Summary

Q5TFQ8

Homolog: O00241.
Function: Signal-regulatory protein beta-1.

Statistics

Total GO Annotation: 835
Unique PROST Go: 493
Unique BLAST Go: 108

Total Homologs: 678
Unique PROST Homologs: 419
Unique BLAST Homologs: 124

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was O00241 (Signal-regulatory protein beta-1) with a FATCAT P-Value: 0.0 and RMSD of 2.61 angstrom. The sequence alignment identity is 87.5%.
Structural alignment shown in left. Query protein Q5TFQ8 colored as red in alignment, homolog O00241 colored as blue. Query protein Q5TFQ8 is also shown in right top, homolog O00241 showed in right bottom. They are colored based on secondary structures. 

  Q5TFQ8 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNN 100
  O00241 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNN 100

  Q5TFQ8 MDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPA 200
  O00241 LDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPA 200

  Q5TFQ8 GDSVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST 300
  O00241 GDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQLTWLENGNVSRTETAST 300

  Q5TFQ8 LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSN-TAPGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA 398
  O00241 LIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEA-ALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA 398

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0071281 cellular response to iron ion
1. PB GO:0042277 peptide binding
1. PB GO:0071346 cellular response to interferon-gamma
1. PB GO:0046007 negative regulation of activated T cell proliferation
1. PB GO:0033010 paranodal junction
1. PB GO:0001815 positive regulation of antibody-dependent cellular cytotoxicity
1. PB GO:0019226 transmission of nerve impulse
1. PB GO:0019886 antigen processing and presentation of exogenous peptide antigen via MHC class II
1. PB GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules
1. PB GO:0032720 negative regulation of tumor necrosis factor production
1. PB GO:0042608 T cell receptor binding
1. PB GO:0071593 lymphocyte aggregation
1. PB GO:0032673 regulation of interleukin-4 production
1. PB GO:0002477 antigen processing and presentation of exogenous peptide antigen via MHC class Ib
1. PB GO:0045178 basal part of cell
1. PB GO:0046979 TAP2 binding
1. PB GO:0010106 cellular response to iron ion starvation
1. PB GO:0036037 CD8-positive, alpha-beta T cell activation
1. PB GO:0010039 response to iron ion
1. PB GO:1990782 protein tyrosine kinase binding
1. PB GO:0010008 endosome membrane
1. PB GO:0098880 maintenance of postsynaptic specialization structure
1. PB GO:0042446 hormone biosynthetic process
1. PB GO:1901215 negative regulation of neuron death
1. PB GO:0001819 positive regulation of cytokine production
1. PB GO:0050860 negative regulation of T cell receptor signaling pathway
1. PB GO:0030424 axon
1. PB GO:0042610 CD8 receptor binding
1. PB GO:0002250 adaptive immune response
1. PB GO:0031902 late endosome membrane
1. PB GO:0030669 clathrin-coated endocytic vesicle membrane
1. PB GO:0002503 peptide antigen assembly with MHC class II protein complex
1. PB GO:0050778 positive regulation of immune response
1. PB GO:0032759 positive regulation of TRAIL production
1. PB GO:0001913 T cell mediated cytotoxicity
1. PB GO:0003823 antigen binding
1. PB GO:0032743 positive regulation of interleukin-2 production
1. PB GO:2000273 positive regulation of signaling receptor activity
1. PB GO:0005911 cell-cell junction
1. PB GO:0023026 MHC class II protein complex binding
1. PB GO:0044877 protein-containing complex binding
1. PB GO:0001812 positive regulation of type I hypersensitivity
1. PB GO:0032729 positive regulation of interferon-gamma production
1. PB GO:0019903 protein phosphatase binding
1. PB GO:0099054 presynapse assembly
1. PB GO:0042288 MHC class I protein binding
1. PB GO:1900016 negative regulation of cytokine production involved in inflammatory response
1. PB GO:0031901 early endosome membrane
1. PB GO:0032398 MHC class Ib protein complex
1. PB GO:0006959 humoral immune response
1. PB GO:1900121 negative regulation of receptor binding
1. PB GO:0071556 integral component of lumenal side of endoplasmic reticulum membrane
1. PB GO:1990641 response to iron ion starvation
1. PB GO:0045019 negative regulation of nitric oxide biosynthetic process
1. PB GO:0098636 protein complex involved in cell adhesion
1. PB GO:0002489 antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
1. PB GO:0002451 peripheral B cell tolerance induction
1. PB GO:0005615 extracellular space
1. PB GO:0002626 negative regulation of T cell antigen processing and presentation
1. PB GO:0009986 cell surface
1. PB GO:0002344 B cell affinity maturation
1. PB GO:0050689 negative regulation of defense response to virus by host
1. PB GO:0042110 T cell activation
1. PB GO:0032680 regulation of tumor necrosis factor production
1. PB GO:0030695 GTPase regulator activity
1. PB GO:0009897 external side of plasma membrane
1. PB GO:0090277 positive regulation of peptide hormone secretion
1. PB GO:0010770 positive regulation of cell morphogenesis involved in differentiation
1. PB GO:0005737 cytoplasm
1. PB GO:0002416 IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor
1. PB GO:0001916 positive regulation of T cell mediated cytotoxicity
1. PB GO:0032653 regulation of interleukin-10 production
1. PB GO:0050766 positive regulation of phagocytosis
1. PB GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
1. PB GO:2001187 positive regulation of CD8-positive, alpha-beta T cell activation
1. PB GO:0070593 dendrite self-avoidance
1. PB GO:0010977 negative regulation of neuron projection development
1. PB GO:0016323 basolateral plasma membrane
1. PB GO:0008037 cell recognition
1. PB GO:0032753 positive regulation of interleukin-4 production
1. PB GO:0070062 extracellular exosome
1. PB GO:0019884 antigen processing and presentation of exogenous antigen
1. PB GO:0006955 immune response
1. PB GO:0006910 phagocytosis, recognition
1. PB GO:0042101 T cell receptor complex
1. PB GO:0002579 positive regulation of antigen processing and presentation
1. PB GO:0001798 positive regulation of type IIa hypersensitivity
1. PB GO:0002728 negative regulation of natural killer cell cytokine production
1. PB GO:0002486 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent
1. PB GO:0062061 TAP complex binding
1. PB GO:0030881 beta-2-microglobulin binding
1. PB GO:0051606 detection of stimulus
1. PB GO:0030658 transport vesicle membrane
1. PB GO:0002476 antigen processing and presentation of endogenous peptide antigen via MHC class Ib
1. PB GO:0097021 lymphocyte migration into lymphoid organs
1. PB GO:0042130 negative regulation of T cell proliferation
1. PB GO:0060586 multicellular organismal iron ion homeostasis
1. PB GO:0002469 myeloid dendritic cell antigen processing and presentation
1. PB GO:0046635 positive regulation of alpha-beta T cell activation
1. PB GO:0005886 plasma membrane
1. PB GO:0006911 phagocytosis, engulfment
1. PB GO:0034987 immunoglobulin receptor binding
1. PB GO:0055038 recycling endosome membrane
1. PB GO:0043322 negative regulation of natural killer cell degranulation
1. PB GO:0007520 myoblast fusion
1. PB GO:0101003 ficolin-1-rich granule membrane
1. PB GO:2001186 negative regulation of CD8-positive, alpha-beta T cell activation
1. PB GO:0071349 cellular response to interleukin-12
1. PB GO:0002854 positive regulation of T cell mediated cytotoxicity directed against tumor cell target
1. PB GO:0045087 innate immune response
1. PB GO:0019864 IgG binding
1. PB GO:0032831 positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation
1. PB GO:0002715 regulation of natural killer cell mediated immunity
1. PB GO:0042271 susceptibility to natural killer cell mediated cytotoxicity
1. PB GO:0032588 trans-Golgi network membrane
1. PB GO:0071222 cellular response to lipopolysaccharide
1. PB GO:1990405 protein antigen binding
1. PB GO:1904437 positive regulation of transferrin receptor binding
1. PB GO:0042824 MHC class I peptide loading complex
1. PB GO:0050765 negative regulation of phagocytosis
1. PB GO:0019882 antigen processing and presentation
1. PB GO:0002842 positive regulation of T cell mediated immune response to tumor cell
1. PB GO:0048002 antigen processing and presentation of peptide antigen
1. PB GO:0048839 inner ear development
1. PB GO:0002504 antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
1. PB GO:0007411 axon guidance
1. PB GO:0002455 humoral immune response mediated by circulating immunoglobulin
1. PB GO:0046703 natural killer cell lectin-like receptor binding
1. PB GO:0050870 positive regulation of T cell activation
1. PB GO:0071347 cellular response to interleukin-1
1. PB GO:0042605 peptide antigen binding
1. PB GO:2000516 positive regulation of CD4-positive, alpha-beta T cell activation
1. PB GO:0097530 granulocyte migration
1. PB GO:0002491 antigen processing and presentation of endogenous peptide antigen via MHC class II
1. PB GO:0030670 phagocytic vesicle membrane
1. PB GO:0071650 negative regulation of chemokine (C-C motif) ligand 5 production
1. PB GO:0031295 T cell costimulation
1. PB GO:0005102 signaling receptor binding
1. PB GO:0042613 MHC class II protein complex
1. PB GO:0097241 hematopoietic stem cell migration to bone marrow
1. PB GO:0070301 cellular response to hydrogen peroxide
1. PB GO:0002645 positive regulation of tolerance induction
1. PB GO:1904283 negative regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I
1. PB GO:0001562 response to protozoan
1. PB GO:0045123 cellular extravasation
1. PB GO:1900122 positive regulation of receptor binding
1. PB GO:0033268 node of Ranvier
1. PB GO:2000272 negative regulation of signaling receptor activity
1. PB GO:0002355 detection of tumor cell
1. PB GO:2001199 negative regulation of dendritic cell differentiation
1. PB GO:0002729 positive regulation of natural killer cell cytokine production
1. PB GO:0045428 regulation of nitric oxide biosynthetic process
1. PB GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
1. PB GO:0098942 retrograde trans-synaptic signaling by trans-synaptic protein complex
1. PB GO:0032715 negative regulation of interleukin-6 production
1. PB GO:0071641 negative regulation of macrophage inflammatory protein 1 alpha production
1. PB GO:0050852 T cell receptor signaling pathway
1. PB GO:0045309 protein phosphorylated amino acid binding
1. PB GO:0005634 nucleus
1. PB GO:0035696 monocyte extravasation
1. PB GO:0048260 positive regulation of receptor-mediated endocytosis
1. PB GO:2000403 positive regulation of lymphocyte migration
1. PB GO:0007166 cell surface receptor signaling pathway
1. PB GO:0006958 complement activation, classical pathway
1. PB GO:0046329 negative regulation of JNK cascade
1. PB GO:0016064 immunoglobulin mediated immune response
1. PB GO:0050853 B cell receptor signaling pathway
1. PB GO:0002587 negative regulation of antigen processing and presentation of peptide antigen via MHC class II
1. PB GO:0070971 endoplasmic reticulum exit site
1. PB GO:0086080 protein binding involved in heterotypic cell-cell adhesion
1. PB GO:2000566 positive regulation of CD8-positive, alpha-beta T cell proliferation
1. PB GO:0032651 regulation of interleukin-1 beta production
1. PB GO:0002859 negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
1. PB GO:0042270 protection from natural killer cell mediated cytotoxicity
1. PB GO:0032675 regulation of interleukin-6 production
1. PB GO:1990357 terminal web
1. PB GO:1990712 HFE-transferrin receptor complex
1. PB GO:0001817 regulation of cytokine production
1. PB GO:0007155 cell adhesion
1. PB GO:0098711 iron ion import across plasma membrane
1. PB GO:0001772 immunological synapse
1. PB GO:0005765 lysosomal membrane
1. PB GO:0045953 negative regulation of natural killer cell mediated cytotoxicity
1. PB GO:0050868 negative regulation of T cell activation
1. PB GO:0032819 positive regulation of natural killer cell proliferation
1. PB GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
1. PB GO:0019770 IgG receptor activity
1. PB GO:0005771 multivesicular body
1. PB GO:0032395 MHC class II receptor activity
1. PB GO:0015026 coreceptor activity
1. PB GO:1904434 positive regulation of ferrous iron binding
1. PB GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
1. PB GO:0001788 antibody-dependent cellular cytotoxicity
1. PB GO:0005769 early endosome
1. PB GO:0042102 positive regulation of T cell proliferation
1. PB GO:0032736 positive regulation of interleukin-13 production
1. PB GO:0034341 response to interferon-gamma
1. PB GO:0032649 regulation of interferon-gamma production
1. PB GO:0002639 positive regulation of immunoglobulin production
1. PB GO:0050839 cell adhesion molecule binding
1. PB GO:0045954 positive regulation of natural killer cell mediated cytotoxicity
1. PB GO:0005794 Golgi apparatus
1. PB GO:0039706 co-receptor binding
1. PB GO:0016021 integral component of membrane
1. PB GO:0045622 regulation of T-helper cell differentiation
1. PB GO:0042612 MHC class I protein complex
1. PB GO:2000008 regulation of protein localization to cell surface
1. PB GO:0046629 gamma-delta T cell activation
1. PB GO:1990459 transferrin receptor binding
1. PB GO:0034756 regulation of iron ion transport
1. PB GO:0046977 TAP binding
1. PB GO:0002725 negative regulation of T cell cytokine production
1. PB GO:0036057 slit diaphragm
1. PB GO:0030666 endocytic vesicle membrane
1. PB GO:1903720 negative regulation of I-kappaB phosphorylation
1. PB GO:0005829 cytosol
1. PB GO:0032809 neuronal cell body membrane
1. PB GO:0030667 secretory granule membrane
1. PB GO:0098609 cell-cell adhesion
1. PB GO:0033077 T cell differentiation in thymus
1. PB GO:0012507 ER to Golgi transport vesicle membrane
1. PB GO:0032688 negative regulation of interferon-beta production
1. PB GO:0002419 T cell mediated cytotoxicity directed against tumor cell target
1. PB GO:0005797 Golgi medial cisterna
1. PB GO:0001933 negative regulation of protein phosphorylation
1. PB GO:0098632 cell-cell adhesion mediator activity
1. PB GO:0000139 Golgi membrane
1. PB GO:0002399 MHC class II protein complex assembly
1. PB GO:0002429 immune response-activating cell surface receptor signaling pathway
1. PB GO:0016045 detection of bacterium
1. PB GO:0042590 antigen processing and presentation of exogenous peptide antigen via MHC class I
1. PB GO:0002519 natural killer cell tolerance induction
1. PB GO:0002767 immune response-inhibiting cell surface receptor signaling pathway
1. PB GO:0002717 positive regulation of natural killer cell mediated immunity
2. P GO:1903753 negative regulation of p38MAPK cascade
2. P GO:0045591 positive regulation of regulatory T cell differentiation
2. P GO:1903387 positive regulation of homophilic cell adhesion
2. P GO:0060369 positive regulation of Fc receptor mediated stimulatory signaling pathway
2. P GO:2000676 positive regulation of type B pancreatic cell apoptotic process
2. P GO:0002457 T cell antigen processing and presentation
2. P GO:0015125 bile acid transmembrane transporter activity
2. P GO:0150076 neuroinflammatory response
2. P GO:0005244 voltage-gated ion channel activity
2. P GO:0098640 integrin binding involved in cell-matrix adhesion
2. P GO:2000298 regulation of Rho-dependent protein serine/threonine kinase activity
2. P GO:0042088 T-helper 1 type immune response
2. P GO:0002438 acute inflammatory response to antigenic stimulus
2. P GO:0023035 CD40 signaling pathway
2. P GO:0010477 response to sulfur dioxide
2. P GO:0060307 regulation of ventricular cardiac muscle cell membrane repolarization
2. P GO:0070372 regulation of ERK1 and ERK2 cascade
2. P GO:0019863 IgE binding
2. P GO:0046684 response to pyrethroid
2. P GO:0034181 positive regulation of toll-like receptor 13 signaling pathway
2. P GO:1902227 negative regulation of macrophage colony-stimulating factor signaling pathway
2. P GO:0008038 neuron recognition
2. P GO:1904466 positive regulation of matrix metallopeptidase secretion
2. P GO:2000660 negative regulation of interleukin-1-mediated signaling pathway
2. P GO:0050900 leukocyte migration
2. P GO:0070571 negative regulation of neuron projection regeneration
2. P GO:0010460 positive regulation of heart rate
2. P GO:0030054 cell junction
2. P GO:0038158 granulocyte colony-stimulating factor signaling pathway
2. P GO:0010765 positive regulation of sodium ion transport
2. P GO:0002819 regulation of adaptive immune response
2. P GO:0033629 negative regulation of cell adhesion mediated by integrin
2. P GO:0032690 negative regulation of interleukin-1 alpha production
2. P GO:2001214 positive regulation of vasculogenesis
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0086015 SA node cell action potential
2. P GO:0050867 positive regulation of cell activation
2. P GO:0035725 sodium ion transmembrane transport
2. P GO:0042104 positive regulation of activated T cell proliferation
2. P GO:0019966 interleukin-1 binding
2. P GO:0071312 cellular response to alkaloid
2. P GO:0030889 negative regulation of B cell proliferation
2. P GO:0035581 sequestering of extracellular ligand from receptor
2. P GO:2000439 positive regulation of monocyte extravasation
2. P GO:0005537 mannose binding
2. P GO:0005784 Sec61 translocon complex
2. P GO:0097197 tetraspanin-enriched microdomain
2. P GO:0042105 alpha-beta T cell receptor complex
2. P GO:1905449 regulation of Fc-gamma receptor signaling pathway involved in phagocytosis
2. P GO:0014911 positive regulation of smooth muscle cell migration
2. P GO:0042734 presynaptic membrane
2. P GO:0071354 cellular response to interleukin-6
2. P GO:0070392 detection of lipoteichoic acid
2. P GO:1904996 positive regulation of leukocyte adhesion to vascular endothelial cell
2. P GO:0002922 positive regulation of humoral immune response
2. P GO:0055036 virion membrane
2. P GO:0150104 transport across blood-brain barrier
2. P GO:0045065 cytotoxic T cell differentiation
2. P GO:0019772 low-affinity IgG receptor activity
2. P GO:1900273 positive regulation of long-term synaptic potentiation
2. P GO:0004908 interleukin-1 receptor activity
2. P GO:0002080 acrosomal membrane
2. P GO:1905805 excitatory synapse pruning
2. P GO:0150072 positive regulation of arginase activity
2. P GO:0002079 inner acrosomal membrane
2. P GO:1903385 regulation of homophilic cell adhesion
2. P GO:0120035 regulation of plasma membrane bounded cell projection organization
2. P GO:0005887 integral component of plasma membrane
2. P GO:0048007 antigen processing and presentation, exogenous lipid antigen via MHC class Ib
2. P GO:0005764 lysosome
2. P GO:0042007 interleukin-18 binding
2. P GO:0005178 integrin binding
2. P GO:0050892 intestinal absorption
2. P GO:0032735 positive regulation of interleukin-12 production
2. P GO:0044325 transmembrane transporter binding
2. P GO:0051055 negative regulation of lipid biosynthetic process
2. P GO:2000145 regulation of cell motility
2. P GO:0030293 transmembrane receptor protein tyrosine kinase inhibitor activity
2. P GO:0034351 negative regulation of glial cell apoptotic process
2. P GO:0050863 regulation of T cell activation
2. P GO:0032692 negative regulation of interleukin-1 production
2. P GO:0002845 positive regulation of tolerance induction to tumor cell
2. P GO:0090264 regulation of immune complex clearance by monocytes and macrophages
2. P GO:0071723 lipopeptide binding
2. P GO:0050850 positive regulation of calcium-mediated signaling
2. P GO:0045494 photoreceptor cell maintenance
2. P GO:1905808 positive regulation of synapse pruning
2. P GO:0044291 cell-cell contact zone
2. P GO:2000509 negative regulation of dendritic cell chemotaxis
2. P GO:1900272 negative regulation of long-term synaptic potentiation
2. P GO:0150102 negative regulation of monocyte activation
2. P GO:0060312 regulation of blood vessel remodeling
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0002273 plasmacytoid dendritic cell differentiation
2. P GO:0098657 import into cell
2. P GO:0032393 MHC class I receptor activity
2. P GO:0035579 specific granule membrane
2. P GO:0086012 membrane depolarization during cardiac muscle cell action potential
2. P GO:1903980 positive regulation of microglial cell activation
2. P GO:0002291 T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
2. P GO:0070379 high mobility group box 1 binding
2. P GO:0019763 immunoglobulin receptor activity
2. P GO:0002410 plasmacytoid dendritic cell chemotaxis
2. P GO:0051493 regulation of cytoskeleton organization
2. P GO:0021966 corticospinal neuron axon guidance
2. P GO:0032691 negative regulation of interleukin-1 beta production
2. P GO:1902950 regulation of dendritic spine maintenance
2. P GO:0022614 membrane to membrane docking
2. P GO:0007167 enzyme linked receptor protein signaling pathway
2. P GO:1901143 insulin catabolic process
2. P GO:0002693 positive regulation of cellular extravasation
2. P GO:0038065 collagen-activated signaling pathway
2. P GO:0019227 neuronal action potential propagation
2. P GO:0042011 interleukin-16 binding
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:0045577 regulation of B cell differentiation
2. P GO:0042012 interleukin-16 receptor activity
2. P GO:0010976 positive regulation of neuron projection development
2. P GO:0031941 filamentous actin
2. P GO:0071333 cellular response to glucose stimulus
2. P GO:0005902 microvillus
2. P GO:0030110 HLA-C specific inhibitory MHC class I receptor activity
2. P GO:0038160 CXCL12-activated CXCR4 signaling pathway
2. P GO:0044319 wound healing, spreading of cells
2. P GO:0032966 negative regulation of collagen biosynthetic process
2. P GO:0034698 response to gonadotropin
2. P GO:0001774 microglial cell activation
2. P GO:0031642 negative regulation of myelination
2. P GO:0061154 endothelial tube morphogenesis
2. P GO:0019865 immunoglobulin binding
2. P GO:0090383 phagosome acidification
2. P GO:0034157 positive regulation of toll-like receptor 7 signaling pathway
2. P GO:1905522 negative regulation of macrophage migration
2. P GO:0002266 follicular dendritic cell activation
2. P GO:0035683 memory T cell extravasation
2. P GO:1900744 regulation of p38MAPK cascade
2. P GO:0150079 negative regulation of neuroinflammatory response
2. P GO:0071224 cellular response to peptidoglycan
2. P GO:1904141 positive regulation of microglial cell migration
2. P GO:0031005 filamin binding
2. P GO:0097368 establishment of Sertoli cell barrier
2. P GO:1902414 protein localization to cell junction
2. P GO:0033691 sialic acid binding
2. P GO:1904861 excitatory synapse assembly
2. P GO:0019768 high-affinity IgE receptor activity
2. P GO:0035577 azurophil granule membrane
2. P GO:0010595 positive regulation of endothelial cell migration
2. P GO:0060371 regulation of atrial cardiac muscle cell membrane depolarization
2. P GO:0004910 interleukin-1, type II, blocking receptor activity
2. P GO:0051101 regulation of DNA binding
2. P GO:0002891 positive regulation of immunoglobulin mediated immune response
2. P GO:0010255 glucose mediated signaling pathway
2. P GO:1904646 cellular response to amyloid-beta
2. P GO:0033005 positive regulation of mast cell activation
2. P GO:0043318 negative regulation of cytotoxic T cell degranulation
2. P GO:1901980 positive regulation of inward rectifier potassium channel activity
2. P GO:0045780 positive regulation of bone resorption
2. P GO:0086047 membrane depolarization during Purkinje myocyte cell action potential
2. P GO:0005105 type 1 fibroblast growth factor receptor binding
2. P GO:0046813 receptor-mediated virion attachment to host cell
2. P GO:0014704 intercalated disc
2. P GO:0031528 microvillus membrane
2. P GO:0060266 negative regulation of respiratory burst involved in inflammatory response
2. P GO:0033860 regulation of NAD(P)H oxidase activity
2. P GO:0002313 mature B cell differentiation involved in immune response
2. P GO:0019766 IgA receptor activity
2. P GO:2000405 negative regulation of T cell migration
2. P GO:2000562 negative regulation of CD4-positive, alpha-beta T cell proliferation
2. P GO:0005130 granulocyte colony-stimulating factor receptor binding
2. P GO:0038023 signaling receptor activity
2. P GO:0150094 amyloid-beta clearance by cellular catabolic process
2. P GO:0002436 immune complex clearance by monocytes and macrophages
2. P GO:0030165 PDZ domain binding
2. P GO:0043382 positive regulation of memory T cell differentiation
2. P GO:0042289 MHC class II protein binding
2. P GO:1905710 positive regulation of membrane permeability
2. P GO:0001780 neutrophil homeostasis
2. P GO:0010955 negative regulation of protein processing
2. P GO:0001931 uropod
2. P GO:1902623 negative regulation of neutrophil migration
2. P GO:2000558 positive regulation of immunoglobulin production in mucosal tissue
2. P GO:0030948 negative regulation of vascular endothelial growth factor receptor signaling pathway
2. P GO:0002865 negative regulation of acute inflammatory response to antigenic stimulus
2. P GO:2000515 negative regulation of CD4-positive, alpha-beta T cell activation
2. P GO:0001848 complement binding
2. P GO:0005912 adherens junction
2. P GO:0150062 complement-mediated synapse pruning
2. P GO:2000352 negative regulation of endothelial cell apoptotic process
2. P GO:0032499 detection of peptidoglycan
2. P GO:0051497 negative regulation of stress fiber assembly
2. P GO:0002860 positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
2. P GO:0032760 positive regulation of tumor necrosis factor production
2. P GO:0045056 transcytosis
2. P GO:0002446 neutrophil mediated immunity
2. P GO:0051899 membrane depolarization
2. P GO:0072683 T cell extravasation
2. P GO:1901076 positive regulation of engulfment of apoptotic cell
2. P GO:0035325 Toll-like receptor binding
2. P GO:0045059 positive thymic T cell selection
2. P GO:1903523 negative regulation of blood circulation
2. P GO:0010884 positive regulation of lipid storage
2. P GO:0072714 response to selenite ion
2. P GO:0038016 insulin receptor internalization
2. P GO:0061028 establishment of endothelial barrier
2. P GO:0010822 positive regulation of mitochondrion organization
2. P GO:0002220 innate immune response activating cell surface receptor signaling pathway
2. P GO:1990051 activation of protein kinase C activity
2. P GO:2000649 regulation of sodium ion transmembrane transporter activity
2. P GO:0032497 detection of lipopolysaccharide
2. P GO:0019767 IgE receptor activity
2. P GO:0035726 common myeloid progenitor cell proliferation
2. P GO:0034136 negative regulation of toll-like receptor 2 signaling pathway
2. P GO:0002827 positive regulation of T-helper 1 type immune response
2. P GO:0086005 ventricular cardiac muscle cell action potential
2. P GO:0070352 positive regulation of white fat cell proliferation
2. P GO:0150074 positive regulation of protein-glutamine gamma-glutamyltransferase activity
2. P GO:0010891 negative regulation of sequestering of triglyceride
2. P GO:0051926 negative regulation of calcium ion transport
2. P GO:0051924 regulation of calcium ion transport
2. P GO:0002318 myeloid progenitor cell differentiation
2. P GO:0044406 adhesion of symbiont to host
2. P GO:0002376 immune system process
2. P GO:2001200 positive regulation of dendritic cell differentiation
2. P GO:0050776 regulation of immune response
2. P GO:0002523 leukocyte migration involved in inflammatory response
2. P GO:0031362 anchored component of external side of plasma membrane
2. P GO:2000346 negative regulation of hepatocyte proliferation
2. P GO:0002588 positive regulation of antigen processing and presentation of peptide antigen via MHC class II
2. P GO:0045058 T cell selection
2. P GO:0050823 peptide antigen stabilization
2. P GO:0051963 regulation of synapse assembly
2. P GO:0002232 leukocyte chemotaxis involved in inflammatory response
2. P GO:0046978 TAP1 binding
2. P GO:0044548 S100 protein binding
2. P GO:0007159 leukocyte cell-cell adhesion
2. P GO:1903142 positive regulation of establishment of endothelial barrier
2. P GO:0050785 advanced glycation end-product receptor activity
2. P GO:0010887 negative regulation of cholesterol storage
2. P GO:0045959 negative regulation of complement activation, classical pathway
2. P GO:0007286 spermatid development
2. P GO:0042113 B cell activation
2. P GO:0045960 positive regulation of complement activation, classical pathway
2. P GO:1904472 positive regulation of endothelin production
2. P GO:0001915 negative regulation of T cell mediated cytotoxicity
2. P GO:1903209 positive regulation of oxidative stress-induced cell death
2. P GO:0043184 vascular endothelial growth factor receptor 2 binding
2. P GO:0045657 positive regulation of monocyte differentiation
2. P GO:0071640 regulation of macrophage inflammatory protein 1 alpha production
2. P GO:0001910 regulation of leukocyte mediated cytotoxicity
2. P GO:0030101 natural killer cell activation
2. P GO:0043183 vascular endothelial growth factor receptor 1 binding
2. P GO:0090647 modulation of age-related behavioral decline
2. P GO:1904951 positive regulation of establishment of protein localization
2. P GO:0010594 regulation of endothelial cell migration
2. P GO:0045582 positive regulation of T cell differentiation
2. P GO:0001865 NK T cell differentiation
2. P GO:0034260 negative regulation of GTPase activity
2. P GO:0033627 cell adhesion mediated by integrin
2. P GO:1902531 regulation of intracellular signal transduction
2. P GO:0033084 regulation of immature T cell proliferation in thymus
2. P GO:0048143 astrocyte activation
2. P GO:0045916 negative regulation of complement activation
2. P GO:0060370 susceptibility to T cell mediated cytotoxicity
2. P GO:0060100 positive regulation of phagocytosis, engulfment
2. P GO:0060373 regulation of ventricular cardiac muscle cell membrane depolarization
2. P GO:0001813 regulation of antibody-dependent cellular cytotoxicity
2. P GO:0039573 suppression by virus of host complement activation
2. P GO:0032793 positive regulation of CREB transcription factor activity
2. P GO:0045121 membrane raft
2. P GO:0043549 regulation of kinase activity
2. P GO:0034156 negative regulation of toll-like receptor 7 signaling pathway
2. P GO:0097011 cellular response to granulocyte macrophage colony-stimulating factor stimulus
2. P GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I
2. P GO:0002398 MHC class Ib protein complex assembly
2. P GO:0050829 defense response to Gram-negative bacterium
2. P GO:1904093 negative regulation of autophagic cell death
2. P GO:0046697 decidualization
2. P GO:1903556 negative regulation of tumor necrosis factor superfamily cytokine production
2. P GO:0035879 plasma membrane lactate transport
2. P GO:0038064 collagen receptor activity
2. P GO:0030883 endogenous lipid antigen binding
2. P GO:1905291 positive regulation of CAMKK-AMPK signaling cascade
2. P GO:0070345 negative regulation of fat cell proliferation
2. P GO:0140081 glycosylated region protein binding
2. P GO:0034235 GPI anchor binding
2. P GO:1902961 positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process
2. P GO:0070891 lipoteichoic acid binding
2. P GO:0050732 negative regulation of peptidyl-tyrosine phosphorylation
2. P GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
2. P GO:0050866 negative regulation of cell activation
2. P GO:0043116 negative regulation of vascular permeability
2. P GO:0032693 negative regulation of interleukin-10 production
2. P GO:0001791 IgM binding
2. P GO:0045860 positive regulation of protein kinase activity
2. P GO:0045576 mast cell activation
2. P GO:1902683 regulation of receptor localization to synapse
2. P GO:0005272 sodium channel activity
2. P GO:0001618 virus receptor activity
2. P GO:0060048 cardiac muscle contraction
2. P GO:0034241 positive regulation of macrophage fusion
2. P GO:0050777 negative regulation of immune response
2. P GO:1905581 positive regulation of low-density lipoprotein particle clearance
2. P GO:0002541 activation of plasma proteins involved in acute inflammatory response
2. P GO:0007202 activation of phospholipase C activity
2. P GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
2. P GO:1905404 positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process
2. P GO:0002282 microglial cell activation involved in immune response
2. P GO:0035723 interleukin-15-mediated signaling pathway
2. P GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
2. P GO:0050930 induction of positive chemotaxis
2. P GO:0039671 evasion by virus of host natural killer cell activity
2. P GO:0042058 regulation of epidermal growth factor receptor signaling pathway
2. P GO:0001540 amyloid-beta binding
2. P GO:0005055 laminin receptor activity
2. P GO:0060077 inhibitory synapse
2. P GO:0032752 positive regulation of interleukin-3 production
2. P GO:1900271 regulation of long-term synaptic potentiation
2. P GO:0043547 positive regulation of GTPase activity
2. P GO:0061518 microglial cell proliferation
2. P GO:0032507 maintenance of protein location in cell
2. P GO:0007160 cell-matrix adhesion
2. P GO:0030316 osteoclast differentiation
2. P GO:0072657 protein localization to membrane
2. P GO:0009925 basal plasma membrane
2. P GO:0042119 neutrophil activation
2. P GO:0070160 tight junction
2. P GO:0033624 negative regulation of integrin activation
2. P GO:0002765 immune response-inhibiting signal transduction
2. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
2. P GO:1901216 positive regulation of neuron death
2. P GO:1903376 regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
2. P GO:0014066 regulation of phosphatidylinositol 3-kinase signaling
2. P GO:0005248 voltage-gated sodium channel activity
2. P GO:0071639 positive regulation of monocyte chemotactic protein-1 production
2. P GO:0003723 RNA binding
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0034113 heterotypic cell-cell adhesion
2. P GO:0030884 exogenous lipid antigen binding
2. P GO:0060075 regulation of resting membrane potential
2. P GO:0045728 respiratory burst after phagocytosis
2. P GO:0042803 protein homodimerization activity
2. P GO:0032731 positive regulation of interleukin-1 beta production
2. P GO:0050901 leukocyte tethering or rolling
2. P GO:0032689 negative regulation of interferon-gamma production
2. P GO:0086014 atrial cardiac muscle cell action potential
2. P GO:0030882 lipid antigen binding
2. P GO:0008270 zinc ion binding
2. P GO:0034189 very-low-density lipoprotein particle binding
2. P GO:0061889 negative regulation of astrocyte activation
2. P GO:0071813 lipoprotein particle binding
2. P GO:0090022 regulation of neutrophil chemotaxis
2. P GO:0030217 T cell differentiation
2. P GO:0001811 negative regulation of type I hypersensitivity
2. P GO:0043220 Schmidt-Lanterman incisure
2. P GO:0090557 establishment of endothelial intestinal barrier
2. P GO:0001805 positive regulation of type III hypersensitivity
2. P GO:0051138 positive regulation of NK T cell differentiation
2. P GO:0031225 anchored component of membrane
2. P GO:0010983 positive regulation of high-density lipoprotein particle clearance
2. P GO:0034116 positive regulation of heterotypic cell-cell adhesion
2. P GO:0045088 regulation of innate immune response
2. P GO:0001952 regulation of cell-matrix adhesion
2. P GO:2000350 positive regulation of CD40 signaling pathway
2. P GO:0005923 bicellular tight junction
2. P GO:0005739 mitochondrion
2. P GO:0086062 voltage-gated sodium channel activity involved in Purkinje myocyte action potential
2. P GO:0030225 macrophage differentiation
2. P GO:0090138 regulation of actin cytoskeleton organization by cell-cell adhesion
2. P GO:0086010 membrane depolarization during action potential
2. P GO:0043507 positive regulation of JUN kinase activity
2. P GO:0001818 negative regulation of cytokine production
2. P GO:1903829 positive regulation of protein localization
2. P GO:0140052 cellular response to oxidised low-density lipoprotein particle stimulus
2. P GO:1900747 negative regulation of vascular endothelial growth factor signaling pathway
2. P GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
2. P GO:2000774 positive regulation of cellular senescence
2. P GO:0070821 tertiary granule membrane
2. P GO:0044853 plasma membrane raft
2. P GO:0046598 positive regulation of viral entry into host cell
2. P GO:0002526 acute inflammatory response
2. P GO:0007565 female pregnancy
2. P GO:0034333 adherens junction assembly
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0086091 regulation of heart rate by cardiac conduction
2. P GO:0032755 positive regulation of interleukin-6 production
2. P GO:0042129 regulation of T cell proliferation
2. P GO:0035020 regulation of Rac protein signal transduction
2. P GO:0030315 T-tubule
2. P GO:0023024 MHC class I protein complex binding
2. P GO:0010641 positive regulation of platelet-derived growth factor receptor signaling pathway
2. P GO:0034186 apolipoprotein A-I binding
2. P GO:0050859 negative regulation of B cell receptor signaling pathway
2. P GO:0010575 positive regulation of vascular endothelial growth factor production
2. P GO:0035397 helper T cell enhancement of adaptive immune response
2. P GO:0031032 actomyosin structure organization
2. P GO:1903670 regulation of sprouting angiogenesis
2. P GO:0032733 positive regulation of interleukin-10 production
2. P GO:1901731 positive regulation of platelet aggregation
2. P GO:1904645 response to amyloid-beta
2. P GO:1900027 regulation of ruffle assembly
2. P GO:0097062 dendritic spine maintenance
2. P GO:0007338 single fertilization
2. P GO:0035633 maintenance of blood-brain barrier
2. P GO:0090331 negative regulation of platelet aggregation
2. P GO:0086002 cardiac muscle cell action potential involved in contraction
2. P GO:2000249 regulation of actin cytoskeleton reorganization
2. P GO:0007165 signal transduction
2. P GO:0031774 leukotriene receptor binding
2. P GO:2001171 positive regulation of ATP biosynthetic process
2. P GO:0034144 negative regulation of toll-like receptor 4 signaling pathway
2. P GO:0002668 negative regulation of T cell anergy
2. P GO:1900453 negative regulation of long-term synaptic depression
2. P GO:0046689 response to mercury ion
2. P GO:0045590 negative regulation of regulatory T cell differentiation
2. P GO:0043031 negative regulation of macrophage activation
2. P GO:0048170 positive regulation of long-term neuronal synaptic plasticity
2. P GO:0015721 bile acid and bile salt transport
2. P GO:0048006 antigen processing and presentation, endogenous lipid antigen via MHC class Ib
2. P GO:0090559 regulation of membrane permeability
2. P GO:0030593 neutrophil chemotaxis
2. P GO:0099059 integral component of presynaptic active zone membrane
2. P GO:0002862 negative regulation of inflammatory response to antigenic stimulus
2. P GO:0010760 negative regulation of macrophage chemotaxis
2. P GO:0046549 retinal cone cell development
2. P GO:0030057 desmosome
2. P GO:0030853 negative regulation of granulocyte differentiation
2. P GO:0060101 negative regulation of phagocytosis, engulfment
2. P GO:0051135 positive regulation of NK T cell activation
2. P GO:0002270 plasmacytoid dendritic cell activation
2. P GO:0045777 positive regulation of blood pressure
2. P GO:0070348 negative regulation of brown fat cell proliferation
2. P GO:0071219 cellular response to molecule of bacterial origin
2. P GO:0001814 negative regulation of antibody-dependent cellular cytotoxicity
2. P GO:0006968 cellular defense response
2. P GO:0061041 regulation of wound healing
2. P GO:0002397 MHC class I protein complex assembly
2. P GO:0001518 voltage-gated sodium channel complex
2. P GO:0086006 voltage-gated sodium channel activity involved in cardiac muscle cell action potential
2. P GO:0007229 integrin-mediated signaling pathway
2. P GO:0150003 regulation of spontaneous synaptic transmission
2. P GO:1903082 positive regulation of C-C chemokine receptor CCR7 signaling pathway
2. P GO:0045601 regulation of endothelial cell differentiation
2. P GO:0019871 sodium channel inhibitor activity
2. P GO:0110089 regulation of hippocampal neuron apoptotic process
2. P GO:1902396 protein localization to bicellular tight junction
2. P GO:0046330 positive regulation of JNK cascade
2. P GO:0050728 negative regulation of inflammatory response
2. P GO:1905150 regulation of voltage-gated sodium channel activity
2. P GO:0002638 negative regulation of immunoglobulin production
2. P GO:0120146 sulfatide binding
2. P GO:1900745 positive regulation of p38MAPK cascade
2. P GO:0045743 positive regulation of fibroblast growth factor receptor signaling pathway
2. P GO:0150077 regulation of neuroinflammatory response
2. P GO:0031103 axon regeneration
2. P GO:0001914 regulation of T cell mediated cytotoxicity
2. P GO:0032757 positive regulation of interleukin-8 production
2. P GO:0019209 kinase activator activity
2. P GO:0033674 positive regulation of kinase activity
2. P GO:0098671 adhesion receptor-mediated virion attachment to host cell
2. P GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
2. P GO:0071223 cellular response to lipoteichoic acid
2. P GO:0002456 T cell mediated immunity
2. P GO:0002726 positive regulation of T cell cytokine production
2. P GO:1905286 serine-type peptidase complex
2. P GO:2000353 positive regulation of endothelial cell apoptotic process
2. P GO:0032703 negative regulation of interleukin-2 production
2. P GO:1905898 positive regulation of response to endoplasmic reticulum stress
2. P GO:0097028 dendritic cell differentiation
2. P GO:0048534 hematopoietic or lymphoid organ development
2. P GO:0001525 angiogenesis
2. P GO:0071636 positive regulation of transforming growth factor beta production
2. P GO:0043113 receptor clustering
2. P GO:0034151 regulation of toll-like receptor 6 signaling pathway
2. P GO:1901018 positive regulation of potassium ion transmembrane transporter activity
2. P GO:0002924 negative regulation of humoral immune response mediated by circulating immunoglobulin
2. P GO:0002336 B-1 B cell lineage commitment
2. P GO:0090027 negative regulation of monocyte chemotaxis
2. P GO:0002622 regulation of B cell antigen processing and presentation
2. P GO:0002695 negative regulation of leukocyte activation
2. P GO:2000514 regulation of CD4-positive, alpha-beta T cell activation
2. P GO:1904465 negative regulation of matrix metallopeptidase secretion
2. P GO:0003407 neural retina development
2. P GO:2000810 regulation of bicellular tight junction assembly
2. P GO:0010801 negative regulation of peptidyl-threonine phosphorylation
2. P GO:0061337 cardiac conduction
2. P GO:0004888 transmembrane signaling receptor activity
2. P GO:0001820 serotonin secretion
2. P GO:0099557 trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission
2. P GO:0006948 induction by virus of host cell-cell fusion
2. P GO:0017080 sodium channel regulator activity
2. P GO:0060074 synapse maturation
2. P GO:1901224 positive regulation of NIK/NF-kappaB signaling
2. P GO:0045176 apical protein localization
3. B GO:0010737 protein kinase A signaling
3. B GO:0098797 plasma membrane protein complex
3. B GO:0007414 axonal defasciculation
3. B GO:0003094 glomerular filtration
3. B GO:0030913 paranodal junction assembly
3. B GO:0050709 negative regulation of protein secretion
3. B GO:2001198 regulation of dendritic cell differentiation
3. B GO:0007254 JNK cascade
3. B GO:0008307 structural constituent of muscle
3. B GO:0055037 recycling endosome
3. B GO:0019815 B cell receptor complex
3. B GO:0051371 muscle alpha-actinin binding
3. B GO:0031430 M band
3. B GO:0048668 collateral sprouting
3. B GO:0019731 antibacterial humoral response
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0045580 regulation of T cell differentiation
3. B GO:0006953 acute-phase response
3. B GO:2000521 negative regulation of immunological synapse formation
3. B GO:0043194 axon initial segment
3. B GO:0030240 skeletal muscle thin filament assembly
3. B GO:0042805 actinin binding
3. B GO:0042609 CD4 receptor binding
3. B GO:0050871 positive regulation of B cell activation
3. B GO:0001580 detection of chemical stimulus involved in sensory perception of bitter taste
3. B GO:0050808 synapse organization
3. B GO:0097493 structural molecule activity conferring elasticity
3. B GO:0033270 paranode region of axon
3. B GO:0001895 retina homeostasis
3. B GO:0055013 cardiac muscle cell development
3. B GO:0007416 synapse assembly
3. B GO:0005524 ATP binding
3. B GO:0042571 immunoglobulin complex, circulating
3. B GO:0017124 SH3 domain binding
3. B GO:0032092 positive regulation of protein binding
3. B GO:0097421 liver regeneration
3. B GO:0030277 maintenance of gastrointestinal epithelium
3. B GO:0002667 regulation of T cell anergy
3. B GO:0071656 negative regulation of granulocyte colony-stimulating factor production
3. B GO:0060419 heart growth
3. B GO:0055003 cardiac myofibril assembly
3. B GO:0002418 immune response to tumor cell
3. B GO:0043323 positive regulation of natural killer cell degranulation
3. B GO:2001222 regulation of neuron migration
3. B GO:0005865 striated muscle thin filament
3. B GO:0035418 protein localization to synapse
3. B GO:2000568 positive regulation of memory T cell activation
3. B GO:0032815 negative regulation of natural killer cell activation
3. B GO:0071205 protein localization to juxtaparanode region of axon
3. B GO:0034154 toll-like receptor 7 signaling pathway
3. B GO:0072562 blood microparticle
3. B GO:0043056 forward locomotion
3. B GO:2001189 negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
3. B GO:0032154 cleavage furrow
3. B GO:0099560 synaptic membrane adhesion
3. B GO:0009826 unidimensional cell growth
3. B GO:0003382 epithelial cell morphogenesis
3. B GO:0016199 axon midline choice point recognition
3. B GO:0045022 early endosome to late endosome transport
3. B GO:0045859 regulation of protein kinase activity
3. B GO:0098688 parallel fiber to Purkinje cell synapse
3. B GO:0031674 I band
3. B GO:0032655 regulation of interleukin-12 production
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:0070700 BMP receptor binding
3. B GO:0055072 iron ion homeostasis
3. B GO:0071751 secretory IgA immunoglobulin complex
3. B GO:0002652 regulation of tolerance induction dependent upon immune response
3. B GO:0044062 regulation of excretion
3. B GO:0097454 Schwann cell microvillus
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:0031324 negative regulation of cellular metabolic process
3. B GO:0019814 immunoglobulin complex
3. B GO:0032687 negative regulation of interferon-alpha production
3. B GO:0002826 negative regulation of T-helper 1 type immune response
3. B GO:0032712 negative regulation of interleukin-3 production
3. B GO:1901897 regulation of relaxation of cardiac muscle
3. B GO:0099056 integral component of presynaptic membrane
3. B GO:0003300 cardiac muscle hypertrophy
3. B GO:0031433 telethonin binding
3. B GO:0016338 calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
3. B GO:0070373 negative regulation of ERK1 and ERK2 cascade
3. B GO:0009617 response to bacterium
3. B GO:0099629 postsynaptic specialization of symmetric synapse
3. B GO:0030537 larval behavior
3. B GO:0048769 sarcomerogenesis
3. B GO:0097708 intracellular vesicle
3. B GO:0007422 peripheral nervous system development
3. B GO:0002175 protein localization to paranode region of axon
3. B GO:2001190 positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
3. B GO:0048681 negative regulation of axon regeneration
3. B GO:0071756 pentameric IgM immunoglobulin complex
3. B GO:0048679 regulation of axon regeneration
3. B GO:0010862 positive regulation of pathway-restricted SMAD protein phosphorylation
3. B GO:0071748 monomeric IgA immunoglobulin complex
3. B GO:0002838 negative regulation of immune response to tumor cell
3. B GO:0030241 skeletal muscle myosin thick filament assembly
3. B GO:0008039 synaptic target recognition
3. B GO:0046872 metal ion binding
3. B GO:0030509 BMP signaling pathway
3. B GO:0042552 myelination
3. B GO:0035995 detection of muscle stretch
3. B GO:0042742 defense response to bacterium
3. B GO:0005918 septate junction
3. B GO:0002666 positive regulation of T cell tolerance induction
3. B GO:0050830 defense response to Gram-positive bacterium
3. B GO:2001185 regulation of CD8-positive, alpha-beta T cell activation
3. B GO:0061042 vascular wound healing

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q7ZXX1 Cell adhesion molecule 3 1.56e-07 4.36e-08 1.80e-08
1. PB O19477 Major histocompatibility complex class I-related gene protein 1.01e-02 8.84e-05 0.011
1. PB P55899 IgG receptor FcRn large subunit p51 1.71e-02 4.57e-07 0.010
1. PB P06339 H-2 class I histocompatibility antigen, D-37 alpha chain 2.14e-02 5.84e-07 0.003
1. PB O46631 Tyrosine-protein phosphatase non-receptor type substrate 1 0.00e+00 8.12e-07 0.0
1. PB P13762 HLA class II histocompatibility antigen, DR beta 4 chain 9.95e-03 1.94e-07 0.032
1. PB P04223 H-2 class I histocompatibility antigen, K-K alpha chain 9.81e-03 1.33e-07 0.006
1. PB P13750 Patr class I histocompatibility antigen, B-1 alpha chain (Fragment) 1.16e-02 1.84e-06 0.001
1. PB P35737 Class II histocompatibility antigen, M beta 1 chain 9.71e-03 1.83e-08 1.21e-04
1. PB P13752 BOLA class I histocompatibility antigen, alpha chain BL3-6 8.37e-03 5.32e-09 0.002
1. PB P06341 Rano class II histocompatibility antigen, A beta chain (Fragment) 4.47e-03 1.35e-03 0.008
1. PB P04221 Ig mu chain C region membrane-bound form 3.06e-04 7.55e-04 8.07e-05
1. PB P33617 Mamu class I histocompatibility antigen, alpha chain F 1.31e-03 1.19e-04 0.003
1. PB Q6MG97 Butyrophilin-like protein 2 4.73e-06 1.27e-02 3.45e-05
1. PB P20040 H-2 class II histocompatibility antigen, E-Q beta chain 5.59e-03 2.45e-05 0.008
1. PB P01889 HLA class I histocompatibility antigen, B alpha chain 3.32e-03 3.71e-07 0.003
1. PB Q9GL43 Hereditary hemochromatosis protein homolog 2.17e-03 1.40e-04 5.90e-04
1. PB Q1WIM3 Cell adhesion molecule 3 2.60e-06 2.80e-09 9.51e-11
1. PB P06345 H-2 class II histocompatibility antigen, A-S beta chain 7.43e-03 1.48e-05 0.028
1. PB Q9BY67 Cell adhesion molecule 1 3.18e-06 5.41e-06 1.28e-04
1. PB Q90460 CD166 antigen homolog A 1.22e-04 4.40e-03 0.021
1. PB P04439 HLA class I histocompatibility antigen, A alpha chain 2.24e-03 1.97e-07 0.002
1. PB O35799 Hereditary hemochromatosis protein homolog 1.87e-02 2.65e-07 0.003
1. PB P30385 Class I histocompatibility antigen, Gogo-C*0201 alpha chain 1.18e-02 2.34e-07 0.004
1. PB P70387 Hereditary hemochromatosis protein homolog 2.76e-04 1.09e-06 0.002
1. PB Q9GKZ0 Hereditary hemochromatosis protein homolog 1.22e-02 1.84e-04 6.74e-04
1. PB Q95IT3 Patr class I histocompatibility antigen, alpha chain E 6.59e-03 1.70e-06 0.001
1. PB Q8N3J6 Cell adhesion molecule 2 3.77e-07 5.12e-04 2.74e-09
1. PB P16212 Popy class I histocompatibility antigen, alpha chain E (Fragment) 1.34e-02 2.01e-08 0.015
1. PB P30388 Class I histocompatibility antigen, Gogo-OKO alpha chain 6.42e-03 1.42e-06 4.50e-04
1. PB P23088 Ig heavy chain C region, membrane-bound form 2.96e-05 2.71e-05 3.61e-04
1. PB P30378 Class I histocompatibility antigen, Gogo-A*0501 alpha chain 4.41e-03 4.68e-07 0.027
1. PB P01869 Ig gamma-1 chain C region, membrane-bound form 3.49e-06 1.20e-06 0.006
1. PB P30386 Class I histocompatibility antigen, Gogo-C*0202 alpha chain 1.20e-02 2.17e-07 0.004
1. PB Q91664 V-set and immunoglobulin domain-containing protein 1 1.69e-04 3.43e-03 0.045
1. PB P17693 HLA class I histocompatibility antigen, alpha chain G 1.45e-03 7.42e-03 0.022
1. PB Q66KX2 Cell adhesion molecule 4 1.32e-08 2.07e-10 2.59e-06
1. PB P30382 Class I histocompatibility antigen, Gogo-B*0201 alpha chain 1.31e-03 4.74e-07 0.002
1. PB P30381 Class I histocompatibility antigen, Gogo-B*0103 alpha chain 6.59e-04 4.57e-07 0.002
1. PB P16210 Patr class I histocompatibility antigen, A-5 alpha chain 9.21e-04 3.44e-07 0.003
1. PB P16209 Patr class I histocompatibility antigen, A-2 alpha chain 1.09e-03 5.77e-07 5.61e-04
1. PB P97797 Tyrosine-protein phosphatase non-receptor type substrate 1 0.00e+00 3.89e-07 5.67e-147
1. PB Q1WIM2 Cell adhesion molecule 2 3.12e-07 4.53e-03 2.00e-09
1. PB P01867 Ig gamma-2B chain C region 7.85e-06 1.35e-02 0.002
1. PB Q30201 Hereditary hemochromatosis protein 1.33e-03 1.10e-05 0.046
1. PB Q29980 MHC class I polypeptide-related sequence B 8.07e-03 4.20e-05 1.81e-04
1. PB Q7TSP5 V-set domain containing T-cell activation inhibitor 1 1.36e-03 1.38e-05 2.92e-04
1. PB P97710 Tyrosine-protein phosphatase non-receptor type substrate 1 0.00e+00 3.44e-07 1.03e-144
1. PB Q9GL41 Hereditary hemochromatosis protein homolog 2.22e-03 5.26e-05 8.07e-05
1. PB Q8BLQ9 Cell adhesion molecule 2 3.96e-08 9.29e-04 2.29e-09
1. PB P15464 SMH class II histocompatibility antigen, beta-1 chain 1.78e-04 3.90e-06 0.007
1. PB P03987 Ig gamma-3 chain C region 3.94e-05 6.12e-04 0.007
1. PB P14432 H-2 class I histocompatibility antigen, TLA(B) alpha chain 9.93e-03 7.64e-07 3.16e-04
1. PB P15979 Class I histocompatibility antigen, F10 alpha chain 1.45e-02 1.59e-05 0.003
1. PB Q95IT1 Patr class I histocompatibility antigen, alpha chain G 6.28e-04 8.03e-04 0.020
1. PB P18469 H-2 class II histocompatibility antigen, I-E beta chain 5.54e-03 5.93e-04 0.008
1. PB P78324 Tyrosine-protein phosphatase non-receptor type substrate 1 0.00e+00 1.94e-07 0.0
1. PB P30380 Class I histocompatibility antigen, Gogo-B*0102 alpha chain 1.26e-03 5.36e-07 0.002
1. PB P01897 H-2 class I histocompatibility antigen, L-D alpha chain 1.71e-03 1.81e-08 0.007
1. PB Q5TFQ8 Signal-regulatory protein beta-1 isoform 3 0 1.96e-145 0.0
1. PB Q30154 HLA class II histocompatibility antigen, DR beta 5 chain 3.41e-03 1.92e-04 0.032
1. PB P14427 H-2 class I histocompatibility antigen, D-P alpha chain 2.90e-03 1.53e-07 4.40e-04
1. PB Q99N28 Cell adhesion molecule 3 2.96e-07 5.19e-10 5.06e-11
1. PB P11364 Viral T-cell receptor beta chain-like T17T-22 NA 9.85e-17 0.009
1. PB P30516 Class I histocompatibility antigen, B alpha chain 5.04e-03 1.03e-08 0.004
1. PB P30377 Class I histocompatibility antigen, Gogo-A*0401 alpha chain 1.37e-03 4.31e-08 0.009
1. PB P06340 HLA class II histocompatibility antigen, DO alpha chain 5.86e-03 8.12e-07 1.21e-04
1. PB O75144 ICOS ligand 2.44e-05 6.17e-11 0.007
1. PB P01901 H-2 class I histocompatibility antigen, K-B alpha chain 1.16e-02 8.02e-07 0.025
1. PB P16215 Patr class I histocompatibility antigen, CH28 alpha chain 8.50e-04 2.71e-04 0.002
1. PB P01894 RLA class I histocompatibility antigen, alpha chain 11/11 6.90e-03 2.59e-09 5.61e-04
1. PB P30515 Saoe class I histocompatibility antigen, A alpha chain 1.10e-03 9.53e-09 0.008
1. PB P18468 H-2 class II histocompatibility antigen, I-A beta chain 8.00e-03 1.09e-04 0.006
1. PB P18466 DLA class I histocompatibility antigen, A9/A9 alpha chain 1.86e-03 3.53e-07 1.19e-04
1. PB P04231 H-2 class II histocompatibility antigen, E-S beta chain (Fragment) 2.51e-03 8.56e-05 0.010
1. PB P16391 RT1 class I histocompatibility antigen, AA alpha chain 1.08e-02 2.11e-09 0.006
1. PB O00241 Signal-regulatory protein beta-1 0.00e+00 4.70e-94 0.0
1. PB Q8SPV9 IgG receptor FcRn large subunit p51 1.48e-02 1.62e-06 0.008
1. PB Q8R5M8 Cell adhesion molecule 1 5.28e-07 2.07e-04 1.72e-04
1. PB P0DSE1 M1-specific T cell receptor alpha chain 3.98e-03 2.54e-11 0.030
1. PB P16211 Popy Class I histocompatibility antigen, A-1 alpha chain 1.19e-02 6.68e-07 0.007
1. PB Q9GL42 Hereditary hemochromatosis protein homolog 2.07e-03 7.41e-05 8.29e-05
1. PB P18470 DLA class II histocompatibility antigen, DR-1 beta chain 7.47e-03 7.47e-04 0.006
1. PB P01915 H-2 class II histocompatibility antigen, E-D beta chain 7.24e-03 5.08e-05 0.016
1. PB P14483 H-2 class II histocompatibility antigen, A beta chain 1.06e-02 9.14e-05 0.026
1. PB P28068 HLA class II histocompatibility antigen, DM beta chain 8.32e-03 2.17e-07 0.003
1. PB P15982 SLA class II histocompatibility antigen, DQ haplotype C beta chain 1.81e-02 7.57e-03 1.21e-05
1. PB P20756 RLA class II histocompatibility antigen, DP beta chain 7.56e-03 5.68e-05 0.013
1. PB Q61559 IgG receptor FcRn large subunit p51 1.15e-02 3.64e-08 1.33e-05
1. PB P13749 Patr class I histocompatibility antigen, A-126 alpha chain 3.86e-03 1.15e-07 8.27e-04
1. PB P01900 H-2 class I histocompatibility antigen, D-D alpha chain 3.88e-03 1.39e-09 0.003
1. PB P30511 HLA class I histocompatibility antigen, alpha chain F 7.87e-04 1.01e-04 0.006
1. PB Q9TVC8 BoLa class II histocompatibility antigen, DQB*0101 beta chain 2.16e-02 1.76e-03 0.032
1. PB Q6AYP5 Cell adhesion molecule 1 5.13e-06 5.32e-05 8.11e-05
1. PB Q9P1W8 Signal-regulatory protein gamma 0.00e+00 1.29e-69 0.0
1. PB Q5JXA9 Signal-regulatory protein beta-2 6.26e-05 3.62e-09 2.31e-21
1. PB P13751 Patr class I histocompatibility antigen, B-2 alpha chain 1.17e-03 2.09e-07 0.003
1. PB P13599 IgG receptor FcRn large subunit p51 5.92e-03 8.91e-08 2.11e-05
1. PB Q9JI59 Junctional adhesion molecule B 1.52e-04 2.26e-07 0.008
1. PB P06140 RLA class I histocompatibility antigen, alpha chain 19-1 6.92e-03 1.80e-09 5.66e-04
1. PB P60018 Hereditary hemochromatosis protein homolog 2.56e-02 1.10e-05 0.046
1. PB Q8N126 Cell adhesion molecule 3 6.41e-07 6.92e-10 1.43e-09
1. PB P30379 Class I histocompatibility antigen, Gogo-B*0101 alpha chain 2.51e-03 7.37e-07 0.002
1. PB P04440 HLA class II histocompatibility antigen, DP beta 1 chain 5.64e-03 2.53e-05 1.79e-04
1. PB P06342 H-2 class II histocompatibility antigen, A-Q beta chain 9.97e-03 1.03e-04 0.009
1. PB P06346 H-2 class II histocompatibility antigen, A-F beta chain (Fragment) 5.89e-03 3.85e-07 0.009
1. PB Q5RD09 Major histocompatibility complex class I-related gene protein 1.03e-03 1.61e-04 0.022
1. PB P10321 HLA class I histocompatibility antigen, C alpha chain 1.88e-03 9.78e-09 0.016
1. PB P03991 H-2 class I histocompatibility antigen, K-W28 alpha chain 1.30e-02 2.67e-06 0.013
1. PB P01899 H-2 class I histocompatibility antigen, D-B alpha chain 5.64e-03 1.31e-08 0.010
1. PB P30517 Saoe class I histocompatibility antigen, C alpha chain 2.75e-03 2.72e-07 0.005
1. PB P79483 HLA class II histocompatibility antigen, DR beta 3 chain 6.99e-03 4.82e-06 0.026
1. PB P30387 Class I histocompatibility antigen, Gogo-C*0203 alpha chain 2.44e-03 3.69e-08 0.004
1. PB P06343 H-2 class II histocompatibility antigen, A-K beta chain 5.28e-03 3.68e-05 0.022
1. PB P0DTU4 T cell receptor beta chain MC.7.G5 3.00e-05 4.65e-14 0.006
1. PB P05538 HLA class II histocompatibility antigen, DQ beta 2 chain 3.16e-03 2.00e-05 0.001
1. PB P33681 T-lymphocyte activation antigen CD80 2.40e-05 1.00e-17 0.017
1. PB Q8HWB0 Major histocompatibility complex class I-related gene protein 4.33e-04 8.29e-04 6.29e-06
1. PB P01921 H-2 class II histocompatibility antigen, A-D beta chain 8.16e-03 8.46e-05 0.008
1. PB P30686 Patr class I histocompatibility antigen, C alpha chain 2.02e-03 9.78e-09 0.031
1. PB Q7Z7D3 V-set domain-containing T-cell activation inhibitor 1 6.08e-04 5.81e-04 0.003
1. PB Q2KN22 IgG receptor FcRn large subunit p51 5.03e-03 5.94e-05 0.009
1. PB Q501W4 V-set domain-containing T-cell activation inhibitor 1 1.48e-03 8.73e-06 7.40e-04
1. PB P13747 HLA class I histocompatibility antigen, alpha chain E 6.60e-03 6.44e-07 7.01e-04
1. PB P01865 Ig gamma-2A chain C region, membrane-bound form 1.86e-06 1.53e-02 0.005
1. PB P30383 Class I histocompatibility antigen, Gogo-C*0101/C*0102 alpha chain 9.97e-04 7.00e-08 0.047
1. PB Q6DJ83 Cell adhesion molecule 2 6.76e-08 1.66e-05 7.80e-09
1. PB P04230 H-2 class II histocompatibility antigen, E-B beta chain 7.31e-03 1.66e-05 0.008
1. PB P06344 H-2 class II histocompatibility antigen, A-U beta chain 8.79e-03 1.63e-04 0.008
1. PB P15980 SLA class II histocompatibility antigen, DQ haplotype C alpha chain 1.31e-02 8.46e-09 0.010
1. PB Q00609 T-lymphocyte activation antigen CD80 1.36e-04 2.32e-13 0.002
1. PB Q29983 MHC class I polypeptide-related sequence A 5.34e-02 4.87e-06 4.82e-04
1. PB P01893 Putative HLA class I histocompatibility antigen, alpha chain H 2.19e-03 1.61e-07 0.001
1. PB P18211 Rano class II histocompatibility antigen, D-1 beta chain 3.86e-03 4.18e-06 0.006
1. PB P13748 Patr class I histocompatibility antigen, A-108 alpha chain 1.07e-03 1.47e-06 0.001
2. P A6NJW9 T-cell surface glycoprotein CD8 beta-2 chain 6.90e-03 1.46e-04 NA
2. P P27930 Interleukin-1 receptor type 2 1.71e-04 2.34e-07 NA
2. P P50895 Basal cell adhesion molecule 4.50e-04 5.86e-03 NA
2. P P03228 Secreted protein BARF1 NA 9.98e-07 NA
2. P Q6UDI7 Envelope glycoprotein C NA 1.91e-06 NA
2. P P40199 Carcinoembryonic antigen-related cell adhesion molecule 6 1.69e-04 1.70e-11 NA
2. P Q9NZQ7 Programmed cell death 1 ligand 1 3.83e-04 1.07e-08 NA
2. P P06126 T-cell surface glycoprotein CD1a 1.14e-02 9.94e-03 NA
2. P Q58DA5 Neurotrimin 7.18e-05 7.03e-09 NA
2. P P41725 Brevican core protein (Fragment) NA 2.59e-02 NA
2. P Q969P0 Immunoglobulin superfamily member 8 5.23e-03 8.22e-07 NA
2. P P20489 High affinity immunoglobulin epsilon receptor subunit alpha 3.60e-03 4.01e-04 NA
2. P Q5R4D0 Membrane cofactor protein 9.96e-02 1.91e-05 NA
2. P Q5NKU6 Intercellular adhesion molecule 3 2.47e-03 1.22e-02 NA
2. P Q9QJ17 Putative OX-2 membrane glycoprotein homolog NA 6.01e-08 NA
2. P Q9D7L8 Transmembrane and immunoglobulin domain-containing protein 1 1.97e-04 5.14e-05 NA
2. P A8MVZ5 Butyrophilin-like protein 10 6.65e-04 1.15e-10 NA
2. P Q68FQ2 Junctional adhesion molecule C 6.67e-05 6.48e-08 NA
2. P Q9XSI1 Cytotoxic T-lymphocyte protein 4 1.37e-03 1.14e-02 NA
2. P Q9JHJ8 ICOS ligand 2.98e-04 1.76e-13 NA
2. P P01882 Ig delta chain C region membrane-bound form 1.76e-05 9.25e-06 NA
2. P Q9D3G2 SLAM family member 8 4.53e-03 3.87e-09 NA
2. P Q99795 Cell surface A33 antigen 4.27e-05 3.36e-03 NA
2. P Q9Z0M9 Interleukin-18-binding protein 2.33e-02 1.03e-04 NA
2. P P43632 Killer cell immunoglobulin-like receptor 2DS4 3.22e-03 1.90e-04 NA
2. P P78410 Butyrophilin subfamily 3 member A2 1.63e-04 2.65e-05 NA
2. P Q5NKT8 Intercellular adhesion molecule 4 (Fragment) 5.08e-05 9.51e-14 NA
2. P P42072 Cytotoxic T-lymphocyte protein 4 4.76e-03 2.85e-04 NA
2. P F5HFB4 Membrane glycoprotein UL18 NA 6.24e-08 NA
2. P Q9D871 Carcinoembryonic antigen-related cell adhesion molecule 18 6.47e-05 1.04e-17 NA
2. P Q89738 Putative OX-2 membrane glycoprotein homolog NA 5.04e-07 NA
2. P Q9ES58 Cell surface glycoprotein CD200 receptor 1 1.04e-03 5.76e-12 NA
2. P Q9NY72 Sodium channel subunit beta-3 3.19e-02 1.86e-02 NA
2. P Q61790 Lymphocyte activation gene 3 protein 3.62e-03 7.33e-05 NA
2. P Q5NKV2 Intercellular adhesion molecule 2 8.94e-04 5.28e-04 NA
2. P P12319 High affinity immunoglobulin epsilon receptor subunit alpha 1.80e-03 3.89e-08 NA
2. P Q5NKV4 Intercellular adhesion molecule 1 6.72e-05 5.67e-06 NA
2. P Q5MGS7 Beta-2-microglobulin 4.30e-04 2.79e-02 NA
2. P Q9QZZ2 T-cell surface glycoprotein CD1b1 7.61e-03 3.18e-02 NA
2. P Q9NP99 Triggering receptor expressed on myeloid cells 1 4.57e-03 3.28e-07 NA
2. P Q6UXN2 Trem-like transcript 4 protein 1.40e-02 3.63e-02 NA
2. P Q09TM4 Low affinity immunoglobulin gamma Fc region receptor III 1.85e-02 3.71e-07 NA
2. P Q9Z109 V-set and immunoglobulin domain-containing protein 2 1.34e-04 4.82e-06 NA
2. P Q5RDA5 Triggering receptor expressed on myeloid cells 1 4.30e-03 1.74e-04 NA
2. P P31997 Carcinoembryonic antigen-related cell adhesion molecule 8 8.79e-05 1.31e-12 NA
2. P Q90773 Protein CEPU-1 9.30e-08 8.32e-07 NA
2. P Q8VBT3 Osteoclast-associated immunoglobulin-like receptor 1.91e-02 1.49e-11 NA
2. P P43303 Interleukin-1 receptor type 2 1.47e-04 1.15e-10 NA
2. P Q925P2 Carcinoembryonic antigen-related cell adhesion molecule 2 6.41e-04 8.14e-09 NA
2. P P04218 OX-2 membrane glycoprotein 5.52e-04 1.47e-15 NA
2. P Q99PJ0 Neurotrimin 2.09e-05 2.31e-07 NA
2. P Q13449 Limbic system-associated membrane protein 7.52e-06 1.12e-07 NA
2. P Q15109 Advanced glycosylation end product-specific receptor 1.05e-04 1.71e-07 NA
2. P Q00238 Intercellular adhesion molecule 1 7.34e-05 4.54e-06 NA
2. P Q8HWE5 MHC class I-like protein MILL2 1.82e-02 1.16e-02 NA
2. P P26151 High affinity immunoglobulin gamma Fc receptor I 2.14e-03 3.43e-02 NA
2. P P09326 CD48 antigen 7.56e-04 2.16e-10 NA
2. P Q8IYS5 Osteoclast-associated immunoglobulin-like receptor 6.01e-04 7.42e-03 NA
2. P P23150 H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) 2.33e-03 1.27e-10 NA
2. P A0A140LHF2 V-set and immunoglobulin domain-containing protein 10-like 2 2.44e-03 3.63e-02 NA
2. P P35613 Basigin 6.45e-04 1.66e-10 NA
2. P P29826 Rano class II histocompatibility antigen, B-1 beta chain 1.44e-02 6.53e-06 NA
2. P Q09TM2 Low affinity immunoglobulin gamma Fc region receptor III 2.56e-02 3.71e-07 NA
2. P Q28173 Advanced glycosylation end product-specific receptor 2.51e-05 7.09e-05 NA
2. P P24358 36 kDa major membrane protein F5 NA 8.55e-04 NA
2. P P16756 Uncharacterized protein UL14 NA 5.42e-03 NA
2. P Q4ACW4 Antigen-presenting glycoprotein CD1d 3.08e-02 3.04e-02 NA
2. P O88775 Embigin 6.87e-03 4.02e-02 NA
2. P O76036 Natural cytotoxicity triggering receptor 1 5.83e-04 2.62e-04 NA
2. P Q9NZC2 Triggering receptor expressed on myeloid cells 2 3.39e-02 1.21e-02 NA
2. P P14439 H-2 class II histocompatibility antigen, E-U alpha chain 1.17e-03 1.01e-05 NA
2. P Q9GKM2 Beta-2-microglobulin 1.18e-04 1.13e-03 NA
2. P Q22125 Zwei Ig domain protein zig-6 9.09e-03 6.47e-03 NA
2. P Q6UX52 Protein IL-40 1.34e-02 8.10e-05 NA
2. P P18181 CD48 antigen 7.01e-03 9.86e-08 NA
2. P Q4PPC4 Sodium channel subunit beta-1 6.06e-02 6.59e-04 NA
2. P Q14773 Intercellular adhesion molecule 4 1.33e-04 7.49e-13 NA
2. P P09793 Cytotoxic T-lymphocyte protein 4 6.21e-03 2.04e-02 NA
2. P M0RAS4 Immunoglobulin superfamily member 21 1.74e-04 1.69e-02 NA
2. P Q8IYV9 Izumo sperm-egg fusion protein 1 1.16e-01 8.59e-03 NA
2. P P16573 Carcinoembryonic antigen-related cell adhesion molecule 1 3.00e-04 4.81e-04 NA
2. P Q6XJV4 Cell surface glycoprotein CD200 receptor 4 5.04e-04 3.51e-14 NA
2. P Q9ES57 Cell surface glycoprotein CD200 receptor 1 6.23e-03 2.55e-15 NA
2. P A0A0G2K7V7 MHC class I-like protein MILL2 6.98e-03 3.71e-03 NA
2. P P15813 Antigen-presenting glycoprotein CD1d 1.04e-03 3.91e-02 NA
2. P Q13046 Putative pregnancy-specific beta-1-glycoprotein 7 2.82e-03 3.46e-02 NA
2. P Q15238 Pregnancy-specific beta-1-glycoprotein 5 4.86e-05 2.18e-06 NA
2. P P01911 HLA class II histocompatibility antigen, DRB1 beta chain 4.81e-03 1.13e-06 NA
2. P Q5NKV1 Intercellular adhesion molecule 2 2.48e-04 9.38e-03 NA
2. P Q17QN4 Sodium channel subunit beta-1 7.93e-03 6.66e-04 NA
2. P P20755 RLA class II histocompatibility antigen, DP alpha-1 chain (Fragment) 3.87e-03 1.79e-02 NA
2. P P15151 Poliovirus receptor 4.12e-07 2.65e-14 NA
2. P P42082 T-lymphocyte activation antigen CD86 2.72e-04 8.81e-09 NA
2. P P13597 Intercellular adhesion molecule 1 1.15e-04 1.47e-06 NA
2. P P16004 T-cell surface glycoprotein CD4 6.58e-04 3.97e-04 NA
2. P Q3KPI0 Carcinoembryonic antigen-related cell adhesion molecule 21 1.62e-03 5.27e-14 NA
2. P A0A0R4IGV4 Junctional adhesion molecule 2A 1.07e-04 1.91e-02 NA
2. P Q5RAL8 OX-2 membrane glycoprotein 1.09e-05 8.61e-18 NA
2. P P79184 T-cell surface glycoprotein CD4 5.18e-04 1.52e-03 NA
2. P Q90304 CD166 antigen homolog 3.91e-05 3.93e-04 NA
2. P Q95460 Major histocompatibility complex class I-related gene protein 1.28e-02 1.51e-04 NA
2. P P0DTU3 T cell receptor alpha chain MC.7.G5 9.01e-04 3.25e-13 NA
2. P P01830 Thy-1 membrane glycoprotein 1.23e-03 2.92e-03 NA
2. P Q9HCN6 Platelet glycoprotein VI 1.55e-03 3.94e-03 NA
2. P P01831 Thy-1 membrane glycoprotein 1.04e-02 6.73e-03 NA
2. P Q9JK00 Sodium channel subunit beta-3 1.55e-02 2.31e-02 NA
2. P P05362 Intercellular adhesion molecule 1 6.45e-05 3.55e-05 NA
2. P P08637 Low affinity immunoglobulin gamma Fc region receptor III-A 1.37e-02 8.02e-07 NA
2. P Q63495 Advanced glycosylation end product-specific receptor 3.20e-05 8.63e-07 NA
2. P P13598 Intercellular adhesion molecule 2 1.16e-04 2.16e-03 NA
2. P P01910 H-2 class II histocompatibility antigen, A-K alpha chain 6.42e-03 7.92e-09 NA
2. P Q1WIM1 Cell adhesion molecule 4 9.57e-08 4.20e-11 NA
2. P O75015 Low affinity immunoglobulin gamma Fc region receptor III-B 1.72e-02 5.35e-11 NA
2. P Q60513 Low affinity immunoglobulin gamma Fc region receptor II 6.96e-03 2.64e-02 NA
2. P P41217 OX-2 membrane glycoprotein 2.27e-06 4.48e-17 NA
2. P Q9Y639 Neuroplastin 1.86e-03 4.16e-10 NA
2. P P19256 Lymphocyte function-associated antigen 3 4.68e-03 8.86e-10 NA
2. P P13765 HLA class II histocompatibility antigen, DO beta chain 8.83e-03 2.92e-04 NA
2. P P27931 Interleukin-1 receptor type 2 1.58e-04 4.85e-09 NA
2. P P42070 T-lymphocyte activation antigen CD80 5.53e-05 2.50e-16 NA
2. P P21975 Putative Ig-like V-type domain-containing protein FPV055 NA 1.38e-03 NA
2. P Q00889 Pregnancy-specific beta-1-glycoprotein 6 2.00e-03 1.26e-04 NA
2. P P57087 Junctional adhesion molecule B 1.21e-03 2.80e-06 NA
2. P Q64735 Complement component receptor 1-like protein 1.67e-01 1.54e-03 NA
2. P Q28942 Low affinity immunoglobulin gamma Fc region receptor III 5.79e-03 7.51e-06 NA
2. P P33729 Intercellular adhesion molecule 1 (Fragment) 2.21e-05 4.27e-03 NA
2. P Q8TD46 Cell surface glycoprotein CD200 receptor 1 1.76e-03 1.54e-12 NA
2. P P30931 Tissue factor 2.43e-02 1.74e-03 NA
2. P Q6QUN5 Triggering receptor expressed on myeloid cells 1 1.47e-02 1.93e-05 NA
2. P Q8N743 Killer cell immunoglobulin-like receptor 3DL3 1.11e-03 1.70e-04 NA
2. P Q5XI43 Matrix remodeling-associated protein 8 7.92e-03 1.87e-03 NA
2. P Q8HXJ7 Sodium channel subunit beta-3 3.86e-02 1.77e-02 NA
2. P P68325 Envelope glycoprotein C NA 2.62e-13 NA
2. P Q9H7L2 Putative killer cell immunoglobulin-like receptor-like protein KIR3DX1 2.13e-04 9.59e-04 NA
2. P P80943 T-cell surface glycoprotein CD1b-3 (Fragment) 4.57e-04 3.64e-03 NA
2. P Q9BCU3 Major histocompatibility complex class I-related gene protein 7.51e-03 6.94e-05 NA
2. P P20138 Myeloid cell surface antigen CD33 1.30e-03 1.78e-03 NA
2. P Q8SPV8 Low affinity immunoglobulin gamma Fc region receptor II-a 1.43e-02 3.18e-02 NA
2. P P30376 Class I histocompatibility antigen, Gogo-A*0201 alpha chain 6.91e-04 9.98e-08 NA
2. P P18467 Patr class II histocompatibility antigen, DO beta chain 3.65e-03 1.32e-03 NA
2. P O75019 Leukocyte immunoglobulin-like receptor subfamily A member 1 6.70e-04 3.55e-08 NA
2. P H0VDZ8 Low affinity immunoglobulin gamma Fc region receptor IV 7.50e-04 5.92e-09 NA
2. P Q8VHK6 Interleukin-13 receptor subunit alpha-2 1.71e-03 4.31e-03 NA
2. P Q6UXZ0 Transmembrane and immunoglobulin domain-containing protein 1 1.65e-04 4.09e-06 NA
2. P Q07984 Translocon-associated protein subunit delta 2.58e-02 1.56e-02 NA
2. P P31809 Carcinoembryonic antigen-related cell adhesion molecule 1 5.37e-04 4.63e-07 NA
2. P P0CW72 Secreted protein BARF1 NA 9.98e-07 NA
2. P A7XV04 Selection and upkeep of intraepithelial T-cells protein 7 1.82e-04 1.19e-02 NA
2. P P31994 Low affinity immunoglobulin gamma Fc region receptor II-b 1.68e-03 5.02e-08 NA
2. P P21611 Beta-2-microglobulin 2.13e-04 4.53e-02 NA
2. P P06475 Envelope glycoprotein C NA 5.51e-12 NA
2. P Q7TPB4 CD276 antigen 1.27e-04 1.60e-11 NA
2. P A3KPA0 Junctional adhesion molecule 3B 3.37e-05 5.77e-07 NA
2. P Q6GMZ9 V-set and immunoglobulin domain-containing protein 10 1.14e-05 3.53e-03 NA
2. P P28067 HLA class II histocompatibility antigen, DM alpha chain 2.00e-03 6.06e-04 NA
2. P P53788 Sodium channel subunit beta-1 7.03e-02 1.72e-03 NA
2. P Q61450 Mast cell surface glycoprotein Gp49A 1.05e-02 7.64e-07 NA
2. P Q9JKE2 Triggering receptor expressed on myeloid cells 1 9.74e-04 1.19e-07 NA
2. P P12318 Low affinity immunoglobulin gamma Fc region receptor II-a 2.90e-03 2.35e-02 NA
2. P Q9CX63 Protein IL-40 3.69e-03 1.47e-06 NA
2. P P23505 Cell surface glycoprotein gp42 3.36e-04 1.57e-08 NA
2. P P11610 Antigen-presenting glycoprotein CD1d2 3.33e-03 4.02e-02 NA
2. P Q5BK54 Lymphocyte activation gene 3 protein 1.07e-02 3.97e-04 NA
2. P Q08338 T-cell surface glycoprotein CD4 1.54e-04 5.86e-03 NA
2. P P01730 T-cell surface glycoprotein CD4 6.84e-04 2.14e-05 NA
2. P Q9JLU8 Tissue factor 9.72e-03 4.37e-02 NA
2. P Q864T8 Beta-2-microglobulin 2.17e-04 7.64e-03 NA
2. P P08508 Low affinity immunoglobulin gamma Fc region receptor III 3.44e-02 1.15e-11 NA
2. P P97546 Neuroplastin 2.65e-03 4.65e-08 NA
2. P P18572 Basigin 3.69e-03 7.42e-11 NA
2. P Q9MZ08 Basal cell adhesion molecule 4.70e-04 1.14e-03 NA
2. P P20036 HLA class II histocompatibility antigen, DP alpha 1 chain 3.94e-03 5.30e-07 NA
2. P Q9UM44 HERV-H LTR-associating protein 2 1.76e-04 2.09e-05 NA
2. P Q00320 36 kDa major membrane protein F5 NA 1.31e-03 NA
2. P A8MTB9 Carcinoembryonic antigen-related cell adhesion molecule 18 9.09e-05 9.55e-05 NA
2. P Q8VCH2 CMRF35-like molecule 5 3.53e-03 5.15e-03 NA
2. P Q9UIR0 Butyrophilin-like protein 2 9.01e-07 1.82e-02 NA
2. P Q28806 Intercellular adhesion molecule 1 6.17e-05 1.49e-06 NA
2. P Q28740 Basigin 1.34e-02 6.52e-04 NA
2. P Q9WUL5 Programmed cell death 1 ligand 2 3.17e-04 1.02e-20 NA
2. P P13753 BOLA class I histocompatibility antigen, alpha chain BL3-7 6.58e-03 1.18e-07 NA
2. P P04228 H-2 class II histocompatibility antigen, A-D alpha chain 2.31e-03 4.20e-08 NA
2. P Q3B8P2 Fc receptor-like A 3.08e-03 1.71e-03 NA
2. P P07725 T-cell surface glycoprotein CD8 alpha chain 3.01e-02 1.06e-02 NA
2. P O18906 CD226 antigen 1.61e-03 1.46e-02 NA
2. P Q26474 Lachesin 1.99e-08 1.25e-07 NA
2. P Q9P121 Neurotrimin 5.92e-05 8.05e-08 NA
2. P O88174 Membrane cofactor protein 8.47e-02 6.07e-05 NA
2. P Q7Z3B1 Neuronal growth regulator 1 1.57e-05 3.47e-10 NA
2. P P11834 Opioid-binding protein/cell adhesion molecule 4.65e-05 2.44e-08 NA
2. P A6NMB1 Sialic acid-binding Ig-like lectin 16 6.08e-04 4.70e-06 NA
2. P Q14943 Killer cell immunoglobulin-like receptor 3DS1 1.22e-04 2.39e-05 NA
2. P Q9D8B7 Junctional adhesion molecule C 7.42e-05 7.28e-07 NA
2. P A6NGN9 IgLON family member 5 1.05e-05 1.76e-08 NA
2. P B6A8R8 T-cell-interacting, activating receptor on myeloid cells protein 1 3.71e-04 4.19e-09 NA
2. P P10252 CD48 antigen 3.54e-03 8.97e-13 NA
2. P Q29612 Interleukin-1 receptor type 2 1.63e-04 2.26e-08 NA
2. P Q8NFZ8 Cell adhesion molecule 4 1.40e-09 1.85e-11 NA
2. P O02839 Membrane cofactor protein 7.01e-02 1.37e-05 NA
2. P Q8VE98 CD276 antigen 1.10e-04 1.70e-11 NA
2. P Q9BX67 Junctional adhesion molecule C 6.09e-05 6.76e-06 NA
2. P Q8HWE7 MHC class I-like protein MILL1 1.73e-02 6.73e-03 NA
2. P P0DSE2 M1-specific T cell receptor beta chain 9.27e-05 1.61e-19 NA
2. P Q0V881 Lymphocyte antigen 6 complex locus protein G6f 1.41e-03 2.07e-07 NA
2. P Q3LRV9 Trem-like transcript 4 protein 8.60e-03 2.25e-02 NA
2. P Q8R464 Cell adhesion molecule 4 6.66e-08 9.31e-11 NA
2. P Q9W6V2 Neuronal growth regulator 1 5.26e-06 4.28e-06 NA
2. P P0C191 Platelet glycoprotein VI 1.41e-03 9.99e-04 NA
2. P P16410 Cytotoxic T-lymphocyte protein 4 1.66e-03 4.27e-03 NA
2. P P14436 H-2 class II histocompatibility antigen, A-R alpha chain 2.78e-03 7.13e-03 NA
2. P A5A6L6 Sodium channel subunit beta-1 6.13e-02 6.28e-03 NA
2. P Q16557 Pregnancy-specific beta-1-glycoprotein 3 4.29e-03 6.93e-03 NA
2. P Q863H2 Natural cytotoxicity triggering receptor 1 5.04e-03 3.44e-07 NA
2. P P01903 HLA class II histocompatibility antigen, DR alpha chain 7.23e-04 9.25e-08 NA
2. P G5EGI7 Zwei Ig domain protein zig-1 3.91e-03 2.82e-07 NA
2. P P04224 H-2 class II histocompatibility antigen, E-K alpha chain 1.18e-03 1.35e-05 NA
2. P Q62186 Translocon-associated protein subunit delta 3.35e-02 9.47e-03 NA
2. P P14378 Envelope glycoprotein C homolog NA 1.65e-07 NA
2. P Q6PCB8 Embigin 2.26e-03 1.42e-02 NA
2. P P97952 Sodium channel subunit beta-1 6.05e-02 4.96e-04 NA
2. P Q9XSM7 T-cell surface glycoprotein CD8 beta chain 8.05e-02 9.98e-05 NA
2. P P33500 Envelope glycoprotein C homolog NA 1.36e-04 NA
2. P P23735 Ig mu chain C region membrane-bound form 2.61e-05 9.16e-09 NA
2. P P30375 Class I histocompatibility antigen, Gogo-A*0101 alpha chain 1.17e-03 4.31e-08 NA
2. P P32506 Poliovirus receptor homolog 7.94e-07 6.18e-16 NA
2. P Q28110 Low affinity immunoglobulin gamma Fc region receptor II 2.99e-02 4.19e-09 NA
2. P P05540 T-cell surface glycoprotein CD4 3.45e-04 9.69e-04 NA
2. P P16003 T-cell surface glycoprotein CD4 5.58e-04 9.01e-04 NA
2. P Q08340 T-cell surface glycoprotein CD4 4.55e-04 7.42e-03 NA
2. P P01909 HLA class II histocompatibility antigen, DQ alpha 1 chain 1.29e-03 1.78e-07 NA
2. P P18535 Envelope glycoprotein C homolog NA 3.60e-08 NA
2. P Q3U497 CMRF35-like molecule 7 1.68e-01 4.81e-03 NA
2. P A6NFU0 Ig-like V-type domain-containing protein FAM187A 1.02e-02 7.47e-04 NA
2. P P11465 Pregnancy-specific beta-1-glycoprotein 2 9.88e-05 1.14e-04 NA
2. P Q9D780 SLAM family member 9 6.54e-03 2.33e-11 NA
2. P Q3T113 Transmembrane and immunoglobulin domain-containing protein 1 1.46e-04 9.58e-06 NA
2. P A0A0E4BZH1 Selection and upkeep of intraepithelial T-cells protein 1 8.22e-04 1.95e-03 NA
2. P Q0IJ12 V-set and transmembrane domain-containing protein 2B 2.27e-02 2.22e-02 NA
2. P Q64JA4 Sialic acid-binding Ig-like lectin 13 9.05e-07 3.38e-09 NA
2. P Q8MJZ2 Leukocyte immunoglobulin-like receptor subfamily A member 6 1.59e-03 5.50e-05 NA
2. P Q9Z0M4 Membrane cofactor protein 1.51e-01 1.67e-02 NA
2. P Q6PI73 Leukocyte immunoglobulin-like receptor subfamily A member 6 1.20e-03 7.68e-06 NA
2. P Q8BLK3 Limbic system-associated membrane protein 4.37e-05 2.92e-02 NA
2. P Q95132 Intercellular adhesion molecule 1 8.74e-05 1.42e-06 NA
2. P P27645 Low affinity immunoglobulin gamma Fc region receptor III 2.64e-02 4.32e-11 NA
2. P P59901 Leukocyte immunoglobulin-like receptor subfamily A member 4 4.67e-04 1.00e-05 NA
2. P P33706 T-cell surface glycoprotein CD8 alpha chain 3.06e-02 5.91e-07 NA
2. P Q61826 Mucosal addressin cell adhesion molecule 1 3.43e-04 2.85e-04 NA
2. P P17790 Basigin 4.11e-03 2.42e-09 NA
2. P Q98892 Opioid-binding protein/cell adhesion molecule homolog 4.08e-07 9.91e-06 NA
2. P P03173 Envelope glycoprotein C NA 5.88e-14 NA
2. P B0CLX4 V-set and immunoglobulin domain-containing protein 10 9.87e-06 1.17e-02 NA
2. P Q9JF44 Protein B5 NA 2.71e-04 NA
2. P O95998 Interleukin-18-binding protein 2.26e-02 4.79e-02 NA
2. P Q08708 CMRF35-like molecule 6 7.56e-03 3.77e-04 NA
2. P W5XKT8 Sperm acrosome membrane-associated protein 6 6.44e-02 1.60e-03 NA
2. P P0C6N0 Secreted protein BARF1 NA 9.98e-07 NA
2. P Q9XT56 Junctional adhesion molecule A 8.04e-04 8.68e-08 NA
2. P Q8CIQ3 Beta-2-microglobulin 1.51e-04 2.12e-02 NA
2. P Q62813 Limbic system-associated membrane protein 5.42e-06 8.36e-08 NA
2. P Q7TSN2 CMRF-35-like molecule 4 9.39e-03 4.49e-03 NA
2. P Q96IQ7 V-set and immunoglobulin domain-containing protein 2 7.71e-05 4.86e-04 NA
2. P P79107 Low affinity immunoglobulin gamma Fc region receptor III 1.68e-03 8.57e-08 NA
2. P Q8R0A6 V-set and transmembrane domain-containing protein 2A 3.95e-02 1.05e-03 NA
2. P P28078 Class II histocompatibility antigen, M alpha chain 4.58e-03 1.18e-04 NA
2. P A6NI73 Leukocyte immunoglobulin-like receptor subfamily A member 5 2.17e-03 1.41e-09 NA
2. P Q80Z24 Neuronal growth regulator 1 2.15e-06 5.56e-10 NA
2. P Q9JK39 Butyrophilin-like protein 10 6.34e-05 1.09e-07 NA
2. P Q08ET2 Sialic acid-binding Ig-like lectin 14 4.55e-05 2.35e-10 NA
2. P P24084 Protein B5 NA 3.16e-03 NA
2. P A0A0K2S4Q6 Protein CD300H 4.97e-02 4.53e-02 NA
2. P Q00888 Pregnancy-specific beta-1-glycoprotein 4 3.55e-03 5.86e-03 NA
2. P P18627 Lymphocyte activation gene 3 protein 2.51e-03 8.81e-09 NA
2. P Q6TYI6 Triggering receptor expressed on myeloid cells 1 2.80e-03 3.00e-06 NA
2. P P22650 Envelope glycoprotein C homolog NA 2.62e-05 NA
2. P Q8TAG5 V-set and transmembrane domain-containing protein 2A 3.43e-02 7.31e-04 NA
2. P P79185 T-cell surface glycoprotein CD4 5.16e-04 2.01e-03 NA
2. P A1YIY0 Fc receptor-like protein 6 2.31e-03 4.70e-05 NA
2. P P22596 Envelope glycoprotein C NA 3.77e-10 NA
2. P D3YZF7 V-set and immunoglobulin domain-containing protein 10-like 1.39e-02 1.52e-03 NA
2. P Q5NKV9 Intercellular adhesion molecule 1 6.25e-05 1.07e-05 NA
2. P A2A7V7 CMRF35-like molecule 6 3.13e-02 1.97e-02 NA
2. P Q6VE48 Membrane cofactor protein 1.18e-01 8.32e-07 NA
2. P P20037 Rano class II histocompatibility antigen, B alpha chain 3.61e-03 8.43e-06 NA
2. P Q08336 T-cell surface glycoprotein CD4 (Fragment) 9.58e-04 1.74e-03 NA
2. P Q07717 Beta-2-microglobulin 3.84e-04 2.38e-02 NA
2. P A3RFZ7 Low affinity immunoglobulin gamma Fc region receptor III 1.95e-02 5.36e-07 NA
2. P P70105 Membrane cofactor protein 1.59e-01 4.41e-02 NA
2. P G5EEY6 Zwei Ig domain protein zig-3 6.07e-03 4.71e-03 NA
2. P Q6PZD2 Tapasin 6.81e-04 1.58e-02 NA
2. P Q14954 Killer cell immunoglobulin-like receptor 2DS1 1.06e-02 6.42e-05 NA
2. P Q2YHT7 Cell surface glycoprotein CD200 receptor 1-A 1.18e-02 5.42e-08 NA
2. P A7E3C4 Ig-like V-type domain-containing protein FAM187A 7.05e-03 5.63e-03 NA
2. P P31783 T-cell surface glycoprotein CD8 alpha chain 1.65e-02 1.59e-03 NA
2. P Q5R412 Neuronal growth regulator 1 8.13e-06 5.12e-10 NA
2. P Q6ZMC9 Sialic acid-binding Ig-like lectin 15 1.11e-02 6.01e-08 NA
2. P P01904 H-2 class II histocompatibility antigen, E-D alpha chain 1.12e-03 1.32e-05 NA
2. P Q5UKY4 Cell surface glycoprotein CD200 receptor 3 1.12e-02 1.32e-06 NA
2. P Q89730 Envelope glycoprotein C NA 3.19e-12 NA
2. P P15981 SLA class II histocompatibility antigen, DQ haplotype D alpha chain 1.01e-02 7.72e-09 NA
2. P Q8BTP3 Cell surface glycoprotein CD200 receptor 5 8.53e-04 2.25e-13 NA
2. P Q01227 Protein B5 NA 1.69e-03 NA
2. P P23068 Class II histocompatibility antigen, B-L beta chain (Fragment) 5.80e-03 9.28e-07 NA
2. P P20352 Tissue factor 8.72e-02 6.40e-03 NA
2. P Q6S6Q5 Envelope glycoprotein C NA 2.62e-13 NA
2. P Q07699 Sodium channel subunit beta-1 6.97e-02 6.28e-03 NA
2. P Q9MYX7 Cytotoxic T-lymphocyte protein 4 3.98e-02 5.99e-04 NA
2. P O70540 Mucosal addressin cell adhesion molecule 1 1.18e-03 2.83e-03 NA
2. P P14426 H-2 class I histocompatibility antigen, D-K alpha chain 6.41e-03 7.18e-08 NA
2. P Q8SPW2 Low affinity immunoglobulin gamma Fc region receptor III 2.63e-02 3.94e-07 NA
2. P A5D7V5 Cell surface glycoprotein CD200 receptor 1 7.99e-03 6.26e-11 NA
2. P P16721 Protein UL11 NA 3.86e-03 NA
2. P Q9D3R5 Ig-like V-type domain-containing protein FAM187A 1.52e-02 1.02e-02 NA
2. P P01902 H-2 class I histocompatibility antigen, K-D alpha chain 9.41e-03 1.59e-07 NA
2. P Q14953 Killer cell immunoglobulin-like receptor 2DS5 8.06e-04 5.95e-06 NA
2. P P42071 T-lymphocyte activation antigen CD86 1.70e-03 3.28e-04 NA
2. P P24083 Plaque-size/host range protein NA 9.39e-04 NA
2. P O43699 Sialic acid-binding Ig-like lectin 6 7.81e-06 2.64e-03 NA
2. P Q98919 Limbic system-associated membrane protein 4.85e-06 2.72e-07 NA
2. P Q5NKV6 Intercellular adhesion molecule 1 3.82e-05 4.19e-07 NA
2. P P79336 T-cell surface glycoprotein CD8 beta chain 5.26e-02 3.50e-03 NA
2. P P01731 T-cell surface glycoprotein CD8 alpha chain 2.71e-02 2.07e-04 NA
2. P P01906 HLA class II histocompatibility antigen, DQ alpha 2 chain 2.71e-03 1.41e-08 NA
2. P Q5T2D2 Trem-like transcript 2 protein 2.21e-02 3.12e-02 NA
2. P Q9ERM2 Intercellular adhesion molecule 4 8.86e-04 1.42e-13 NA
2. P P0C788 OX-2 membrane glycoprotein homolog NA 1.98e-16 NA
2. P P35330 Intercellular adhesion molecule 2 1.29e-04 1.24e-02 NA
2. P A0A0B4J1G0 Low affinity immunoglobulin gamma Fc region receptor IV 2.83e-03 2.46e-06 NA
2. P P79138 Membrane cofactor protein 2.24e-01 1.02e-03 NA
2. P G5ED00 Zwei Ig domain protein zig-8 8.78e-04 1.15e-07 NA
2. P P33705 T-cell surface glycoprotein CD4 4.41e-04 8.82e-04 NA
2. P Q2TBX5 Translocon-associated protein subunit delta 2.99e-02 1.14e-02 NA
2. P Q95JB9 Natural cytotoxicity triggering receptor 1 4.74e-03 8.12e-04 NA
2. P Q9NQ25 SLAM family member 7 4.74e-03 1.89e-02 NA
2. P Q96A28 SLAM family member 9 6.29e-03 1.31e-05 NA
2. P P30434 T-cell surface glycoprotein CD8 beta chain 7.54e-03 4.46e-04 NA
2. P Q8K4F0 CD226 antigen 2.38e-03 2.85e-04 NA
2. P Q8HW98 IgLON family member 5 1.57e-05 6.57e-08 NA
2. P P10228 Envelope glycoprotein C NA 7.42e-03 NA
2. P Q9JHY1 Junctional adhesion molecule A 1.14e-03 2.80e-09 NA
2. P P32736 Opioid-binding protein/cell adhesion molecule 2.09e-05 1.33e-07 NA
2. P Q6MG56 Lymphocyte antigen 6 complex locus protein G6f 1.11e-03 1.59e-03 NA
2. P Q18806 Neuronal immunoglobulin domain-containing protein rig-3 2.35e-03 3.76e-02 NA
2. P P11464 Pregnancy-specific beta-1-glycoprotein 1 5.65e-03 4.29e-02 NA
2. P P14437 H-2 class II histocompatibility antigen, A-S alpha chain 3.69e-03 8.51e-03 NA
2. P Q9BD50 Major histocompatibility complex class I-related gene protein 1.46e-02 1.96e-04 NA
2. P Q68EV1 CD276 antigen homolog 4.72e-05 2.30e-11 NA
2. P Q91Y57 Sialic acid-binding Ig-like lectin 12 8.73e-07 1.52e-02 NA
2. P O15533 Tapasin 1.49e-03 3.53e-02 NA
2. P Q6XJV6 Cell surface glycoprotein CD200 receptor 2 1.32e-03 2.22e-19 NA
2. P P14434 H-2 class II histocompatibility antigen, A-B alpha chain 1.89e-03 5.05e-09 NA
2. P Q00954 Sodium channel subunit beta-1 5.95e-02 7.16e-04 NA
2. P Q62718 Neurotrimin 4.29e-05 7.00e-08 NA
2. P P22651 Envelope glycoprotein C homolog NA 2.05e-04 NA
2. P Q5REH6 Translocon-associated protein subunit delta 4.45e-02 3.56e-02 NA
2. P Q5SQ64 Lymphocyte antigen 6 complex locus protein G6f 1.09e-03 5.78e-08 NA
2. P P33865 36 kDa major membrane protein F5 NA 6.73e-03 NA
2. P Q99NH8 Triggering receptor expressed on myeloid cells 2 8.00e-02 1.62e-02 NA
2. P Q14982 Opioid-binding protein/cell adhesion molecule 9.74e-06 1.83e-08 NA
2. P P51571 Translocon-associated protein subunit delta 4.31e-02 3.56e-02 NA
2. P P06024 Envelope glycoprotein C homolog NA 2.97e-06 NA
2. P B6A8C7 T-cell-interacting, activating receptor on myeloid cells protein 1 4.93e-04 1.06e-09 NA
2. P Q00887 Pregnancy-specific beta-1-glycoprotein 9 1.19e-03 1.07e-03 NA
2. P P12371 High affinity immunoglobulin epsilon receptor subunit alpha 2.53e-03 2.45e-05 NA
2. P O54901 OX-2 membrane glycoprotein 1.33e-06 4.00e-15 NA
2. P Q6AXV7 Ig-like V-type domain-containing protein FAM187A 1.44e-02 7.35e-03 NA
2. P P24071 Immunoglobulin alpha Fc receptor 1.57e-02 3.38e-06 NA
2. P Q9UKJ0 Paired immunoglobulin-like type 2 receptor beta 1.07e-02 8.26e-03 NA
2. P Q2KI11 Sodium channel subunit beta-3 4.34e-02 1.38e-02 NA
2. P Q9Z0J8 Neuronal growth regulator 1 1.42e-05 7.52e-10 NA
2. P Q7TNR6 Immunoglobulin superfamily member 21 1.84e-04 2.54e-02 NA
2. P P41688 T-cell surface glycoprotein CD8 alpha chain 4.20e-02 6.30e-06 NA
2. P P11609 Antigen-presenting glycoprotein CD1d1 2.62e-03 1.46e-02 NA
2. P P14435 H-2 class II histocompatibility antigen, A-F alpha chain 3.59e-03 4.44e-03 NA
2. P P10966 T-cell surface glycoprotein CD8 beta chain 9.48e-03 7.25e-05 NA
2. P Q9Y624 Junctional adhesion molecule A 1.06e-03 3.04e-05 NA
2. P Q24372 Lachesin 3.00e-06 7.77e-14 NA
2. P Q9EP73 Programmed cell death 1 ligand 1 9.36e-06 1.20e-11 NA
2. P Q8BHK2 Sodium channel subunit beta-3 1.95e-02 4.09e-02 NA
2. P P28986 Envelope glycoprotein C NA 3.94e-03 NA
2. P Q63203 Low affinity immunoglobulin gamma Fc region receptor II 1.50e-02 9.14e-05 NA
2. P P20747 Putative Ig-like domain-containing protein ORF10 NA 2.29e-05 NA
2. P Q6Q8B3 Cell surface glycoprotein CD200 receptor 2 1.29e-03 5.81e-18 NA
2. P Q5IS61 Opioid-binding protein/cell adhesion molecule 9.73e-06 1.83e-08 NA
2. P Q96ID5 Immunoglobulin superfamily member 21 1.86e-04 2.16e-02 NA
2. P P10300 T-cell surface glycoprotein CD8 beta chain 1.61e-02 1.15e-02 NA
2. P Q9JLM2 Natural killer cell receptor 2B4 2.14e-03 3.27e-02 NA
2. P Q63493 Antigen-presenting glycoprotein CD1d 1.92e-02 1.51e-03 NA
2. P O57254 Protein B5 NA 3.69e-04 NA
2. P P21115 Protein B5 NA 9.39e-04 NA
2. P Q62151 Advanced glycosylation end product-specific receptor 2.24e-05 1.05e-05 NA
2. P Q6UXZ3 CMRF35-like molecule 5 6.75e-03 6.35e-05 NA
2. P P13688 Carcinoembryonic antigen-related cell adhesion molecule 1 3.24e-04 1.24e-04 NA
2. P Q9UQ72 Pregnancy-specific beta-1-glycoprotein 11 4.89e-05 1.87e-02 NA
2. P C1ITJ8 Major histocompatibility complex class I-related gene protein 1.50e-02 3.32e-04 NA
2. P Q9JKA5 Cell surface A33 antigen 2.53e-04 9.36e-06 NA
2. P P43631 Killer cell immunoglobulin-like receptor 2DS2 1.38e-02 4.20e-05 NA
2. P Q9ET39 SLAM family member 6 7.67e-03 1.14e-04 NA
2. P P26453 Basigin 1.14e-03 1.75e-09 NA
2. P Q30631 Mamu class II histocompatibility antigen, DR alpha chain 6.07e-04 1.89e-06 NA
2. P Q5R8H1 Tapasin-related protein 3.13e-03 2.64e-03 NA
2. P Q14952 Killer cell immunoglobulin-like receptor 2DS3 1.31e-02 8.20e-04 NA
2. P P06332 T-cell surface glycoprotein CD4 1.20e-03 2.78e-03 NA
2. P Q14002 Carcinoembryonic antigen-related cell adhesion molecule 7 3.36e-04 6.44e-13 NA
2. P P42081 T-lymphocyte activation antigen CD86 2.24e-03 6.09e-06 NA
2. P Q496F6 CMRF35-like molecule 2 2.56e-02 5.54e-06 NA
2. P P08560 Glycoprotein UL18 NA 4.09e-08 NA
2. P Q2WGK2 Junctional adhesion molecule A 8.09e-04 1.24e-07 NA
2. P Q08339 T-cell surface glycoprotein CD4 (Fragment) 5.40e-04 1.32e-03 NA
2. P Q9XS78 T-cell surface glycoprotein CD4 9.78e-04 1.54e-04 NA
2. P P31995 Low affinity immunoglobulin gamma Fc region receptor II-c 4.74e-03 6.45e-04 NA
2. P Q8R366 Immunoglobulin superfamily member 8 6.53e-03 6.57e-08 NA
2. P Q9P0V8 SLAM family member 8 2.20e-03 1.90e-07 NA
2. P O88792 Junctional adhesion molecule A 6.24e-04 6.16e-06 NA
2. P Q8N149 Leukocyte immunoglobulin-like receptor subfamily A member 2 2.25e-03 4.48e-09 NA
2. P Q6SWB7 Uncharacterized protein UL14 NA 7.27e-03 NA
2. P P97300 Neuroplastin 5.51e-04 4.48e-09 NA
2. P Q9BQ51 Programmed cell death 1 ligand 2 5.37e-05 2.26e-11 NA
2. P P32942 Intercellular adhesion molecule 3 9.84e-04 5.52e-03 NA
3. B O70355 Butyrophilin-like protein 2 7.30e-07 NA 2.41e-04
3. B Q86XK7 V-set and immunoglobulin domain-containing protein 1 1.78e-04 NA 3.24e-06
3. B P01696 Ig kappa chain V region K29-213 2.24e-04 NA 0.006
3. B P23087 Ig heavy chain C region, secreted form (Fragment) 1.59e-04 NA 2.67e-04
3. B Q07409 Contactin-3 4.89e-02 NA 0.029
3. B P20760 Ig gamma-2A chain C region 1.88e-07 NA 1.35e-04
3. B O95428 Papilin 1.70e-01 NA 0.006
3. B O42414 Neurofascin 1.57e-01 NA 0.029
3. B P01864 Ig gamma-2A chain C region secreted form 2.40e-07 NA 0.042
3. B Q3ZCH5 Zinc-alpha-2-glycoprotein 1.35e-02 NA 0.011
3. B P0DOX6 Immunoglobulin mu heavy chain 4.07e-06 NA 0.015
3. B P14429 H-2 class I histocompatibility antigen, Q7 alpha chain 8.32e-03 NA 0.043
3. B A0A0K0K1D8 T cell receptor beta variable 6-1 5.13e-03 NA 0.028
3. B P01860 Immunoglobulin heavy constant gamma 3 6.96e-06 NA 5.21e-04
3. B P0DP09 Immunoglobulin kappa variable 1-13 7.78e-03 NA 0.008
3. B Q9H106 Signal-regulatory protein delta 2.02e-06 NA 1.99e-32
3. B Q9D2J4 V-set and immunoglobulin domain-containing protein 1 2.55e-03 NA 7.68e-05
3. B Q9P232 Contactin-3 3.23e-02 NA 0.028
3. B Q967D7 Protein turtle 1.96e-02 NA 0.002
3. B P01637 Ig kappa chain V-V region T1 1.21e-03 NA 0.019
3. B P01872 Immunoglobulin heavy constant mu 2.80e-04 NA 0.024
3. B Q8VIM0 Hepatitis A virus cellular receptor 2 homolog 1.80e-02 NA 0.047
3. B P0DOX8 Immunoglobulin lambda-1 light chain 1.94e-06 NA 0.004
3. B P01694 Ig kappa chain V region 3547 2.74e-04 NA 0.028
3. B P15978 Class I histocompatibility antigen, Non-RT1.A alpha-1 chain 3.46e-02 NA 0.010
3. B P06336 Ig epsilon chain C region 6.53e-05 NA 0.050
3. B P04433 Immunoglobulin kappa variable 3-11 1.15e-02 NA 0.013
3. B P01635 Ig kappa chain V-V region K2 (Fragment) 3.81e-04 NA 0.005
3. B Q9U3P2 Synaptogenesis protein syg-2 3.28e-04 NA 0.008
3. B P0DPF4 T cell receptor alpha variable 35 4.81e-04 NA 0.015
3. B P06337 Ig mu chain C region 2.02e-04 NA 0.003
3. B P01619 Immunoglobulin kappa variable 3-20 8.33e-04 NA 1.42e-04
3. B Q9UPX0 Protein turtle homolog B 2.83e-02 NA 0.015
3. B P0DOX5 Immunoglobulin gamma-1 heavy chain 1.16e-06 NA 3.23e-04
3. B A0A0B4J274 T cell receptor alpha variable 20 1.31e-03 NA 0.021
3. B P01847 Ig lambda chain C region 5.95e-05 NA 0.010
3. B O95727 Cytotoxic and regulatory T-cell molecule 6.64e-05 NA 0.001
3. B Q63678 Zinc-alpha-2-glycoprotein 1.05e-02 NA 5.44e-05
3. B P03988 Ig mu chain C region secreted form 2.73e-04 NA 6.32e-05
3. B O60500 Nephrin 3.11e-03 NA 1.85e-04
3. B P01920 HLA class II histocompatibility antigen, DQ beta 1 chain 1.01e-02 NA 0.005
3. B A4IGL7 Peroxidasin 3.64e-02 NA 0.005
3. B Q62230 Sialoadhesin 6.68e-02 NA 0.005
3. B P25311 Zinc-alpha-2-glycoprotein 8.49e-03 NA 2.27e-04
3. B B7Z8K6 T cell receptor delta constant 5.28e-03 NA 6.80e-04
3. B P15983 SLA class II histocompatibility antigen, DQ haplotype D beta chain 1.09e-02 NA 6.22e-05
3. B P01868 Ig gamma-1 chain C region secreted form 2.69e-06 NA 0.004
3. B Q96RW7 Hemicentin-1 NA NA 0.024
3. B P97603 Neogenin (Fragment) 7.72e-02 NA 0.009
3. B P23086 Ig heavy chain C region (Fragment) 8.18e-05 NA 5.71e-04
3. B P97798 Neogenin 1.10e-01 NA 0.033
3. B A0A0A0MRZ8 Immunoglobulin kappa variable 3D-11 2.93e-04 NA 0.027
3. B Q8AYH8 Beta-2-microglobulin 2.33e-04 NA 0.002
3. B P01651 Ig kappa chain V-V region EPC 109 3.50e-04 NA 0.013
3. B P01822 Ig heavy chain V region MOPC 315 5.64e-05 NA 0.012
3. B P01863 Ig gamma-2A chain C region, A allele 3.61e-06 NA 0.002
3. B P01618 Ig kappa chain V region GOM 5.35e-04 NA 0.002
3. B P01682 Ig kappa chain V region 2717 NA NA 0.033
3. B B1Q236 Synaptogenesis protein syg-1 4.88e-04 NA 1.10e-05
3. B P0DOX4 Immunoglobulin epsilon heavy chain 2.00e-06 NA 0.021
3. B P01836 Ig kappa chain C region, A allele 7.59e-05 NA 0.003
3. B Q9EPF2 Cell surface glycoprotein MUC18 2.66e-04 NA 0.006
3. B A0A0B4J2D9 Immunoglobulin kappa variable 1D-13 4.42e-04 NA 0.008
3. B P43121 Cell surface glycoprotein MUC18 9.23e-05 NA 2.07e-04
3. B P01650 Ig kappa chain V-V region UPC 61 3.21e-04 NA 0.004
3. B P01652 Ig kappa chain V-V region J606 3.17e-04 NA 0.002
3. B O94856 Neurofascin 7.42e-02 NA 0.001
3. B P14428 H-2 class I histocompatibility antigen, K-Q alpha chain (Fragment) 2.79e-02 NA 0.012
3. B Q7Z553 MAM domain-containing glycosylphosphatidylinositol anchor protein 2 6.36e-03 NA 0.033
3. B P20767 Ig lambda-2 chain C region 2.46e-04 NA 0.028
3. B Q810U3 Neurofascin 1.26e-01 NA 0.005
3. B Q8NDA2 Hemicentin-2 NA NA 0.017
3. B P0DOX7 Immunoglobulin kappa light chain 6.68e-07 NA 8.42e-08
3. B P01857 Immunoglobulin heavy constant gamma 1 1.52e-05 NA 1.69e-04
3. B P01643 Ig kappa chain V-V region MOPC 173 NA NA 0.002
3. B P01862 Ig gamma-2 chain C region NA NA 0.003
3. B O73895 Tapasin 1.24e-05 NA 6.09e-04
3. B P01859 Immunoglobulin heavy constant gamma 2 1.81e-05 NA 2.02e-04
3. B A0A0C4DH25 Immunoglobulin kappa variable 3D-20 1.72e-02 NA 1.50e-04
3. B P20761 Ig gamma-2B chain C region 4.16e-07 NA 1.36e-05
3. B P01895 H-2 class I histocompatibility antigen, alpha chain (Fragment) 1.08e-03 NA 0.004
3. B Q0PMG2 MAM domain-containing glycosylphosphatidylinositol anchor protein 1 2.15e-02 NA 0.004
3. B P01896 H-2 class I histocompatibility antigen, alpha chain (Fragment) 2.12e-03 NA 0.006
3. B A0A0B4J1U7 Immunoglobulin heavy variable 6-1 1.35e-03 NA 0.011
3. B Q9PWR4 V-set and immunoglobulin domain-containing protein 1 2.28e-04 NA 5.89e-07
3. B P20759 Ig gamma-1 chain C region 1.41e-07 NA 1.12e-04
3. B P01854 Immunoglobulin heavy constant epsilon 1.11e-04 NA 0.016
3. B P01835 Ig kappa chain C region, B allele 7.87e-05 NA 0.001
3. B P01688 Ig kappa chain V region K-25 NA NA 0.019
3. B P84751 Ig heavy chain Mem5 (Fragment) 1.75e-05 NA 0.003
3. B P01636 Ig kappa chain V-V region MOPC 149 4.04e-04 NA 5.57e-04
3. B Q64726 Zinc-alpha-2-glycoprotein 1.50e-02 NA 0.004
3. B P23085 Ig heavy chain C region (Fragment) 7.69e-05 NA 2.97e-04
3. B P97685 Neurofascin 1.48e-01 NA 0.001
3. B P35329 B-cell receptor CD22 3.04e-04 NA 0.003
3. B A0A075B6H7 Probable non-functional immunoglobulin kappa variable 3-7 3.85e-04 NA 0.003
3. B Q8WZ42 Titin NA NA 0.001
3. B A0A0B4J275 T cell receptor alpha variable 17 6.22e-03 NA 8.29e-06
3. B P01879 Ig alpha chain C region (Fragment) 8.12e-04 NA 0.001
3. B P23084 Ig heavy chain C region (Fragment) 8.88e-05 NA 0.020
3. B P01691 Ig kappa chain V region 12F2 (Fragment) 1.34e-04 NA 5.35e-04
3. B P01684 Ig kappa chain V region 3374 1.78e-04 NA 0.006
3. B P20762 Ig gamma-2C chain C region 1.28e-06 NA 0.002
3. B Q5ZPR3 CD276 antigen 5.19e-07 NA 0.008
3. B P01846 Ig lambda chain C region 7.75e-05 NA 0.007
3. B Q9IA97 Beta-2-microglobulin 1.02e-04 NA 0.033
3. B P01653 Ig kappa chain V-V region W3082 3.41e-04 NA 0.006
3. B P84750 Ig kappa chain V region Mem5 (Fragment) 2.49e-04 NA 0.015
3. B P01683 Ig kappa chain V region 3315 1.59e-04 NA 3.42e-04
3. B A0A075B6S5 Immunoglobulin kappa variable 1-27 4.02e-04 NA 0.004
3. B P22648 Fasciclin-2 4.83e-03 NA 0.045
3. B P01837 Immunoglobulin kappa constant 7.57e-05 NA 0.026
3. B Q9R044 Nephrin 4.95e-04 NA 5.18e-04
3. B P01861 Immunoglobulin heavy constant gamma 4 1.59e-05 NA 2.06e-04
3. B A0A0C4DH55 Immunoglobulin kappa variable 3D-7 6.66e-03 NA 0.005
3. B Q6UXE8 Butyrophilin-like protein 3 4.87e-04 NA 6.95e-04
3. B Q96MS0 Roundabout homolog 3 1.49e-01 NA 0.038
3. B A2AJ76 Hemicentin-2 NA NA 0.004
3. B Q6UX41 Butyrophilin-like protein 8 5.28e-04 NA 3.46e-05
3. B A2ASS6 Titin NA NA 0.049
3. B Q62682 Contactin-3 1.05e-01 NA 0.039
3. B P01870 Ig gamma chain C region 5.04e-06 NA 0.002
3. B Q29RR6 V-set and immunoglobulin domain-containing protein 1 1.53e-03 NA 1.46e-07
3. B Q5R7W8 Butyrophilin subfamily 2 member A2 1.28e-02 NA 0.042