Summary

Q5TAA0

Homolog: Q8C159.
Function: Tetratricopeptide repeat protein 22.

Statistics

Total GO Annotation: 191
Unique PROST Go: 191
Unique BLAST Go: 0

Total Homologs: 149
Unique PROST Homologs: 147
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8C159 (Tetratricopeptide repeat protein 22) with a FATCAT P-Value: 0.0 and RMSD of 1.71 angstrom. The sequence alignment identity is 84.4%.
Structural alignment shown in left. Query protein Q5TAA0 colored as red in alignment, homolog Q8C159 colored as blue. Query protein Q5TAA0 is also shown in right top, homolog Q8C159 showed in right bottom. They are colored based on secondary structures. 

  Q5TAA0 MAELEAVADDLDALIDDLDYLPGHFHLEMQLNFEPRSPAPQRARDLKLQREGLRQELQLAAAPQRPAVRHLLGAFAFYLEELDEARECFLEVAHEHPGNL 100
  Q8C159 MTEAEVGAEDLDTLLDELDYLPGHFHLEMQLNFEPRSPAQLRARDLKLQREGLRQELELVATPQLPAVRHLLGTFSFYLEELGDAREHFLEVARKDPGNL 100

  Q5TAA0 NAWANLAHVYGRLGQEEEEEACAARLADLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEKRGWYF 200
  Q8C159 NAWANLAHVYGQLGQEEEEEASAGRLASLMGLEGDPEDAGDPRLRAARCLAEQGYAHGFDVGCASPEERAQVLEAGIALYDKALGYGQQIPIEEKRSWYF 200

  Q5TAA0 TMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKSEDPRHRALAWCYLGMLLERKDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR 300
  Q8C159 TMATLFIRLDGIFLEMGSEEQKRLPAFNRTLALLGEVLKSSDSRHQALAWCYVGMLLERKDTFSTTPMGVHEYGYSGTEPLDCFGKAIEIAKNQPPILNR 300

  Q5TAA0 LAKIFYFLGKQDMAIGTCNMALDVLRDPELNWQAYCTRAKIHIRAYLHDLKRAKMGLGGMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDA 400
  Q8C159 LAKIFHFLGKQDMAVGTCNMVLAVLTDPELNWQAYCTRAKVRIRAYVHDLERAKVGLGGLPDRNHLACAKADLEEVVKVCPSLRTYLDISQVYYYMGVDA 400

  Q5TAA0 VQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTDGFGCLLEALLAQWSQAQLSDGELGREVDAW 500
  Q8C159 MRELLAVDEAALNQALVFLAKAGELELGDTLPELQLLRGKCLRVQGEDANAAACFKRAVELDDEGSSHTEGFGCLLEALLAQWSQAQLSDGEVGYEVDVW 500

  Q5TAA0 LRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGRPALVRLLFETMEREGE--GASAPRDRRAVSF 569
  Q8C159 LRHAQGKYPAARLRQELQRVWRGHTEEVLGLARALVAQGRPALVRLLFETMEHEGEDAGGSG-KSR--VSS 568

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0009306 protein secretion
2. P GO:0021766 hippocampus development
2. P GO:0030014 CCR4-NOT complex
2. P GO:0035082 axoneme assembly
2. P GO:0030837 negative regulation of actin filament polymerization
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0071539 protein localization to centrosome
2. P GO:0000245 spliceosomal complex assembly
2. P GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:0060296 regulation of cilium beat frequency involved in ciliary motility
2. P GO:0050688 regulation of defense response to virus
2. P GO:0035327
2. P GO:0006641 triglyceride metabolic process
2. P GO:0046548 retinal rod cell development
2. P GO:0030992 intraciliary transport particle B
2. P GO:0030970 retrograde protein transport, ER to cytosol
2. P GO:2001255 positive regulation of histone H3-K36 trimethylation
2. P GO:0035720 intraciliary anterograde transport
2. P GO:0036513 Derlin-1 retrotranslocation complex
2. P GO:0034451 centriolar satellite
2. P GO:0003690 double-stranded DNA binding
2. P GO:0000963 mitochondrial RNA processing
2. P GO:0007271 synaptic transmission, cholinergic
2. P GO:1905198 manchette assembly
2. P GO:0016567 protein ubiquitination
2. P GO:0032091 negative regulation of protein binding
2. P GO:0035255 ionotropic glutamate receptor binding
2. P GO:0031126 sno(s)RNA 3'-end processing
2. P GO:0051321 meiotic cell cycle
2. P GO:0099634 postsynaptic specialization membrane
2. P GO:0009793 embryo development ending in seed dormancy
2. P GO:0019903 protein phosphatase binding
2. P GO:0055087 Ski complex
2. P GO:0007030 Golgi organization
2. P GO:1902855 regulation of non-motile cilium assembly
2. P GO:2000234 positive regulation of rRNA processing
2. P GO:0005929 cilium
2. P GO:0036503 ERAD pathway
2. P GO:0048487 beta-tubulin binding
2. P GO:0007268 chemical synaptic transmission
2. P GO:0071357 cellular response to type I interferon
2. P GO:0010874 regulation of cholesterol efflux
2. P GO:0038108 negative regulation of appetite by leptin-mediated signaling pathway
2. P GO:0008594 photoreceptor cell morphogenesis
2. P GO:0060324 face development
2. P GO:0003085 negative regulation of systemic arterial blood pressure
2. P GO:0032465 regulation of cytokinesis
2. P GO:0001895 retina homeostasis
2. P GO:0016072 rRNA metabolic process
2. P GO:0033564 anterior/posterior axon guidance
2. P GO:0051301 cell division
2. P GO:0060170 ciliary membrane
2. P GO:0008356 asymmetric cell division
2. P GO:0030674 protein-macromolecule adaptor activity
2. P GO:0001750 photoreceptor outer segment
2. P GO:1900075 positive regulation of neuromuscular synaptic transmission
2. P GO:0003341 cilium movement
2. P GO:0001015 snoRNA transcription by RNA polymerase II
2. P GO:0007098 centrosome cycle
2. P GO:0048854 brain morphogenesis
2. P GO:0000836 Hrd1p ubiquitin ligase complex
2. P GO:0034464 BBSome
2. P GO:0034088 maintenance of mitotic sister chromatid cohesion
2. P GO:0035176 social behavior
2. P GO:0090694 Scc2-Scc4 cohesin loading complex
2. P GO:0046907 intracellular transport
2. P GO:0060260 regulation of transcription initiation from RNA polymerase II promoter
2. P GO:0003735 structural constituent of ribosome
2. P GO:0007219 Notch signaling pathway
2. P GO:0030534 adult behavior
2. P GO:0030071 regulation of mitotic metaphase/anaphase transition
2. P GO:0009451 RNA modification
2. P GO:0120170 intraciliary transport particle B binding
2. P GO:0039023 pronephric duct morphogenesis
2. P GO:0060348 bone development
2. P GO:0015031 protein transport
2. P GO:0031938 obsolete regulation of chromatin silencing at telomere
2. P GO:2001165 positive regulation of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues
2. P GO:0045087 innate immune response
2. P GO:0009615 response to virus
2. P GO:0031145 anaphase-promoting complex-dependent catabolic process
2. P GO:0000281 mitotic cytokinesis
2. P GO:1905515 non-motile cilium assembly
2. P GO:0005856 cytoskeleton
2. P GO:0031047 gene silencing by RNA
2. P GO:0043495 protein-membrane adaptor activity
2. P GO:0090181 regulation of cholesterol metabolic process
2. P GO:0071006 U2-type catalytic step 1 spliceosome
2. P GO:0019060 intracellular transport of viral protein in host cell
2. P GO:0001917 photoreceptor inner segment
2. P GO:0006412 translation
2. P GO:0031462 Cul2-RING ubiquitin ligase complex
2. P GO:0051492 regulation of stress fiber assembly
2. P GO:0021756 striatum development
2. P GO:0036126 sperm flagellum
2. P GO:0071360 cellular response to exogenous dsRNA
2. P GO:0044321 response to leptin
2. P GO:0030659 cytoplasmic vesicle membrane
2. P GO:0030433 ubiquitin-dependent ERAD pathway
2. P GO:0003688 DNA replication origin binding
2. P GO:0097730 non-motile cilium
2. P GO:0035458 cellular response to interferon-beta
2. P GO:0016358 dendrite development
2. P GO:0061512 protein localization to cilium
2. P GO:0000839 Hrd1p ubiquitin ligase ERAD-L complex
2. P GO:0005819 spindle
2. P GO:0033130 acetylcholine receptor binding
2. P GO:1903546 protein localization to photoreceptor outer segment
2. P GO:0006836 neurotransmitter transport
2. P GO:0071014 post-mRNA release spliceosomal complex
2. P GO:0006270 DNA replication initiation
2. P GO:0097546 ciliary base
2. P GO:0051457 maintenance of protein location in nucleus
2. P GO:1903540 establishment of protein localization to postsynaptic membrane
2. P GO:0033365 protein localization to organelle
2. P GO:0099518 vesicle cytoskeletal trafficking
2. P GO:0000958 mitochondrial mRNA catabolic process
2. P GO:0033563 dorsal/ventral axon guidance
2. P GO:0045444 fat cell differentiation
2. P GO:0001843 neural tube closure
2. P GO:0005634 nucleus
2. P GO:0051097 negative regulation of helicase activity
2. P GO:0010239 chloroplast mRNA processing
2. P GO:0000242 pericentriolar material
2. P GO:0090262 regulation of transcription-coupled nucleotide-excision repair
2. P GO:0036064 ciliary basal body
2. P GO:2001173 regulation of histone H2B conserved C-terminal lysine ubiquitination
2. P GO:0016604 nuclear body
2. P GO:0045494 photoreceptor cell maintenance
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0070979 protein K11-linked ubiquitination
2. P GO:0071008 U2-type post-mRNA release spliceosomal complex
2. P GO:0046530 photoreceptor cell differentiation
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0000785 chromatin
2. P GO:0071004 U2-type prespliceosome
2. P GO:0051607 defense response to virus
2. P GO:0009949 polarity specification of anterior/posterior axis
2. P GO:0072423 response to DNA damage checkpoint signaling
2. P GO:0043014 alpha-tubulin binding
2. P GO:0045142 triplex DNA binding
2. P GO:0060613 fat pad development
2. P GO:0045071 negative regulation of viral genome replication
2. P GO:0040018 positive regulation of multicellular organism growth
2. P GO:2001209 positive regulation of transcription elongation from RNA polymerase I promoter
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0000354 cis assembly of pre-catalytic spliceosome
2. P GO:0005814 centriole
2. P GO:0070209 ASTRA complex
2. P GO:0006362 transcription elongation from RNA polymerase I promoter
2. P GO:0010887 negative regulation of cholesterol storage
2. P GO:0034452 dynactin binding
2. P GO:0035634 response to stilbenoid
2. P GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
2. P GO:0005794 Golgi apparatus
2. P GO:1990269 RNA polymerase II C-terminal domain phosphoserine binding
2. P GO:0007286 spermatid development
2. P GO:0021591 ventricular system development
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0060271 cilium assembly
2. P GO:0021987 cerebral cortex development
2. P GO:0007608 sensory perception of smell
2. P GO:0071007 U2-type catalytic step 2 spliceosome
2. P GO:1901626 regulation of postsynaptic membrane organization
2. P GO:0031514 motile cilium
2. P GO:0005813 centrosome
2. P GO:0035845 photoreceptor cell outer segment organization
2. P GO:0035457 cellular response to interferon-alpha
2. P GO:0042073 intraciliary transport
2. P GO:0005829 cytosol
2. P GO:0005739 mitochondrion
2. P GO:0030990 intraciliary transport particle
2. P GO:0034260 negative regulation of GTPase activity
2. P GO:0045842 positive regulation of mitotic metaphase/anaphase transition
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0071921 cohesin loading
2. P GO:0005680 anaphase-promoting complex
2. P GO:0030703 eggshell formation
2. P GO:1901525 negative regulation of mitophagy
2. P GO:0007224 smoothened signaling pathway
2. P GO:0019216 regulation of lipid metabolic process
2. P GO:0000974 Prp19 complex
2. P GO:0050893 sensory processing
2. P GO:0044782 cilium organization
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0032116 SMC loading complex
2. P GO:0035869 ciliary transition zone
2. P GO:0045880 positive regulation of smoothened signaling pathway
2. P GO:0032474 otolith morphogenesis
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8C159 Tetratricopeptide repeat protein 22 0.00e+00 3.61e-73 0.0
1. PB Q5TAA0 Tetratricopeptide repeat protein 22 0 4.09e-138 0.0
2. P P09108 43 kDa receptor-associated protein of the synapse 9.22e-09 3.21e-06 NA
2. P Q9D4C6 LRP2-binding protein 3.85e-05 5.87e-04 NA
2. P A5A6J9 Interferon-induced protein with tetratricopeptide repeats 3 4.58e-09 4.64e-06 NA
2. P Q9FRI5 Pentatricopeptide repeat-containing protein At1g25360 8.34e-05 4.78e-02 NA
2. P Q64112 Interferon-induced protein with tetratricopeptide repeats 2 1.77e-11 6.69e-13 NA
2. P Q16NZ8 MAU2 chromatid cohesion factor homolog 3.21e-07 6.57e-04 NA
2. P Q5RFF7 Tetratricopeptide repeat protein 38 1.11e-06 7.30e-03 NA
2. P P41889 Anaphase-promoting complex subunit cut9 3.04e-06 9.57e-04 NA
2. P A5HK05 Amyloid protein-binding protein 2 4.59e-06 5.37e-05 NA
2. P Q80Z70 Protein sel-1 homolog 1 5.22e-05 4.57e-02 NA
2. P Q569C2 LRP2-binding protein 3.64e-05 1.25e-04 NA
2. P A1A4R8 Cell division cycle protein 23 homolog 9.97e-08 6.97e-05 NA
2. P B3P0R4 MAU2 chromatid cohesion factor homolog 1.18e-07 1.33e-04 NA
2. P Q8BS45 Intraflagellar transport protein 56 3.25e-05 1.54e-04 NA
2. P B4NKT1 MAU2 chromatid cohesion factor homolog 6.58e-07 2.50e-04 NA
2. P Q6CJK2 Pre-mRNA-splicing factor CLF1 7.14e-06 7.02e-03 NA
2. P Q60462 Interferon-induced protein with tetratricopeptide repeats 2 4.41e-11 9.97e-13 NA
2. P B1H1Z8 MAU2 chromatid cohesion factor homolog 1.50e-07 2.18e-05 NA
2. P B4F766 Dymeclin 4.17e-03 3.51e-02 NA
2. P A3KPN8 Tetratricopeptide repeat protein 38 1.18e-06 5.96e-03 NA
2. P Q9WVM3 Anaphase-promoting complex subunit 7 4.36e-06 1.09e-02 NA
2. P P89105 RNA polymerase-associated protein CTR9 4.26e-06 5.33e-06 NA
2. P Q75CN2 Cargo-transport protein YPP1 5.88e-06 4.82e-02 NA
2. P O14879 Interferon-induced protein with tetratricopeptide repeats 3 1.80e-09 8.79e-06 NA
2. P Q9C6S6 Putative pentatricopeptide repeat-containing protein At1g31840 4.04e-05 2.06e-02 NA
2. P Q7SGD2 Pre-mRNA-splicing factor clf-1 3.02e-06 1.98e-02 NA
2. P O17581 Maternal uncoordinated protein 2 3.39e-06 4.64e-03 NA
2. P Q19294 Cell division cycle protein 23 homolog 5.37e-07 3.48e-02 NA
2. P A2VD82 Tetratricopeptide repeat protein 38 1.49e-06 8.74e-04 NA
2. P Q9Z2G6 Protein sel-1 homolog 1 4.95e-05 4.61e-02 NA
2. P Q9UJX3 Anaphase-promoting complex subunit 7 1.26e-05 1.48e-03 NA
2. P A7E727 Inclusion body clearance protein iml2 2.78e-05 1.39e-04 NA
2. P Q66KY0 Cytochrome c oxidase assembly factor 7A 5.72e-04 4.05e-03 NA
2. P P39011 Bud emergence protein 4 4.27e-04 8.26e-03 NA
2. P P94583 Response regulator aspartate phosphatase D 5.53e-07 2.58e-03 NA
2. P Q752U3 Mitochondrial group I intron splicing factor CCM1 1.67e-03 3.54e-02 NA
2. P O42393 43 kDa receptor-associated protein of the synapse 8.66e-09 6.69e-06 NA
2. P A4III8 Intraflagellar transport protein 56 1.37e-05 2.30e-04 NA
2. P P23610 40-kDa huntingtin-associated protein 1.88e-04 4.10e-02 NA
2. P Q86TZ1 Tetratricopeptide repeat protein 6 1.36e-08 3.26e-03 NA
2. P P12672 43 kDa receptor-associated protein of the synapse 8.26e-10 4.80e-06 NA
2. P B4M4L4 MAU2 chromatid cohesion factor homolog 1.17e-07 2.34e-02 NA
2. P B4QZ45 MAU2 chromatid cohesion factor homolog 1.13e-07 1.79e-04 NA
2. P Q5TEA6 Protein sel-1 homolog 2 1.65e-05 2.04e-02 NA
2. P B4GF49 MAU2 chromatid cohesion factor homolog 3.36e-07 1.68e-02 NA
2. P Q32NR4 Tetratricopeptide repeat protein 29 6.55e-05 6.05e-04 NA
2. P Q6DCP6 Dymeclin 5.32e-03 8.75e-03 NA
2. P D3ZC96 Tetratricopeptide repeat protein 39B 3.00e-07 4.01e-03 NA
2. P Q4R6M4 Tetratricopeptide repeat protein 29 1.76e-05 3.44e-06 NA
2. P B0WYS3 MAU2 chromatid cohesion factor homolog 3.69e-07 1.22e-03 NA
2. P O90758 Soluble NSF attachment protein homolog FPV033 NA 3.00e-02 NA
2. P B4K4X6 MAU2 chromatid cohesion factor homolog 3.58e-07 4.46e-03 NA
2. P P07252 Cytochrome B pre-mRNA-processing protein 1 3.49e-05 4.49e-02 NA
2. P Q8BYY4 Tetratricopeptide repeat protein 39B 2.27e-07 6.20e-03 NA
2. P Q28BM0 Dymeclin 3.12e-03 1.42e-03 NA
2. P P09914 Interferon-induced protein with tetratricopeptide repeats 1 1.65e-13 6.05e-04 NA
2. P Q9C6B6 ERAD-associated E3 ubiquitin-protein ligase component HRD3B 5.33e-05 1.25e-02 NA
2. P A1Z8E9 Bardet-Biedl syndrome 4 protein homolog 2.30e-09 1.02e-05 NA
2. P Q9VFC0 MAU2 chromatid cohesion factor homolog 5.52e-07 1.79e-04 NA
2. P Q13702 43 kDa receptor-associated protein of the synapse 6.40e-10 1.47e-06 NA
2. P Q2KHY7 Tetratricopeptide repeat protein 23 1.58e-07 5.12e-10 NA
2. P B3M1B7 MAU2 chromatid cohesion factor homolog 1.52e-07 6.77e-04 NA
2. P Q9P2M1 LRP2-binding protein 2.87e-05 1.03e-04 NA
2. P Q296H8 MAU2 chromatid cohesion factor homolog 3.04e-07 1.68e-02 NA
2. P O81629 Protein KINESIN LIGHT CHAIN-RELATED 1 3.45e-08 1.64e-04 NA
2. P Q9LII8 Protein KINESIN LIGHT CHAIN-RELATED 2 1.32e-07 7.81e-04 NA
2. P P87312 Pre-mRNA-splicing factor cwf4 5.65e-06 8.92e-03 NA
2. P Q4R5F5 Interferon-induced protein with tetratricopeptide repeats 1 2.19e-13 8.89e-06 NA
2. P Q6DIV2 Tetratricopeptide repeat protein 38 9.52e-07 1.20e-02 NA
2. P Q9EQR6 Fanconi anemia group G protein homolog 1.42e-07 4.25e-02 NA
2. P Q6IND7 LRP2-binding protein 1.27e-04 5.74e-03 NA
2. P Q92624 Amyloid protein-binding protein 2 7.24e-07 1.18e-04 NA
2. P A6H6E9 Tetratricopeptide repeat protein 23-like 1.73e-06 6.92e-09 NA
2. P Q96RK4 Bardet-Biedl syndrome 4 protein 6.59e-07 1.88e-04 NA
2. P C6K7I2 Importin subunit alpha-8 2.17e-04 1.34e-03 NA
2. P Q6DFB8 Tetratricopeptide repeat protein 37 2.67e-04 5.76e-07 NA
2. P A0AVF1 Intraflagellar transport protein 56 1.46e-05 9.53e-05 NA
2. P Q57ZL2 Intraflagellar transport protein 56 homolog 2.28e-07 1.49e-05 NA
2. P Q6NU53 CCR4-NOT transcription complex subunit 10-B 2.70e-05 4.06e-02 NA
2. P O42972 UPF0588 membrane protein C20F10.02c 4.32e-04 4.05e-03 NA
2. P Q758Z4 Meiotic sister-chromatid recombination protein 6, mitochondrial 9.51e-05 1.53e-02 NA
2. P B4PS83 MAU2 chromatid cohesion factor homolog 1.15e-07 3.32e-04 NA
2. P Q09266 Uncharacterized protein C32D5.6 1.69e-06 8.50e-03 NA
2. P Q527H0 Pre-mRNA-splicing factor CLF1 8.60e-05 7.65e-03 NA
2. P Q7KNA0 Dymeclin 3.76e-03 2.53e-03 NA
2. P Q4R350 CCR4-NOT transcription complex subunit 10 1.84e-05 7.65e-03 NA
2. P Q5T764 Interferon-induced protein with tetratricopeptide repeats 1B 3.47e-13 3.29e-06 NA
2. P F4HSX9 Protein KINESIN LIGHT CHAIN-RELATED 3 1.83e-08 8.29e-05 NA
2. P Q5PR66 Intraflagellar transport protein 56 1.78e-05 2.82e-03 NA
2. P Q8CHY3 Dymeclin 2.19e-03 1.63e-02 NA
2. P Q5ZLW3 Dymeclin 5.57e-03 3.60e-03 NA
2. P Q03771 Assembly chaperone of RPL4 1.28e-03 2.28e-02 NA
2. P Q4R3N2 LRP2-binding protein 3.51e-05 6.61e-05 NA
2. P Q5R3I4 Tetratricopeptide repeat protein 38 1.25e-06 1.49e-02 NA
2. P Q9FGN7 Sister chromatid cohesion protein SCC4 4.96e-07 3.51e-02 NA
2. P Q8CHY7 Tetratricopeptide repeat protein 23 7.10e-07 9.67e-04 NA
2. P Q0V9D9 Cytochrome c oxidase assembly factor 7 5.03e-04 2.79e-03 NA
2. P Q6PGP7 Tetratricopeptide repeat protein 37 2.78e-04 2.70e-06 NA
2. P Q5XIA4 CCR4-NOT transcription complex subunit 10 8.96e-06 4.91e-02 NA
2. P Q9UBV2 Protein sel-1 homolog 1 8.16e-05 9.62e-03 NA
2. P A5PLI4 LRP2-binding protein 7.10e-05 4.48e-06 NA
2. P B4JHK2 MAU2 chromatid cohesion factor homolog 3.57e-07 4.22e-04 NA
2. P Q6BSP7 Pre-mRNA-splicing factor CLF1 9.57e-06 8.34e-03 NA
2. P Q13325 Interferon-induced protein with tetratricopeptide repeats 5 4.95e-13 1.35e-10 NA
2. P Q04748 Protein SOV1, mitochondrial 1.34e-03 1.43e-02 NA
2. P Q8NA56 Tetratricopeptide repeat protein 29 5.09e-06 4.93e-07 NA
2. P Q10NT7 ERAD-associated E3 ubiquitin-protein ligase component HRD3 2.19e-04 1.11e-03 NA
2. P B4ZIX8 MAU2 chromatid cohesion factor homolog 5.88e-07 4.70e-06 NA
2. P Q64345 Interferon-induced protein with tetratricopeptide repeats 3 8.33e-07 1.28e-02 NA
2. P Q0IHP3 Pentatricopeptide repeat-containing protein 3, mitochondrial 1.30e-04 5.47e-03 NA
2. P P41842 Tetratricopeptide repeat-containing protein trd-1 3.04e-07 1.28e-03 NA
2. P Q9UJX2 Cell division cycle protein 23 homolog 1.37e-06 8.02e-05 NA
2. P Q4PB37 Pre-mRNA-splicing factor CLF1 1.50e-06 4.14e-02 NA
2. P Q8GZ63 Pentatricopeptide repeat-containing protein At5g25630 5.47e-05 2.05e-03 NA
2. P Q8VY89 Anaphase-promoting complex subunit 7 1.05e-05 3.61e-02 NA
2. P Q9LM25 ERAD-associated E3 ubiquitin-protein ligase component HRD3A 1.12e-04 5.03e-05 NA
2. P Q5U2N8 Intraflagellar transport protein 56 3.25e-05 1.53e-04 NA
2. P Q9FXH1 Pentatricopeptide repeat-containing protein At1g19720 1.89e-04 3.03e-02 NA
2. P Q28G25 Bardet-Biedl syndrome 4 protein homolog 9.38e-07 1.68e-04 NA
2. P Q5FWY3 Cytochrome c oxidase assembly factor 7B 6.08e-04 2.11e-03 NA
2. P Q9USP3 Pentatricopeptide repeat-containing protein 6, mitochondrial 6.17e-05 1.51e-03 NA
2. P Q8BGZ4 Cell division cycle protein 23 homolog 1.18e-05 8.56e-05 NA
2. P P09913 Interferon-induced protein with tetratricopeptide repeats 2 4.02e-12 6.76e-14 NA
2. P Q9D2X5 MAU2 chromatid cohesion factor homolog 2.45e-07 4.37e-03 NA
2. P P08468 Protein PET111, mitochondrial 7.13e-05 1.60e-02 NA
2. P Q8BH15 CCR4-NOT transcription complex subunit 10 1.93e-04 1.63e-02 NA
2. P B4HE12 MAU2 chromatid cohesion factor homolog 1.37e-07 1.08e-04 NA
2. P Q64282 Interferon-induced protein with tetratricopeptide repeats 1 1.82e-12 9.41e-06 NA
2. P A8JA42 Intraflagellar transport protein 56 1.49e-06 6.39e-05 NA
2. P Q6DE97 CCR4-NOT transcription complex subunit 10-A 1.40e-05 1.49e-02 NA
2. P Q4R7Z9 Intraflagellar transport protein 56 1.27e-05 4.46e-05 NA
2. P Q54XP4 Crooked neck-like protein 1 4.59e-06 2.58e-03 NA
2. P Q6NXR4 TELO2-interacting protein 2 1.87e-04 4.64e-03 NA
2. P Q6FU45 mRNA 3'-end-processing protein RNA14 1.38e-06 2.50e-02 NA
2. P G5EG38 Cell division cycle protein 16 homolog 1.84e-05 1.54e-02 NA
2. P Q8VE09 Tetratricopeptide repeat protein 39C 1.81e-06 4.96e-02 NA
2. P Q6AYP3 Tetratricopeptide repeat protein 29 7.13e-06 2.30e-07 NA
2. P Q9DAX9 Amyloid protein-binding protein 2 2.04e-07 1.08e-04 NA
2. P Q1JQ97 Bardet-Biedl syndrome 4 protein homolog 5.48e-07 2.04e-07 NA
2. P Q5W5X9 Tetratricopeptide repeat protein 23 3.71e-06 5.71e-08 NA
2. P Q8RWS8 Pentatricopeptide repeat-containing protein At2g41720 9.84e-06 1.70e-03 NA
2. P Q80VM3 Tetratricopeptide repeat protein 29 8.99e-07 2.37e-08 NA
2. P Q8C1Z7 Bardet-Biedl syndrome 4 protein homolog 3.55e-07 1.40e-04 NA
2. P Q293C2 Dymeclin 6.85e-03 2.87e-04 NA
2. P Q4V7F0 Tetratricopeptide repeat protein 23 1.57e-06 4.13e-04 NA
2. P Q9Y6X3 MAU2 chromatid cohesion factor homolog 1.46e-07 7.85e-06 NA
2. P A8MYJ7 Tetratricopeptide repeat protein 34 9.38e-09 1.12e-02 NA