	P35415	Paramyosin, long form	7.20e-08	6.36e-04	NA
2. P	Q9UTK5	Nucleoporin alm1	7.17e-03	5.64e-03	NA
2. P	Q9D5Y1	Coiled-coil domain-containing protein 39	1.48e-06	1.28e-04	NA
2. P	A9QT41	NF-kappa-B essential modulator	2.09e-03	1.36e-03	NA
2. P	P39921	Tropomyosin-1	3.40e-03	6.50e-03	NA
2. P	P35417	Paramyosin	2.23e-08	5.65e-06	NA
2. P	Q6ZU80	Centrosomal protein of 128 kDa	2.00e-06	1.17e-04	NA
2. P	Q9H257	Caspase recruitment domain-containing protein 9	7.63e-03	1.09e-03	NA
2. P	A2AIV8	Caspase recruitment domain-containing protein 9	8.75e-03	3.75e-03	NA
2. P	Q5ZKK5	Outer dense fiber protein 2	1.84e-05	2.74e-04	NA
2. P	Q5M9N0	Coiled-coil domain-containing protein 158	1.74e-06	8.85e-05	NA
2. P	Q8CDI7	Coiled-coil domain-containing protein 150	8.59e-08	1.97e-04	NA
2. P	Q6NY15	Testis-specific gene 10 protein	1.92e-05	1.53e-06	NA
2. P	Q6PH08	ERC protein 2	4.21e-02	6.71e-04	NA
2. P	D3Z8K2	Coiled-coil domain-containing protein 39	1.29e-06	1.45e-03	NA
2. P	Q15643	Thyroid receptor-interacting protein 11	3.57e-05	4.48e-02	NA
2. P	Q96KP6	TNFAIP3-interacting protein 3	2.21e-02	4.97e-02	NA
2. P	O15083	ERC protein 2	9.59e-06	7.56e-04	NA
2. P	F1R4Y7	Centrosomal protein of 83 kDa	7.31e-08	1.06e-09	NA
2. P	Q15431	Synaptonemal complex protein 1	4.06e-04	2.99e-02	NA
2. P	Q15025	TNFAIP3-interacting protein 1	3.87e-04	1.46e-02	NA
2. P	Q6DFC2	Coiled-coil domain-containing protein 77	1.98e-04	1.54e-03	NA
2. P	O88522	NF-kappa-B essential modulator	6.88e-03	5.70e-03	NA
2. P	Q01202	Paramyosin	1.88e-07	3.18e-05	NA
2. P	Q8WP33	Coiled-coil domain-containing protein 30	5.16e-05	2.05e-02	NA
2. P	Q6FY25	Spindle pole body component 110	2.04e-02	1.35e-03	NA
2. P	Q9D5R3	Centrosomal protein of 83 kDa	4.39e-04	1.18e-06	NA
2. P	Q498G2	Centrosomal protein of 152 kDa	8.49e-05	4.11e-05	NA
2. P	Q92805	Golgin subfamily A member 1	2.34e-06	1.85e-03	NA
2. P	Q8CDI6	Coiled-coil domain-containing protein 158	3.60e-06	2.90e-04	NA
2. P	Q75AF5	Golgin IMH1	7.19e-06	2.32e-03	NA
2. P	Q5U3Z6	Deuterosome assembly protein 1	6.74e-05	1.21e-02	NA
2. P	Q8CJ40	Rootletin	3.29e-06	6.50e-03	NA
2. P	Q80YF0	Mitotic spindle assembly checkpoint protein MAD1	3.67e-05	1.51e-02	NA
2. P	Q15075	Early endosome antigen 1	3.32e-07	1.87e-02	NA
2. P	Q9NJA9	Paramyosin	9.51e-06	1.86e-06	NA
2. P	Q9EPY0	Caspase recruitment domain-containing protein 9	9.18e-03	2.40e-04	NA
2. P	P35418	Paramyosin	5.37e-08	8.51e-07	NA
2. P	Q6PGZ0	Centrosomal protein of 63 kDa	2.94e-07	5.20e-06	NA
2. P	A8HUA1	Cilia- and flagella-associated protein 58	9.18e-04	3.75e-05	NA
2. P	Q66GS9	Centrosomal protein of 135 kDa	1.36e-07	4.23e-02	NA
2. P	Q9SAF6	Protein CROWDED NUCLEI 2	1.01e-05	3.66e-02	NA
2. P	C5DY19	Spindle pole body component 110	5.69e-07	2.08e-04	NA
2. P	Q95JK1	Deuterosome assembly protein 1	3.91e-05	4.96e-04	NA
2. P	Q9Z220	Testis-specific gene 10 protein	2.17e-06	1.87e-07	NA
2. P	Q2T9Z6	Coiled-coil domain-containing protein 175	3.27e-06	2.61e-03	NA
2. P	Q9Y6D9	Mitotic spindle assembly checkpoint protein MAD1	6.24e-06	2.32e-02	NA
2. P	Q8IYT3	Coiled-coil domain-containing protein 170	1.32e-05	4.11e-03	NA
2. P	C5DJH6	Spindle pole body component 110	3.00e-07	3.14e-02	NA
2. P	Q86RN8	Paramyosin	1.44e-07	4.09e-09	NA
2. P	Q811U3	ELKS/Rab6-interacting/CAST family member 1	1.26e-06	9.26e-03	NA
2. P	Q96CN9	GRIP and coiled-coil domain-containing protein 1	1.39e-04	1.93e-02	NA
2. P	Q4R8C3	Outer dense fiber protein 2	3.12e-07	2.21e-02	NA
2. P	Q8NCX0	Coiled-coil domain-containing protein 150	2.21e-05	1.02e-03	NA
2. P	Q8BT07	Centrosomal protein of 55 kDa	1.41e-03	3.11e-02	NA
2. P	Q8IUD2	ELKS/Rab6-interacting/CAST family member 1	1.73e-03	2.98e-09	NA
2. P	I1RGD4	Autophagy-related protein 23	4.07e-06	2.82e-02	NA
2. P	Q7NBF8	Cytadherence high molecular weight protein 2	3.33e-06	4.11e-05	NA
2. P	Q8CHG3	GRIP and coiled-coil domain-containing protein 2	1.30e-02	1.55e-02	NA
2. P	A6ZYV5	Spindle pole body component 110	7.83e-05	4.94e-03	NA
2. P	A7THU9	Spindle pole body component 110	1.76e-05	2.82e-02	NA
2. P	Q3V6T2	Girdin	7.09e-06	1.09e-02	NA
2. P	Q05870	Paramyosin	3.77e-07	8.09e-07	NA
2. P	Q9BV73	Centrosome-associated protein CEP250	3.17e-04	9.93e-03	NA
2. P	Q56A40	Coiled-coil domain-containing protein 40	1.77e-05	1.44e-02	NA
2. P	Q8WXW3	Progesterone-induced-blocking factor 1	1.99e-06	1.56e-03	NA
2. P	Q921M4	Golgin subfamily A member 2	1.49e-04	2.13e-06	NA
2. P	Q9WUU8	TNFAIP3-interacting protein 1	7.23e-04	1.39e-02	NA
2. P	Q8T305	Paramyosin	NA	1.38e-06	NA
2. P	Q9UTJ3	Meiotic expression up-regulated protein 1/2	8.35e-02	4.35e-02	NA
2. P	B3LFU6	Spindle pole body component 110	2.71e-05	1.60e-02	NA
2. P	O61308	227 kDa spindle- and centromere-associated protein	9.90e-03	9.77e-04	NA
2. P	A8WG43	Coiled-coil domain-containing protein 89	7.63e-07	1.26e-02	NA
2. P	Q08379	Golgin subfamily A member 2	9.04e-06	8.71e-06	NA
2. P	Q5PQJ9	Coiled-coil domain-containing protein 175	1.78e-05	1.03e-06	NA
2. P	O94986	Centrosomal protein of 152 kDa	1.17e-04	3.75e-03	NA
2. P	Q5SNZ0	Girdin	8.57e-06	3.05e-03	NA
2. P	Q9CW79	Golgin subfamily A member 1	2.39e-03	9.67e-04	NA
2. P	Q8I659	Uncharacterized protein PFB0765w	6.54e-04	6.08e-06	NA
2. P	Q8IYE0	Coiled-coil domain-containing protein 146	1.34e-06	3.13e-04	NA
2. P	O96064	Paramyosin	2.73e-07	2.25e-07	NA
2. P	P06198	Paramyosin	1.98e-07	2.50e-06	NA
2. P	P61430	Synaptonemal complex protein 2	1.11e-05	4.33e-03	NA
2. P	Q60563	Synaptonemal complex protein 1 (Fragment)	1.05e-02	7.27e-03	NA
2. P	Q9WTX8	Mitotic spindle assembly checkpoint protein MAD1	2.11e-03	1.13e-03	NA
2. P	B9V5F5	Centrosomal protein of 63 kDa-A	6.68e-02	7.80e-03	NA
2. P	H7BZ55	Ciliary rootlet coiled-coil protein 2	6.55e-09	1.53e-06	NA
2. P	B2RW38	Cilia- and flagella-associated protein 58	5.70e-08	2.37e-02	NA
2. P	P13392	Paramyosin (Fragment)	3.43e-08	6.25e-03	NA
2. P	Q9UPV0	Centrosomal protein of 164 kDa	1.21e-01	6.25e-03	NA
2. P	D3ZZL9	GRIP and coiled-coil domain-containing protein 2	1.16e-02	1.17e-05	NA
2. P	F6XLV1	Ciliary rootlet coiled-coil protein 2	7.39e-06	3.24e-06	NA
2. P	Q8CJ99	Sodium channel and clathrin linker 1	2.84e-02	3.53e-04	NA
2. P	Q96NL6	Sodium channel and clathrin linker 1	2.91e-07	7.21e-05	NA
2. P	Q5BJF6	Outer dense fiber protein 2	5.07e-03	5.52e-04	NA
2. P	Q53EZ4	Centrosomal protein of 55 kDa	2.74e-05	3.67e-03	NA
2. P	Q29RS0	Coiled-coil domain-containing protein 89	3.32e-07	2.23e-02	NA
2. P	Q06VD6	Structural protein ORF147	NA	4.40e-04	NA
2. P	Q9BZW7	Testis-specific gene 10 protein	1.63e-06	8.08e-05	NA
2. P	Q62839	Golgin subfamily A member 2	9.50e-05	7.35e-08	NA
2. P	P22311	Puff II/9-1 protein	7.32e-03	1.61e-04	NA
2. P	Q7YS99	Optineurin	1.53e-01	1.70e-03	NA
2. P	Q84WU4	Golgin candidate 3	3.11e-05	1.10e-03	NA
2. P	Q95JI9	Coiled-coil domain-containing protein 89	1.64e-04	1.37e-02	NA
2. P	Q9Z221	Polyamine-modulated factor 1-binding protein 1	2.80e-06	7.34e-03	NA
2. P	Q05D60	Deuterosome assembly protein 1	1.63e-05	9.54e-03	NA
2. P	Q05000	Myosin heavy chain (Fragment)	2.00e-08	3.02e-02	NA
2. P	Q90Z16	Optineurin	3.21e-05	3.94e-04	NA
2. P	A3KGV1	Outer dense fiber protein 2	3.65e-06	7.21e-05	NA
2. P	Q5HZK9	Centrosomal protein of 63 kDa-B	5.38e-07	4.65e-03	NA
2. P	P32380	Spindle pole body component 110	3.23e-04	7.49e-03	NA
2. P	Q8MUF6	Paramyosin	7.11e-08	2.00e-08	NA
2. P	Q8K3M6	ERC protein 2	1.23e-04	2.58e-03	NA
2. P	P10567	Paramyosin	8.69e-06	5.86e-06	NA
2. P	Q8VYU6	Golgin candidate 4	4.12e-04	1.06e-02	NA
2. P	E9PVB3	Coiled-coil domain-containing protein 175	5.67e-05	9.89e-07	NA
2. P	Q9BMM8	Paramyosin	4.56e-07	3.29e-08	NA
2. P	Q8S2T0	Protein GRIP	7.01e-07	3.31e-04	NA
2. P	Q8N998	Coiled-coil domain-containing protein 89	1.52e-04	3.39e-02	NA
2. P	Q99MI1	ELKS/Rab6-interacting/CAST family member 1	3.85e-06	9.94e-09	NA
2. P	Q8IYE1	Coiled-coil domain-containing protein 13	6.99e-03	1.58e-03	NA
2. P	Q8BI22	Centrosomal protein of 128 kDa	2.20e-06	7.55e-06	NA
2. P	A8IQE0	Coiled-coil domain-containing protein 39	1.48e-05	2.44e-02	NA
2. P	P0CK98	Coiled-coil domain-containing protein 39	9.12e-07	1.54e-03	NA
2. P	Q95XR4	Ectopic P granules protein 2	4.60e-08	4.42e-07	NA
2. P	P22312	Puff II/9-2 protein	2.00e-04	6.36e-04	NA
2. P	Q60952	Centrosome-associated protein CEP250	2.67e-04	5.42e-05	NA
2. P	C8Z5R8	Spindle pole body component 110	1.58e-04	4.07e-03	NA
2. P	G5E861	Sodium channel and clathrin linker 1	2.91e-02	2.51e-04	NA
2. P	Q6TMG5	NF-kappa-B essential modulator	2.36e-04	3.26e-02	NA
2. P	Q4R6W3	Testis-specific gene 10 protein	7.45e-03	5.04e-03	NA
2. P	Q66H60	Coiled-coil domain-containing protein 146	8.33e-04	4.25e-04	NA
2. P	Q8BVF4	Coiled-coil domain-containing protein 30	1.60e-07	1.00e-06	NA
2. P	Q8VD04	GRIP1-associated protein 1	6.37e-03	2.64e-02	NA
2. P	Q4V328	GRIP1-associated protein 1	2.74e-03	4.52e-02	NA
2. P	Q9ULE4	Protein FAM184B	1.09e-05	3.36e-02	NA
2. P	D3YV10	Coiled-coil domain-containing protein 13	5.43e-04	3.05e-02	NA
2. P	P0C221	Coiled-coil domain-containing protein 175	1.40e-03	9.70e-06	NA
2. P	Q5DU05	Centrosomal protein of 164 kDa	1.85e-03	1.34e-02	NA
2. P	Q9Y592	Centrosomal protein of 83 kDa	4.82e-07	1.17e-08	NA
2. P	Q8K2J4	Coiled-coil domain-containing protein 14	6.32e-03	4.61e-02	NA
2. P	Q03410	Synaptonemal complex protein 1	4.50e-02	2.83e-04	NA
2. P	Q66H89	Centrosomal protein of 83 kDa	1.52e-08	1.57e-06	NA
2. P	E1BM70	Coiled-coil domain-containing protein 39	6.19e-05	3.49e-02	NA
3. B	P25386	Intracellular protein transport protein USO1	1.48e-02	NA	0.026
3. B	Q04766	Structural protein (Fragment)	NA	NA	0.031
3. B	Q84TD8	Protein FLX-like 2	7.35e-03	NA	0.040