Summary

Q5TBK1

Homolog: Q3V2Q8.
Function: NEDD4-binding protein 2-like 1.

Statistics

Total GO Annotation: 81
Unique PROST Go: 38
Unique BLAST Go: 43

Total Homologs: 64
Unique PROST Homologs: 47
Unique BLAST Homologs: 14

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3V2Q8 (NEDD4-binding protein 2-like 1) with a FATCAT P-Value: 2.12e-11 and RMSD of 3.12 angstrom. The sequence alignment identity is 84.1%.
Structural alignment shown in left. Query protein Q5TBK1 colored as red in alignment, homolog Q3V2Q8 colored as blue. Query protein Q5TBK1 is also shown in right top, homolog Q3V2Q8 showed in right bottom. They are colored based on secondary structures. 

  Q5TBK1 MEDSFLQSFGRLSLQPQQQQQRQRPPRPPP-RGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWN 99
  Q3V2Q8 MEDSFLESFGRLSL---QQRQQQPPPRPPPARGPPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDYPRALIFSTDDFFFKEDGTYEFNPNLLEEAHEWN 97

  Q5TBK1 QKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQD 199
  Q3V2Q8 QRRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVPKEKIQRMKERYEHNVTFHSVLHAEKPSRANRNQG 197

  Q5TBK1 RNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRGGCHH-GY 243
  Q3V2Q8 RNSE-PSSGSGYWNTYTELPNRRANGLYSNE-GY-RRGG-HHQGY 238

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0048364 root development
2. P GO:0019344 cysteine biosynthetic process
2. P GO:0044206 UMP salvage
2. P GO:0006754 ATP biosynthetic process
2. P GO:0005524 ATP binding
2. P GO:0048678 response to axon injury
2. P GO:0000103 sulfate assimilation
2. P GO:0006163 purine nucleotide metabolic process
2. P GO:0004331 fructose-2,6-bisphosphate 2-phosphatase activity
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0003873 6-phosphofructo-2-kinase activity
2. P GO:0006172 ADP biosynthetic process
2. P GO:0004849 uridine kinase activity
2. P GO:0046033 AMP metabolic process
2. P GO:0004017 adenylate kinase activity
2. P GO:0090038 negative regulation of protein kinase C signaling
2. P GO:0070814 hydrogen sulfide biosynthetic process
2. P GO:2000114 regulation of establishment of cell polarity
2. P GO:0044211 CTP salvage
2. P GO:0048367 shoot system development
2. P GO:0046034 ATP metabolic process
2. P GO:0005829 cytosol
2. P GO:0005739 mitochondrion
2. P GO:0006000 fructose metabolic process
2. P GO:0071453 cellular response to oxygen levels
2. P GO:0007631 feeding behavior
2. P GO:0008976 polyphosphate kinase activity
2. P GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
2. P GO:0004020 adenylylsulfate kinase activity
2. P GO:0030808 regulation of nucleotide biosynthetic process
2. P GO:0004127 cytidylate kinase activity
2. P GO:0046705 CDP biosynthetic process
2. P GO:0016301 kinase activity
2. P GO:0009086 methionine biosynthetic process
2. P GO:0016740 transferase activity
2. P GO:0006003 fructose 2,6-bisphosphate metabolic process
2. P GO:0006225 UDP biosynthetic process
2. P GO:0006110 regulation of glycolytic process
3. B GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
3. B GO:0005902 microvillus
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0035748 myelin sheath abaxonal region
3. B GO:0016020 membrane
3. B GO:0032496 response to lipopolysaccharide
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0005874 microtubule
3. B GO:0070062 extracellular exosome
3. B GO:0061769 ribosylnicotinate kinase activity
3. B GO:0048709 oligodendrocyte differentiation
3. B GO:0042995 cell projection
3. B GO:0005743 mitochondrial inner membrane
3. B GO:1902037 negative regulation of hematopoietic stem cell differentiation
3. B GO:0004113 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
3. B GO:0050262 ribosylnicotinamide kinase activity
3. B GO:0043209 myelin sheath
3. B GO:0017053 transcription repressor complex
3. B GO:0009214 cyclic nucleotide catabolic process
3. B GO:0021762 substantia nigra development
3. B GO:0001701 in utero embryonic development
3. B GO:0007409 axonogenesis
3. B GO:0009636 response to toxic substance
3. B GO:0003714 transcription corepressor activity
3. B GO:0031143 pseudopodium
3. B GO:0001824 blastocyst development
3. B GO:0046902 regulation of mitochondrial membrane permeability
3. B GO:0042470 melanosome
3. B GO:0030551 cyclic nucleotide binding
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0016607 nuclear speck
3. B GO:0046404 polydeoxyribonucleotide 5'-hydroxyl-kinase activity
3. B GO:0008344 adult locomotory behavior
3. B GO:0003723 RNA binding
3. B GO:0043915 L-seryl-tRNA(Sec) kinase activity
3. B GO:0035749 myelin sheath adaxonal region
3. B GO:0032204 regulation of telomere maintenance
3. B GO:0007568 aging
3. B GO:0030900 forebrain development
3. B GO:0005741 mitochondrial outer membrane
3. B GO:0005615 extracellular space
3. B GO:1902035 positive regulation of hematopoietic stem cell proliferation
3. B GO:0019899 enzyme binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3V2Q8 NEDD4-binding protein 2-like 1 2.12e-11 9.41e-85 8.28e-133
1. PB Q5TBK1 NEDD4-binding protein 2-like 1 0 1.76e-134 0.0
1. PB Q29S05 NEDD4-binding protein 2-like 1 7.35e-09 1.91e-02 5.81e-78
2. P B8D0S4 Adenylyl-sulfate kinase 2.92e-04 1.30e-02 NA
2. P P9WL54 Putative O-phosphotransferase MT2714 7.38e-05 2.06e-02 NA
2. P P65040 Putative O-phosphotransferase Mb2669 5.60e-05 2.06e-02 NA
2. P A0QQV6 GDP-polyphosphate phosphotransferase 1.67e-02 4.05e-02 NA
2. P P57702 Adenylyl-sulfate kinase 1.53e-03 3.73e-02 NA
2. P Q9FK35 Adenylate kinase 3 8.66e-05 4.08e-02 NA
2. P Q08479 Adenylate kinase 3 8.56e-03 4.89e-03 NA
2. P P0A4M2 Toxin zeta 1.25e-05 1.50e-03 NA
2. P Q12657 Adenylyl-sulfate kinase 1.63e-04 5.54e-03 NA
2. P A7E8H8 Adenylate kinase 4.19e-03 8.62e-03 NA
2. P Q1I2K4 Adenylyl-sulfate kinase 2.24e-03 1.62e-02 NA
2. P Q4L9E6 Adenylyl-sulfate kinase 1.95e-03 1.93e-02 NA
2. P Q49UM5 Adenylyl-sulfate kinase 3.79e-04 7.35e-03 NA
2. P Q93CM1 Toxin zeta 6.60e-05 9.90e-04 NA
2. P Q54944 Toxin zeta 1.41e-05 1.22e-04 NA
2. P Q0V3D5 Adenylate kinase 3.62e-03 3.48e-02 NA
2. P A6RHI1 Adenylate kinase 3.61e-03 3.04e-02 NA
2. P Q1D6P1 Adenylyl-sulfate kinase 3.39e-05 1.18e-04 NA
2. P A6RPU0 Adenylate kinase 4.76e-03 4.54e-02 NA
2. P Q08480 Adenylate kinase 4 9.17e-03 6.75e-03 NA
2. P A9CKA8 ADP-polyphosphate phosphotransferase 2.00e-02 3.41e-02 NA
2. P Q99PM9 Uridine-cytidine kinase 2 2.83e-02 1.53e-02 NA
2. P Q92203 Adenylyl-sulfate kinase 1.26e-04 2.77e-02 NA
2. P Q92ZU4 ADP-polyphosphate phosphotransferase 3 3.09e-02 8.23e-03 NA
2. P Q8CR04 Adenylyl-sulfate kinase 3.60e-04 2.65e-02 NA
2. P Q97QZ1 Toxin PezT 4.35e-06 1.79e-07 NA
2. P Q10S93 Probable adenylate kinase 1, chloroplastic 3.54e-02 3.15e-02 NA
2. P Q56148 Chloramphenicol 3-O phosphotransferase 2.44e-05 1.34e-02 NA
2. P Q9P7G9 Adenylyl-sulfate kinase 5.37e-04 2.34e-02 NA
2. P Q9QYG8 Uridine-cytidine kinase 2 2.78e-02 1.53e-02 NA
2. P Q9HA47 Uridine-cytidine kinase 1 8.97e-03 1.15e-02 NA
2. P Q9I154 ADP-polyphosphate phosphotransferase 9.59e-02 6.44e-04 NA
2. P Q5HL02 Adenylyl-sulfate kinase 3.54e-04 4.01e-02 NA
2. P Q07Y94 Adenylyl-sulfate kinase 3.41e-04 4.16e-03 NA
2. P Q12471 6-phosphofructo-2-kinase 2 1.05e-03 1.70e-09 NA
2. P P34346 Adenylate kinase 1.81e-03 1.14e-02 NA
2. P B0CAX3 Adenylyl-sulfate kinase 3.68e-04 1.83e-03 NA
2. P P49982 Adenylate kinase 3.60e-03 2.42e-03 NA
2. P O05877 GDP-polyphosphate phosphotransferase 8.20e-02 8.87e-03 NA
2. P P0A4M1 Toxin zeta 1.23e-05 1.50e-03 NA
2. P Q4R4K2 Uridine-cytidine kinase 1 1.60e-02 8.44e-04 NA
2. P B9LKC1 Adenylyl-sulfate kinase 8.42e-05 2.40e-02 NA
2. P Q930V2 ADP-polyphosphate phosphotransferase 2 1.19e-02 3.26e-02 NA
2. P B2W0K4 Adenylate kinase 2.26e-03 1.41e-02 NA
2. P B1H116 Uridine-cytidine kinase 2 3.61e-03 4.27e-02 NA
2. P Q5VRN0 UMP-CMP kinase 1 2.94e-03 4.83e-02 NA
2. P P9WL55 Putative O-phosphotransferase Rv2636 7.57e-05 2.06e-02 NA
3. B Q8JZS6 NEDD4-binding protein 2-like 2 1.44e-05 NA 6.86e-47
3. B P09543 2',3'-cyclic-nucleotide 3'-phosphodiesterase 7.65e-05 NA 5.02e-12
3. B Q92802 NEDD4-binding protein 2-like 2 2.51e-06 NA 4.15e-47
3. B Q9R0I7 YLP motif-containing protein 1 4.61e-02 NA 2.04e-07
3. B P49750 YLP motif-containing protein 1 2.27e-01 NA 3.15e-06
3. B Q8TUS5 L-seryl-tRNA(Sec) kinase 2.55e-05 NA 0.015
3. B P16330 2',3'-cyclic-nucleotide 3'-phosphodiesterase 5.76e-05 NA 1.39e-10
3. B Q9NWW6 Nicotinamide riboside kinase 1 1.86e-02 NA 0.023
3. B Q5RFD0 2',3'-cyclic-nucleotide 3'-phosphodiesterase 8.94e-05 NA 6.86e-12
3. B P06623 2',3'-cyclic-nucleotide 3'-phosphodiesterase 1.55e-05 NA 7.47e-10
3. B Q86UW6 NEDD4-binding protein 2 5.00e-03 NA 3.77e-48
3. B P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase 1.49e-04 NA 2.41e-11
3. B Q66H65 NEDD4-binding protein 2-like 2 5.57e-07 NA 2.46e-47
3. B P0CB49 YLP motif-containing protein 1 5.30e-02 NA 1.70e-07