Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
         Q8C159
         (Tetratricopeptide repeat protein 22) with a FATCAT P-Value: 0.0 and RMSD of 1.71 angstrom.  The sequence alignment identity is 84.4%.
        Structural alignment shown in left. Query protein Q5TAA0 colored as red in alignment, homolog Q8C159 colored as blue.
        Query protein Q5TAA0 is also shown in right top, homolog Q8C159 showed in right bottom. They are colored based on secondary structures. 
Q5TAA0 MAELEAVADDLDALIDDLDYLPGHFHLEMQLNFEPRSPAPQRARDLKLQREGLRQELQLAAAPQRPAVRHLLGAFAFYLEELDEARECFLEVAHEHPGNL 100 Q8C159 MTEAEVGAEDLDTLLDELDYLPGHFHLEMQLNFEPRSPAQLRARDLKLQREGLRQELELVATPQLPAVRHLLGTFSFYLEELGDAREHFLEVARKDPGNL 100 Q5TAA0 NAWANLAHVYGRLGQEEEEEACAARLADLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEKRGWYF 200 Q8C159 NAWANLAHVYGQLGQEEEEEASAGRLASLMGLEGDPEDAGDPRLRAARCLAEQGYAHGFDVGCASPEERAQVLEAGIALYDKALGYGQQIPIEEKRSWYF 200 Q5TAA0 TMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKSEDPRHRALAWCYLGMLLERKDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR 300 Q8C159 TMATLFIRLDGIFLEMGSEEQKRLPAFNRTLALLGEVLKSSDSRHQALAWCYVGMLLERKDTFSTTPMGVHEYGYSGTEPLDCFGKAIEIAKNQPPILNR 300 Q5TAA0 LAKIFYFLGKQDMAIGTCNMALDVLRDPELNWQAYCTRAKIHIRAYLHDLKRAKMGLGGMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDA 400 Q8C159 LAKIFHFLGKQDMAVGTCNMVLAVLTDPELNWQAYCTRAKVRIRAYVHDLERAKVGLGGLPDRNHLACAKADLEEVVKVCPSLRTYLDISQVYYYMGVDA 400 Q5TAA0 VQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTDGFGCLLEALLAQWSQAQLSDGELGREVDAW 500 Q8C159 MRELLAVDEAALNQALVFLAKAGELELGDTLPELQLLRGKCLRVQGEDANAAACFKRAVELDDEGSSHTEGFGCLLEALLAQWSQAQLSDGEVGYEVDVW 500 Q5TAA0 LRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGRPALVRLLFETMEREGE--GASAPRDRRAVSF 569 Q8C159 LRHAQGKYPAARLRQELQRVWRGHTEEVLGLARALVAQGRPALVRLLFETMEHEGEDAGGSG-KSR--VSS 568
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description | 
|---|---|---|
| 2. P | GO:0009306 | protein secretion | 
| 2. P | GO:0021766 | hippocampus development | 
| 2. P | GO:0030014 | CCR4-NOT complex | 
| 2. P | GO:0035082 | axoneme assembly | 
| 2. P | GO:0030837 | negative regulation of actin filament polymerization | 
| 2. P | GO:0007080 | mitotic metaphase plate congression | 
| 2. P | GO:0071539 | protein localization to centrosome | 
| 2. P | GO:0000245 | spliceosomal complex assembly | 
| 2. P | GO:0007091 | metaphase/anaphase transition of mitotic cell cycle | 
| 2. P | GO:0060296 | regulation of cilium beat frequency involved in ciliary motility | 
| 2. P | GO:0050688 | regulation of defense response to virus | 
| 2. P | GO:0035327 | |
| 2. P | GO:0006641 | triglyceride metabolic process | 
| 2. P | GO:0046548 | retinal rod cell development | 
| 2. P | GO:0030992 | intraciliary transport particle B | 
| 2. P | GO:0030970 | retrograde protein transport, ER to cytosol | 
| 2. P | GO:2001255 | positive regulation of histone H3-K36 trimethylation | 
| 2. P | GO:0035720 | intraciliary anterograde transport | 
| 2. P | GO:0036513 | Derlin-1 retrotranslocation complex | 
| 2. P | GO:0034451 | centriolar satellite | 
| 2. P | GO:0003690 | double-stranded DNA binding | 
| 2. P | GO:0000963 | mitochondrial RNA processing | 
| 2. P | GO:0007271 | synaptic transmission, cholinergic | 
| 2. P | GO:1905198 | manchette assembly | 
| 2. P | GO:0016567 | protein ubiquitination | 
| 2. P | GO:0032091 | negative regulation of protein binding | 
| 2. P | GO:0035255 | ionotropic glutamate receptor binding | 
| 2. P | GO:0031126 | sno(s)RNA 3'-end processing | 
| 2. P | GO:0051321 | meiotic cell cycle | 
| 2. P | GO:0099634 | postsynaptic specialization membrane | 
| 2. P | GO:0009793 | embryo development ending in seed dormancy | 
| 2. P | GO:0019903 | protein phosphatase binding | 
| 2. P | GO:0055087 | Ski complex | 
| 2. P | GO:0007030 | Golgi organization | 
| 2. P | GO:1902855 | regulation of non-motile cilium assembly | 
| 2. P | GO:2000234 | positive regulation of rRNA processing | 
| 2. P | GO:0005929 | cilium | 
| 2. P | GO:0036503 | ERAD pathway | 
| 2. P | GO:0048487 | beta-tubulin binding | 
| 2. P | GO:0007268 | chemical synaptic transmission | 
| 2. P | GO:0071357 | cellular response to type I interferon | 
| 2. P | GO:0010874 | regulation of cholesterol efflux | 
| 2. P | GO:0038108 | negative regulation of appetite by leptin-mediated signaling pathway | 
| 2. P | GO:0008594 | photoreceptor cell morphogenesis | 
| 2. P | GO:0060324 | face development | 
| 2. P | GO:0003085 | negative regulation of systemic arterial blood pressure | 
| 2. P | GO:0032465 | regulation of cytokinesis | 
| 2. P | GO:0001895 | retina homeostasis | 
| 2. P | GO:0016072 | rRNA metabolic process | 
| 2. P | GO:0033564 | anterior/posterior axon guidance | 
| 2. P | GO:0051301 | cell division | 
| 2. P | GO:0060170 | ciliary membrane | 
| 2. P | GO:0008356 | asymmetric cell division | 
| 2. P | GO:0030674 | protein-macromolecule adaptor activity | 
| 2. P | GO:0001750 | photoreceptor outer segment | 
| 2. P | GO:1900075 | positive regulation of neuromuscular synaptic transmission | 
| 2. P | GO:0003341 | cilium movement | 
| 2. P | GO:0001015 | snoRNA transcription by RNA polymerase II | 
| 2. P | GO:0007098 | centrosome cycle | 
| 2. P | GO:0048854 | brain morphogenesis | 
| 2. P | GO:0000836 | Hrd1p ubiquitin ligase complex | 
| 2. P | GO:0034464 | BBSome | 
| 2. P | GO:0034088 | maintenance of mitotic sister chromatid cohesion | 
| 2. P | GO:0035176 | social behavior | 
| 2. P | GO:0090694 | Scc2-Scc4 cohesin loading complex | 
| 2. P | GO:0046907 | intracellular transport | 
| 2. P | GO:0060260 | regulation of transcription initiation from RNA polymerase II promoter | 
| 2. P | GO:0003735 | structural constituent of ribosome | 
| 2. P | GO:0007219 | Notch signaling pathway | 
| 2. P | GO:0030534 | adult behavior | 
| 2. P | GO:0030071 | regulation of mitotic metaphase/anaphase transition | 
| 2. P | GO:0009451 | RNA modification | 
| 2. P | GO:0120170 | intraciliary transport particle B binding | 
| 2. P | GO:0039023 | pronephric duct morphogenesis | 
| 2. P | GO:0060348 | bone development | 
| 2. P | GO:0015031 | protein transport | 
| 2. P | GO:0031938 | obsolete regulation of chromatin silencing at telomere | 
| 2. P | GO:2001165 | positive regulation of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues | 
| 2. P | GO:0045087 | innate immune response | 
| 2. P | GO:0009615 | response to virus | 
| 2. P | GO:0031145 | anaphase-promoting complex-dependent catabolic process | 
| 2. P | GO:0000281 | mitotic cytokinesis | 
| 2. P | GO:1905515 | non-motile cilium assembly | 
| 2. P | GO:0005856 | cytoskeleton | 
| 2. P | GO:0031047 | gene silencing by RNA | 
| 2. P | GO:0043495 | protein-membrane adaptor activity | 
| 2. P | GO:0090181 | regulation of cholesterol metabolic process | 
| 2. P | GO:0071006 | U2-type catalytic step 1 spliceosome | 
| 2. P | GO:0019060 | intracellular transport of viral protein in host cell | 
| 2. P | GO:0001917 | photoreceptor inner segment | 
| 2. P | GO:0006412 | translation | 
| 2. P | GO:0031462 | Cul2-RING ubiquitin ligase complex | 
| 2. P | GO:0051492 | regulation of stress fiber assembly | 
| 2. P | GO:0021756 | striatum development | 
| 2. P | GO:0036126 | sperm flagellum | 
| 2. P | GO:0071360 | cellular response to exogenous dsRNA | 
| 2. P | GO:0044321 | response to leptin | 
| 2. P | GO:0030659 | cytoplasmic vesicle membrane | 
| 2. P | GO:0030433 | ubiquitin-dependent ERAD pathway | 
| 2. P | GO:0003688 | DNA replication origin binding | 
| 2. P | GO:0097730 | non-motile cilium | 
| 2. P | GO:0035458 | cellular response to interferon-beta | 
| 2. P | GO:0016358 | dendrite development | 
| 2. P | GO:0061512 | protein localization to cilium | 
| 2. P | GO:0000839 | Hrd1p ubiquitin ligase ERAD-L complex | 
| 2. P | GO:0005819 | spindle | 
| 2. P | GO:0033130 | acetylcholine receptor binding | 
| 2. P | GO:1903546 | protein localization to photoreceptor outer segment | 
| 2. P | GO:0006836 | neurotransmitter transport | 
| 2. P | GO:0071014 | post-mRNA release spliceosomal complex | 
| 2. P | GO:0006270 | DNA replication initiation | 
| 2. P | GO:0097546 | ciliary base | 
| 2. P | GO:0051457 | maintenance of protein location in nucleus | 
| 2. P | GO:1903540 | establishment of protein localization to postsynaptic membrane | 
| 2. P | GO:0033365 | protein localization to organelle | 
| 2. P | GO:0099518 | vesicle cytoskeletal trafficking | 
| 2. P | GO:0000958 | mitochondrial mRNA catabolic process | 
| 2. P | GO:0033563 | dorsal/ventral axon guidance | 
| 2. P | GO:0045444 | fat cell differentiation | 
| 2. P | GO:0001843 | neural tube closure | 
| 2. P | GO:0005634 | nucleus | 
| 2. P | GO:0051097 | negative regulation of helicase activity | 
| 2. P | GO:0010239 | chloroplast mRNA processing | 
| 2. P | GO:0000242 | pericentriolar material | 
| 2. P | GO:0090262 | regulation of transcription-coupled nucleotide-excision repair | 
| 2. P | GO:0036064 | ciliary basal body | 
| 2. P | GO:2001173 | regulation of histone H2B conserved C-terminal lysine ubiquitination | 
| 2. P | GO:0016604 | nuclear body | 
| 2. P | GO:0045494 | photoreceptor cell maintenance | 
| 2. P | GO:0043525 | positive regulation of neuron apoptotic process | 
| 2. P | GO:0070979 | protein K11-linked ubiquitination | 
| 2. P | GO:0071008 | U2-type post-mRNA release spliceosomal complex | 
| 2. P | GO:0046530 | photoreceptor cell differentiation | 
| 2. P | GO:1990756 | ubiquitin ligase-substrate adaptor activity | 
| 2. P | GO:0000785 | chromatin | 
| 2. P | GO:0071004 | U2-type prespliceosome | 
| 2. P | GO:0051607 | defense response to virus | 
| 2. P | GO:0009949 | polarity specification of anterior/posterior axis | 
| 2. P | GO:0072423 | response to DNA damage checkpoint signaling | 
| 2. P | GO:0043014 | alpha-tubulin binding | 
| 2. P | GO:0045142 | triplex DNA binding | 
| 2. P | GO:0060613 | fat pad development | 
| 2. P | GO:0045071 | negative regulation of viral genome replication | 
| 2. P | GO:0040018 | positive regulation of multicellular organism growth | 
| 2. P | GO:2001209 | positive regulation of transcription elongation from RNA polymerase I promoter | 
| 2. P | GO:0034454 | microtubule anchoring at centrosome | 
| 2. P | GO:0000398 | mRNA splicing, via spliceosome | 
| 2. P | GO:0000354 | cis assembly of pre-catalytic spliceosome | 
| 2. P | GO:0005814 | centriole | 
| 2. P | GO:0070209 | ASTRA complex | 
| 2. P | GO:0006362 | transcription elongation from RNA polymerase I promoter | 
| 2. P | GO:0010887 | negative regulation of cholesterol storage | 
| 2. P | GO:0034452 | dynactin binding | 
| 2. P | GO:0035634 | response to stilbenoid | 
| 2. P | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding | 
| 2. P | GO:0005794 | Golgi apparatus | 
| 2. P | GO:1990269 | RNA polymerase II C-terminal domain phosphoserine binding | 
| 2. P | GO:0007286 | spermatid development | 
| 2. P | GO:0021591 | ventricular system development | 
| 2. P | GO:0032391 | photoreceptor connecting cilium | 
| 2. P | GO:0060271 | cilium assembly | 
| 2. P | GO:0021987 | cerebral cortex development | 
| 2. P | GO:0007608 | sensory perception of smell | 
| 2. P | GO:0071007 | U2-type catalytic step 2 spliceosome | 
| 2. P | GO:1901626 | regulation of postsynaptic membrane organization | 
| 2. P | GO:0031514 | motile cilium | 
| 2. P | GO:0005813 | centrosome | 
| 2. P | GO:0035845 | photoreceptor cell outer segment organization | 
| 2. P | GO:0035457 | cellular response to interferon-alpha | 
| 2. P | GO:0042073 | intraciliary transport | 
| 2. P | GO:0005829 | cytosol | 
| 2. P | GO:0005739 | mitochondrion | 
| 2. P | GO:0030990 | intraciliary transport particle | 
| 2. P | GO:0034260 | negative regulation of GTPase activity | 
| 2. P | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition | 
| 2. P | GO:0035735 | intraciliary transport involved in cilium assembly | 
| 2. P | GO:0071921 | cohesin loading | 
| 2. P | GO:0005680 | anaphase-promoting complex | 
| 2. P | GO:0030703 | eggshell formation | 
| 2. P | GO:1901525 | negative regulation of mitophagy | 
| 2. P | GO:0007224 | smoothened signaling pathway | 
| 2. P | GO:0019216 | regulation of lipid metabolic process | 
| 2. P | GO:0000974 | Prp19 complex | 
| 2. P | GO:0050893 | sensory processing | 
| 2. P | GO:0044782 | cilium organization | 
| 2. P | GO:0045724 | positive regulation of cilium assembly | 
| 2. P | GO:0032116 | SMC loading complex | 
| 2. P | GO:0035869 | ciliary transition zone | 
| 2. P | GO:0045880 | positive regulation of smoothened signaling pathway | 
| 2. P | GO:0032474 | otolith morphogenesis | 
| 2. P | GO:0005654 | nucleoplasm | 
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
      2. P indicates homologs that are only found by PROST.
      3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue | 
|---|---|---|---|---|---|
| 1. PB | Q8C159 | Tetratricopeptide repeat protein 22 | 0.00e+00 | 3.61e-73 | 0.0 | 
| 1. PB | Q5TAA0 | Tetratricopeptide repeat protein 22 | 0 | 4.09e-138 | 0.0 | 
| 2. P | P09108 | 43 kDa receptor-associated protein of the synapse | 9.22e-09 | 3.21e-06 | NA | 
| 2. P | Q9D4C6 | LRP2-binding protein | 3.85e-05 | 5.87e-04 | NA | 
| 2. P | A5A6J9 | Interferon-induced protein with tetratricopeptide repeats 3 | 4.58e-09 | 4.64e-06 | NA | 
| 2. P | Q9FRI5 | Pentatricopeptide repeat-containing protein At1g25360 | 8.34e-05 | 4.78e-02 | NA | 
| 2. P | Q64112 | Interferon-induced protein with tetratricopeptide repeats 2 | 1.77e-11 | 6.69e-13 | NA | 
| 2. P | Q16NZ8 | MAU2 chromatid cohesion factor homolog | 3.21e-07 | 6.57e-04 | NA | 
| 2. P | Q5RFF7 | Tetratricopeptide repeat protein 38 | 1.11e-06 | 7.30e-03 | NA | 
| 2. P | P41889 | Anaphase-promoting complex subunit cut9 | 3.04e-06 | 9.57e-04 | NA | 
| 2. P | A5HK05 | Amyloid protein-binding protein 2 | 4.59e-06 | 5.37e-05 | NA | 
| 2. P | Q80Z70 | Protein sel-1 homolog 1 | 5.22e-05 | 4.57e-02 | NA | 
| 2. P | Q569C2 | LRP2-binding protein | 3.64e-05 | 1.25e-04 | NA | 
| 2. P | A1A4R8 | Cell division cycle protein 23 homolog | 9.97e-08 | 6.97e-05 | NA | 
| 2. P | B3P0R4 | MAU2 chromatid cohesion factor homolog | 1.18e-07 | 1.33e-04 | NA | 
| 2. P | Q8BS45 | Intraflagellar transport protein 56 | 3.25e-05 | 1.54e-04 | NA | 
| 2. P | B4NKT1 | MAU2 chromatid cohesion factor homolog | 6.58e-07 | 2.50e-04 | NA | 
| 2. P | Q6CJK2 | Pre-mRNA-splicing factor CLF1 | 7.14e-06 | 7.02e-03 | NA | 
| 2. P | Q60462 | Interferon-induced protein with tetratricopeptide repeats 2 | 4.41e-11 | 9.97e-13 | NA | 
| 2. P | B1H1Z8 | MAU2 chromatid cohesion factor homolog | 1.50e-07 | 2.18e-05 | NA | 
| 2. P | B4F766 | Dymeclin | 4.17e-03 | 3.51e-02 | NA | 
| 2. P | A3KPN8 | Tetratricopeptide repeat protein 38 | 1.18e-06 | 5.96e-03 | NA | 
| 2. P | Q9WVM3 | Anaphase-promoting complex subunit 7 | 4.36e-06 | 1.09e-02 | NA | 
| 2. P | P89105 | RNA polymerase-associated protein CTR9 | 4.26e-06 | 5.33e-06 | NA | 
| 2. P | Q75CN2 | Cargo-transport protein YPP1 | 5.88e-06 | 4.82e-02 | NA | 
| 2. P | O14879 | Interferon-induced protein with tetratricopeptide repeats 3 | 1.80e-09 | 8.79e-06 | NA | 
| 2. P | Q9C6S6 | Putative pentatricopeptide repeat-containing protein At1g31840 | 4.04e-05 | 2.06e-02 | NA | 
| 2. P | Q7SGD2 | Pre-mRNA-splicing factor clf-1 | 3.02e-06 | 1.98e-02 | NA | 
| 2. P | O17581 | Maternal uncoordinated protein 2 | 3.39e-06 | 4.64e-03 | NA | 
| 2. P | Q19294 | Cell division cycle protein 23 homolog | 5.37e-07 | 3.48e-02 | NA | 
| 2. P | A2VD82 | Tetratricopeptide repeat protein 38 | 1.49e-06 | 8.74e-04 | NA | 
| 2. P | Q9Z2G6 | Protein sel-1 homolog 1 | 4.95e-05 | 4.61e-02 | NA | 
| 2. P | Q9UJX3 | Anaphase-promoting complex subunit 7 | 1.26e-05 | 1.48e-03 | NA | 
| 2. P | A7E727 | Inclusion body clearance protein iml2 | 2.78e-05 | 1.39e-04 | NA | 
| 2. P | Q66KY0 | Cytochrome c oxidase assembly factor 7A | 5.72e-04 | 4.05e-03 | NA | 
| 2. P | P39011 | Bud emergence protein 4 | 4.27e-04 | 8.26e-03 | NA | 
| 2. P | P94583 | Response regulator aspartate phosphatase D | 5.53e-07 | 2.58e-03 | NA | 
| 2. P | Q752U3 | Mitochondrial group I intron splicing factor CCM1 | 1.67e-03 | 3.54e-02 | NA | 
| 2. P | O42393 | 43 kDa receptor-associated protein of the synapse | 8.66e-09 | 6.69e-06 | NA | 
| 2. P | A4III8 | Intraflagellar transport protein 56 | 1.37e-05 | 2.30e-04 | NA | 
| 2. P | P23610 | 40-kDa huntingtin-associated protein | 1.88e-04 | 4.10e-02 | NA | 
| 2. P | Q86TZ1 | Tetratricopeptide repeat protein 6 | 1.36e-08 | 3.26e-03 | NA | 
| 2. P | P12672 | 43 kDa receptor-associated protein of the synapse | 8.26e-10 | 4.80e-06 | NA | 
| 2. P | B4M4L4 | MAU2 chromatid cohesion factor homolog | 1.17e-07 | 2.34e-02 | NA | 
| 2. P | B4QZ45 | MAU2 chromatid cohesion factor homolog | 1.13e-07 | 1.79e-04 | NA | 
| 2. P | Q5TEA6 | Protein sel-1 homolog 2 | 1.65e-05 | 2.04e-02 | NA | 
| 2. P | B4GF49 | MAU2 chromatid cohesion factor homolog | 3.36e-07 | 1.68e-02 | NA | 
| 2. P | Q32NR4 | Tetratricopeptide repeat protein 29 | 6.55e-05 | 6.05e-04 | NA | 
| 2. P | Q6DCP6 | Dymeclin | 5.32e-03 | 8.75e-03 | NA | 
| 2. P | D3ZC96 | Tetratricopeptide repeat protein 39B | 3.00e-07 | 4.01e-03 | NA | 
| 2. P | Q4R6M4 | Tetratricopeptide repeat protein 29 | 1.76e-05 | 3.44e-06 | NA | 
| 2. P | B0WYS3 | MAU2 chromatid cohesion factor homolog | 3.69e-07 | 1.22e-03 | NA | 
| 2. P | O90758 | Soluble NSF attachment protein homolog FPV033 | NA | 3.00e-02 | NA | 
| 2. P | B4K4X6 | MAU2 chromatid cohesion factor homolog | 3.58e-07 | 4.46e-03 | NA | 
| 2. P | P07252 | Cytochrome B pre-mRNA-processing protein 1 | 3.49e-05 | 4.49e-02 | NA | 
| 2. P | Q8BYY4 | Tetratricopeptide repeat protein 39B | 2.27e-07 | 6.20e-03 | NA | 
| 2. P | Q28BM0 | Dymeclin | 3.12e-03 | 1.42e-03 | NA | 
| 2. P | P09914 | Interferon-induced protein with tetratricopeptide repeats 1 | 1.65e-13 | 6.05e-04 | NA | 
| 2. P | Q9C6B6 | ERAD-associated E3 ubiquitin-protein ligase component HRD3B | 5.33e-05 | 1.25e-02 | NA | 
| 2. P | A1Z8E9 | Bardet-Biedl syndrome 4 protein homolog | 2.30e-09 | 1.02e-05 | NA | 
| 2. P | Q9VFC0 | MAU2 chromatid cohesion factor homolog | 5.52e-07 | 1.79e-04 | NA | 
| 2. P | Q13702 | 43 kDa receptor-associated protein of the synapse | 6.40e-10 | 1.47e-06 | NA | 
| 2. P | Q2KHY7 | Tetratricopeptide repeat protein 23 | 1.58e-07 | 5.12e-10 | NA | 
| 2. P | B3M1B7 | MAU2 chromatid cohesion factor homolog | 1.52e-07 | 6.77e-04 | NA | 
| 2. P | Q9P2M1 | LRP2-binding protein | 2.87e-05 | 1.03e-04 | NA | 
| 2. P | Q296H8 | MAU2 chromatid cohesion factor homolog | 3.04e-07 | 1.68e-02 | NA | 
| 2. P | O81629 | Protein KINESIN LIGHT CHAIN-RELATED 1 | 3.45e-08 | 1.64e-04 | NA | 
| 2. P | Q9LII8 | Protein KINESIN LIGHT CHAIN-RELATED 2 | 1.32e-07 | 7.81e-04 | NA | 
| 2. P | P87312 | Pre-mRNA-splicing factor cwf4 | 5.65e-06 | 8.92e-03 | NA | 
| 2. P | Q4R5F5 | Interferon-induced protein with tetratricopeptide repeats 1 | 2.19e-13 | 8.89e-06 | NA | 
| 2. P | Q6DIV2 | Tetratricopeptide repeat protein 38 | 9.52e-07 | 1.20e-02 | NA | 
| 2. P | Q9EQR6 | Fanconi anemia group G protein homolog | 1.42e-07 | 4.25e-02 | NA | 
| 2. P | Q6IND7 | LRP2-binding protein | 1.27e-04 | 5.74e-03 | NA | 
| 2. P | Q92624 | Amyloid protein-binding protein 2 | 7.24e-07 | 1.18e-04 | NA | 
| 2. P | A6H6E9 | Tetratricopeptide repeat protein 23-like | 1.73e-06 | 6.92e-09 | NA | 
| 2. P | Q96RK4 | Bardet-Biedl syndrome 4 protein | 6.59e-07 | 1.88e-04 | NA | 
| 2. P | C6K7I2 | Importin subunit alpha-8 | 2.17e-04 | 1.34e-03 | NA | 
| 2. P | Q6DFB8 | Tetratricopeptide repeat protein 37 | 2.67e-04 | 5.76e-07 | NA | 
| 2. P | A0AVF1 | Intraflagellar transport protein 56 | 1.46e-05 | 9.53e-05 | NA | 
| 2. P | Q57ZL2 | Intraflagellar transport protein 56 homolog | 2.28e-07 | 1.49e-05 | NA | 
| 2. P | Q6NU53 | CCR4-NOT transcription complex subunit 10-B | 2.70e-05 | 4.06e-02 | NA | 
| 2. P | O42972 | UPF0588 membrane protein C20F10.02c | 4.32e-04 | 4.05e-03 | NA | 
| 2. P | Q758Z4 | Meiotic sister-chromatid recombination protein 6, mitochondrial | 9.51e-05 | 1.53e-02 | NA | 
| 2. P | B4PS83 | MAU2 chromatid cohesion factor homolog | 1.15e-07 | 3.32e-04 | NA | 
| 2. P | Q09266 | Uncharacterized protein C32D5.6 | 1.69e-06 | 8.50e-03 | NA | 
| 2. P | Q527H0 | Pre-mRNA-splicing factor CLF1 | 8.60e-05 | 7.65e-03 | NA | 
| 2. P | Q7KNA0 | Dymeclin | 3.76e-03 | 2.53e-03 | NA | 
| 2. P | Q4R350 | CCR4-NOT transcription complex subunit 10 | 1.84e-05 | 7.65e-03 | NA | 
| 2. P | Q5T764 | Interferon-induced protein with tetratricopeptide repeats 1B | 3.47e-13 | 3.29e-06 | NA | 
| 2. P | F4HSX9 | Protein KINESIN LIGHT CHAIN-RELATED 3 | 1.83e-08 | 8.29e-05 | NA | 
| 2. P | Q5PR66 | Intraflagellar transport protein 56 | 1.78e-05 | 2.82e-03 | NA | 
| 2. P | Q8CHY3 | Dymeclin | 2.19e-03 | 1.63e-02 | NA | 
| 2. P | Q5ZLW3 | Dymeclin | 5.57e-03 | 3.60e-03 | NA | 
| 2. P | Q03771 | Assembly chaperone of RPL4 | 1.28e-03 | 2.28e-02 | NA | 
| 2. P | Q4R3N2 | LRP2-binding protein | 3.51e-05 | 6.61e-05 | NA | 
| 2. P | Q5R3I4 | Tetratricopeptide repeat protein 38 | 1.25e-06 | 1.49e-02 | NA | 
| 2. P | Q9FGN7 | Sister chromatid cohesion protein SCC4 | 4.96e-07 | 3.51e-02 | NA | 
| 2. P | Q8CHY7 | Tetratricopeptide repeat protein 23 | 7.10e-07 | 9.67e-04 | NA | 
| 2. P | Q0V9D9 | Cytochrome c oxidase assembly factor 7 | 5.03e-04 | 2.79e-03 | NA | 
| 2. P | Q6PGP7 | Tetratricopeptide repeat protein 37 | 2.78e-04 | 2.70e-06 | NA | 
| 2. P | Q5XIA4 | CCR4-NOT transcription complex subunit 10 | 8.96e-06 | 4.91e-02 | NA | 
| 2. P | Q9UBV2 | Protein sel-1 homolog 1 | 8.16e-05 | 9.62e-03 | NA | 
| 2. P | A5PLI4 | LRP2-binding protein | 7.10e-05 | 4.48e-06 | NA | 
| 2. P | B4JHK2 | MAU2 chromatid cohesion factor homolog | 3.57e-07 | 4.22e-04 | NA | 
| 2. P | Q6BSP7 | Pre-mRNA-splicing factor CLF1 | 9.57e-06 | 8.34e-03 | NA | 
| 2. P | Q13325 | Interferon-induced protein with tetratricopeptide repeats 5 | 4.95e-13 | 1.35e-10 | NA | 
| 2. P | Q04748 | Protein SOV1, mitochondrial | 1.34e-03 | 1.43e-02 | NA | 
| 2. P | Q8NA56 | Tetratricopeptide repeat protein 29 | 5.09e-06 | 4.93e-07 | NA | 
| 2. P | Q10NT7 | ERAD-associated E3 ubiquitin-protein ligase component HRD3 | 2.19e-04 | 1.11e-03 | NA | 
| 2. P | B4ZIX8 | MAU2 chromatid cohesion factor homolog | 5.88e-07 | 4.70e-06 | NA | 
| 2. P | Q64345 | Interferon-induced protein with tetratricopeptide repeats 3 | 8.33e-07 | 1.28e-02 | NA | 
| 2. P | Q0IHP3 | Pentatricopeptide repeat-containing protein 3, mitochondrial | 1.30e-04 | 5.47e-03 | NA | 
| 2. P | P41842 | Tetratricopeptide repeat-containing protein trd-1 | 3.04e-07 | 1.28e-03 | NA | 
| 2. P | Q9UJX2 | Cell division cycle protein 23 homolog | 1.37e-06 | 8.02e-05 | NA | 
| 2. P | Q4PB37 | Pre-mRNA-splicing factor CLF1 | 1.50e-06 | 4.14e-02 | NA | 
| 2. P | Q8GZ63 | Pentatricopeptide repeat-containing protein At5g25630 | 5.47e-05 | 2.05e-03 | NA | 
| 2. P | Q8VY89 | Anaphase-promoting complex subunit 7 | 1.05e-05 | 3.61e-02 | NA | 
| 2. P | Q9LM25 | ERAD-associated E3 ubiquitin-protein ligase component HRD3A | 1.12e-04 | 5.03e-05 | NA | 
| 2. P | Q5U2N8 | Intraflagellar transport protein 56 | 3.25e-05 | 1.53e-04 | NA | 
| 2. P | Q9FXH1 | Pentatricopeptide repeat-containing protein At1g19720 | 1.89e-04 | 3.03e-02 | NA | 
| 2. P | Q28G25 | Bardet-Biedl syndrome 4 protein homolog | 9.38e-07 | 1.68e-04 | NA | 
| 2. P | Q5FWY3 | Cytochrome c oxidase assembly factor 7B | 6.08e-04 | 2.11e-03 | NA | 
| 2. P | Q9USP3 | Pentatricopeptide repeat-containing protein 6, mitochondrial | 6.17e-05 | 1.51e-03 | NA | 
| 2. P | Q8BGZ4 | Cell division cycle protein 23 homolog | 1.18e-05 | 8.56e-05 | NA | 
| 2. P | P09913 | Interferon-induced protein with tetratricopeptide repeats 2 | 4.02e-12 | 6.76e-14 | NA | 
| 2. P | Q9D2X5 | MAU2 chromatid cohesion factor homolog | 2.45e-07 | 4.37e-03 | NA | 
| 2. P | P08468 | Protein PET111, mitochondrial | 7.13e-05 | 1.60e-02 | NA | 
| 2. P | Q8BH15 | CCR4-NOT transcription complex subunit 10 | 1.93e-04 | 1.63e-02 | NA | 
| 2. P | B4HE12 | MAU2 chromatid cohesion factor homolog | 1.37e-07 | 1.08e-04 | NA | 
| 2. P | Q64282 | Interferon-induced protein with tetratricopeptide repeats 1 | 1.82e-12 | 9.41e-06 | NA | 
| 2. P | A8JA42 | Intraflagellar transport protein 56 | 1.49e-06 | 6.39e-05 | NA | 
| 2. P | Q6DE97 | CCR4-NOT transcription complex subunit 10-A | 1.40e-05 | 1.49e-02 | NA | 
| 2. P | Q4R7Z9 | Intraflagellar transport protein 56 | 1.27e-05 | 4.46e-05 | NA | 
| 2. P | Q54XP4 | Crooked neck-like protein 1 | 4.59e-06 | 2.58e-03 | NA | 
| 2. P | Q6NXR4 | TELO2-interacting protein 2 | 1.87e-04 | 4.64e-03 | NA | 
| 2. P | Q6FU45 | mRNA 3'-end-processing protein RNA14 | 1.38e-06 | 2.50e-02 | NA | 
| 2. P | G5EG38 | Cell division cycle protein 16 homolog | 1.84e-05 | 1.54e-02 | NA | 
| 2. P | Q8VE09 | Tetratricopeptide repeat protein 39C | 1.81e-06 | 4.96e-02 | NA | 
| 2. P | Q6AYP3 | Tetratricopeptide repeat protein 29 | 7.13e-06 | 2.30e-07 | NA | 
| 2. P | Q9DAX9 | Amyloid protein-binding protein 2 | 2.04e-07 | 1.08e-04 | NA | 
| 2. P | Q1JQ97 | Bardet-Biedl syndrome 4 protein homolog | 5.48e-07 | 2.04e-07 | NA | 
| 2. P | Q5W5X9 | Tetratricopeptide repeat protein 23 | 3.71e-06 | 5.71e-08 | NA | 
| 2. P | Q8RWS8 | Pentatricopeptide repeat-containing protein At2g41720 | 9.84e-06 | 1.70e-03 | NA | 
| 2. P | Q80VM3 | Tetratricopeptide repeat protein 29 | 8.99e-07 | 2.37e-08 | NA | 
| 2. P | Q8C1Z7 | Bardet-Biedl syndrome 4 protein homolog | 3.55e-07 | 1.40e-04 | NA | 
| 2. P | Q293C2 | Dymeclin | 6.85e-03 | 2.87e-04 | NA | 
| 2. P | Q4V7F0 | Tetratricopeptide repeat protein 23 | 1.57e-06 | 4.13e-04 | NA | 
| 2. P | Q9Y6X3 | MAU2 chromatid cohesion factor homolog | 1.46e-07 | 7.85e-06 | NA | 
| 2. P | A8MYJ7 | Tetratricopeptide repeat protein 34 | 9.38e-09 | 1.12e-02 | NA |