Summary

Q5U5X8

Homolog: Q6PGH4.
Function: Protein FAM222A.

Statistics

Total GO Annotation: 222
Unique PROST Go: 221
Unique BLAST Go: 0

Total Homologs: 98
Unique PROST Homologs: 94
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6PGH4 (Protein FAM222A) with a FATCAT P-Value: 2.65e-05 and RMSD of 10.34 angstrom. The sequence alignment identity is 91.0%.
Structural alignment shown in left. Query protein Q5U5X8 colored as red in alignment, homolog Q6PGH4 colored as blue. Query protein Q5U5X8 is also shown in right top, homolog Q6PGH4 showed in right bottom. They are colored based on secondary structures. 

  Q5U5X8 MLACLQRTQNAPGQHLACPSKSLELRKCEAVASAMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTSGQRYSPYPQHTAGYQ 100
  Q6PGH4 MLACLQRTQNPPGQHLACPSKSLDLRKCESVASSMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTSGQRYSPYPQHTAGYQ 100

  Q5U5X8 GLLAIVKAAVSSSSTAAPAG-PAKSVLKSAEGKRTKLSPAAVQVGIAPYPVPSTLGPLAYPKPPEAPAPPPGLPAAATAASVIPLPGRGLPLPPSNLPSI 199
  Q6PGH4 GLLAIVKAAVSSSA-HAPAGHP-KSVLKSVEGKRTKLSPATVQVGIAPYPVPSTLGPLAYPKPPEAPAPPPSLPAAATATSVIPLPGRGLPLPPSNLPSI 198

  Q5U5X8 HSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQP 299
  Q6PGH4 HSILYQLNQQCQAPGAAPSACQGVAVPHPSPAKHGPVPSFPNLAYSATAGLPDCRKGTELSQGATPALTLAGATKPAGYAEGGLDYLLWPQKPPPPPPQP 298

  Q5U5X8 LRAYSGSTVASK--SPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPAAAVVVTELGPGAARELAGPPADALSGLPSKSVC 397
  Q6PGH4 LRAYSSSTVAGKSQSPEICGGRAFERANGSPHNCGMGLPGSFTVGQYFAAPWNSVLVTPTSDCYNPAAAAVVTELAPGAARELAGPPGDVLSGLTSKSVC 398

  Q5U5X8 NTSVLSSSLQSLEYLINDIRPPCIKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR 452
  Q6PGH4 NTAVLSSSLQSLEYLINDIRPPCIKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR 453

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005654 nucleoplasm
2. P GO:0001570 vasculogenesis
2. P GO:0007442 hindgut morphogenesis
2. P GO:0080092 regulation of pollen tube growth
2. P GO:0007493 endodermal cell fate determination
2. P GO:0007369 gastrulation
2. P GO:0072189 ureter development
2. P GO:0016055 Wnt signaling pathway
2. P GO:0070670 response to interleukin-4
2. P GO:0001515 opioid peptide activity
2. P GO:0042074 cell migration involved in gastrulation
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0030048 actin filament-based movement
2. P GO:0060913 cardiac cell fate determination
2. P GO:0035254 glutamate receptor binding
2. P GO:0032755 positive regulation of interleukin-6 production
2. P GO:0003215 cardiac right ventricle morphogenesis
2. P GO:1990526 Ste12p-Dig1p-Dig2p complex
2. P GO:0010942 positive regulation of cell death
2. P GO:0035167 larval lymph gland hemopoiesis
2. P GO:0007399 nervous system development
2. P GO:0071920 cleavage body
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:0007507 heart development
2. P GO:0007626 locomotory behavior
2. P GO:0060174 limb bud formation
2. P GO:0061010 gall bladder development
2. P GO:0035289 posterior head segmentation
2. P GO:0031369 translation initiation factor binding
2. P GO:0048096
2. P GO:0098586 cellular response to virus
2. P GO:0007605 sensory perception of sound
2. P GO:0050693 LBD domain binding
2. P GO:0012505 endomembrane system
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0021556 central nervous system formation
2. P GO:0002314 germinal center B cell differentiation
2. P GO:0045995 regulation of embryonic development
2. P GO:0097229 sperm end piece
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0051707 response to other organism
2. P GO:0090575 RNA polymerase II transcription regulator complex
2. P GO:0060993 kidney morphogenesis
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:2000221 negative regulation of pseudohyphal growth
2. P GO:0071104 response to interleukin-9
2. P GO:0007266 Rho protein signal transduction
2. P GO:0043565 sequence-specific DNA binding
2. P GO:0001726 ruffle
2. P GO:0048235 pollen sperm cell differentiation
2. P GO:0003730 mRNA 3'-UTR binding
2. P GO:0002244 hematopoietic progenitor cell differentiation
2. P GO:0048749 compound eye development
2. P GO:0071105 response to interleukin-11
2. P GO:0007281 germ cell development
2. P GO:0017124 SH3 domain binding
2. P GO:0005884 actin filament
2. P GO:2000043 regulation of cardiac cell fate specification
2. P GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
2. P GO:0061031 endodermal digestive tract morphogenesis
2. P GO:0003697 single-stranded DNA binding
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0003183 mitral valve morphogenesis
2. P GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
2. P GO:0042835 BRE binding
2. P GO:0005667 transcription regulator complex
2. P GO:0030308 negative regulation of cell growth
2. P GO:1901739 regulation of myoblast fusion
2. P GO:0097356 perinucleolar compartment
2. P GO:0014009 glial cell proliferation
2. P GO:1905751 positive regulation of endosome to plasma membrane protein transport
2. P GO:0030036 actin cytoskeleton organization
2. P GO:0065003 protein-containing complex assembly
2. P GO:0007492 endoderm development
2. P GO:0007464 R3/R4 cell fate commitment
2. P GO:0060956 endocardial cell differentiation
2. P GO:0003211 cardiac ventricle formation
2. P GO:0001741 XY body
2. P GO:1990904 ribonucleoprotein complex
2. P GO:0003151 outflow tract morphogenesis
2. P GO:0021501 prechordal plate formation
2. P GO:0016441 posttranscriptional gene silencing
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0032184 SUMO polymer binding
2. P GO:0005856 cytoskeleton
2. P GO:0001841 neural tube formation
2. P GO:0045165 cell fate commitment
2. P GO:0007480 imaginal disc-derived leg morphogenesis
2. P GO:0060080 inhibitory postsynaptic potential
2. P GO:2000035 regulation of stem cell division
2. P GO:0031698 beta-2 adrenergic receptor binding
2. P GO:0008154 actin polymerization or depolymerization
2. P GO:0048839 inner ear development
2. P GO:2000218 negative regulation of invasive growth in response to glucose limitation
2. P GO:1990830 cellular response to leukemia inhibitory factor
2. P GO:0098789 pre-mRNA cleavage required for polyadenylation
2. P GO:0007376 cephalic furrow formation
2. P GO:0007379 segment specification
2. P GO:0005519 cytoskeletal regulatory protein binding
2. P GO:0060711 labyrinthine layer development
2. P GO:0015629 actin cytoskeleton
2. P GO:0070741 response to interleukin-6
2. P GO:0097150 neuronal stem cell population maintenance
2. P GO:0007440 foregut morphogenesis
2. P GO:0016199 axon midline choice point recognition
2. P GO:0000578 embryonic axis specification
2. P GO:0070669 response to interleukin-2
2. P GO:0048800 antennal morphogenesis
2. P GO:0048013 ephrin receptor signaling pathway
2. P GO:0035290 trunk segmentation
2. P GO:0045476 nurse cell apoptotic process
2. P GO:0071564 npBAF complex
2. P GO:0060914 heart formation
2. P GO:0006378 mRNA polyadenylation
2. P GO:0003713 transcription coactivator activity
2. P GO:0023019 signal transduction involved in regulation of gene expression
2. P GO:0007526 larval somatic muscle development
2. P GO:1900240 negative regulation of phenotypic switching
2. P GO:0072091 regulation of stem cell proliferation
2. P GO:0071559 response to transforming growth factor beta
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0060323 head morphogenesis
2. P GO:0030346 protein phosphatase 2B binding
2. P GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
2. P GO:0003289 atrial septum primum morphogenesis
2. P GO:0001947 heart looping
2. P GO:0045597 positive regulation of cell differentiation
2. P GO:0021547 midbrain-hindbrain boundary initiation
2. P GO:2000028 regulation of photoperiodism, flowering
2. P GO:0060214 endocardium formation
2. P GO:0003700 DNA-binding transcription factor activity
2. P GO:0010494 cytoplasmic stress granule
2. P GO:0007377 germ-band extension
2. P GO:0005634 nucleus
2. P GO:0001706 endoderm formation
2. P GO:2000744 positive regulation of anterior head development
2. P GO:1990527 Tec1p-Ste12p-Dig1p complex
2. P GO:0048617 embryonic foregut morphogenesis
2. P GO:0046827 positive regulation of protein export from nucleus
2. P GO:0035469 determination of pancreatic left/right asymmetry
2. P GO:0045732 positive regulation of protein catabolic process
2. P GO:0048382 mesendoderm development
2. P GO:0002328 pro-B cell differentiation
2. P GO:1900114 positive regulation of histone H3-K9 trimethylation
2. P GO:2000761 positive regulation of N-terminal peptidyl-lysine acetylation
2. P GO:0045588 positive regulation of gamma-delta T cell differentiation
2. P GO:0060563 neuroepithelial cell differentiation
2. P GO:0000381 regulation of alternative mRNA splicing, via spliceosome
2. P GO:0060712 spongiotrophoblast layer development
2. P GO:0007350 blastoderm segmentation
2. P GO:0070410 co-SMAD binding
2. P GO:0035910 ascending aorta morphogenesis
2. P GO:0035686 sperm fibrous sheath
2. P GO:0046020 negative regulation of transcription from RNA polymerase II promoter by pheromones
2. P GO:0021903 rostrocaudal neural tube patterning
2. P GO:0006376 mRNA splice site selection
2. P GO:0040018 positive regulation of multicellular organism growth
2. P GO:0060322 head development
2. P GO:0030154 cell differentiation
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0001525 angiogenesis
2. P GO:0036002 pre-mRNA binding
2. P GO:0003357 noradrenergic neuron differentiation
2. P GO:0098837 postsynaptic recycling endosome
2. P GO:0009908 flower development
2. P GO:0003143 embryonic heart tube morphogenesis
2. P GO:0009997 negative regulation of cardioblast cell fate specification
2. P GO:0001828 inner cell mass cellular morphogenesis
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0106222 lncRNA binding
2. P GO:1990837 sequence-specific double-stranded DNA binding
2. P GO:0060153 modulation by virus of host cell cycle
2. P GO:0009415 response to water
2. P GO:0042769 obsolete DNA damage response, detection of DNA damage
2. P GO:0007494 midgut development
2. P GO:0001714 endodermal cell fate specification
2. P GO:0007286 spermatid development
2. P GO:0071107 response to parathyroid hormone
2. P GO:0046332 SMAD binding
2. P GO:0030514 negative regulation of BMP signaling pathway
2. P GO:0003729 mRNA binding
2. P GO:0007366 periodic partitioning by pair rule gene
2. P GO:0021987 cerebral cortex development
2. P GO:1900111 positive regulation of histone H3-K9 dimethylation
2. P GO:0042754 negative regulation of circadian rhythm
2. P GO:0003340 negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
2. P GO:0010628 positive regulation of gene expression
2. P GO:0042472 inner ear morphogenesis
2. P GO:0050890 cognition
2. P GO:0043484 regulation of RNA splicing
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0045762 positive regulation of adenylate cyclase activity
2. P GO:0016514 SWI/SNF complex
2. P GO:0048866 stem cell fate specification
2. P GO:0061157 mRNA destabilization
2. P GO:0080151 positive regulation of salicylic acid mediated signaling pathway
2. P GO:0070121 Kupffer's vesicle development
2. P GO:0035050 embryonic heart tube development
2. P GO:0090102 cochlea development
2. P GO:0003779 actin binding
2. P GO:0008049 male courtship behavior
2. P GO:0061009 common bile duct development
2. P GO:0048533 sporocyte differentiation
2. P GO:0016360 sensory organ precursor cell fate determination
2. P GO:0001656 metanephros development
2. P GO:0045467 R7 cell development
2. P GO:0050727 regulation of inflammatory response
2. P GO:0003142 cardiogenic plate morphogenesis
2. P GO:0007469 antennal development
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0031648 protein destabilization
2. P GO:0003308 negative regulation of Wnt signaling pathway involved in heart development
2. P GO:0060215 primitive hemopoiesis
2. P GO:0030900 forebrain development
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0021782 glial cell development
2. P GO:0048366 leaf development
2. P GO:0007290 spermatid nucleus elongation
2. P GO:0044204 host cell nuclear matrix
2. P GO:0008013 beta-catenin binding
2. P GO:0051091 positive regulation of DNA-binding transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6PGH4 Protein FAM222A 2.65e-05 1.50e-86 0.0
1. PB Q5U5X8 Protein FAM222A 0 3.67e-157 0.0
1. PB Q6P539 Protein FAM222B 1.24e-01 1.12e-09 1.66e-30
1. PB Q8WU58 Protein FAM222B 1.50e-01 1.45e-09 5.46e-31
2. P Q3USH1 Inhibitory synaptic factor 2A 1.05e-01 1.63e-05 NA
2. P Q9D8Q6 Uncharacterized protein C11orf53 homolog 2.98e-01 3.98e-02 NA
2. P Q80TM6 R3H domain-containing protein 2 4.97e-01 7.44e-03 NA
2. P A7MB34 Protein FAM181B 3.02e-01 1.39e-04 NA
2. P O42601 Transcription factor Sox-17-beta.1 1.87e-01 3.77e-05 NA
2. P F4IGU3 Protein SPEAR2 6.18e-01 1.70e-02 NA
2. P Q2KJA4 POU domain class 2-associating factor 1 5.10e-01 3.40e-05 NA
2. P Q7TSA6 Proline and serine-rich protein 3 1.96e-01 2.11e-02 NA
2. P Q90ZH9 Transcription factor Sox-17-alpha-B 1.73e-01 3.53e-04 NA
2. P Q08DN6 Cdc42 effector protein 2 5.92e-01 3.29e-02 NA
2. P P84551 SKI family transcriptional corepressor 1 3.78e-01 9.05e-04 NA
2. P Q9BWW4 Single-stranded DNA-binding protein 3 5.96e-01 5.44e-07 NA
2. P Q5RFQ1 Protein SSXT 2.23e-01 2.30e-02 NA
2. P Q8K1I7 WAS/WASL-interacting protein family member 1 2.47e-01 1.13e-03 NA
2. P Q9H0L4 Cleavage stimulation factor subunit 2 tau variant 4.06e-01 2.01e-02 NA
2. P Q8TF74 WAS/WASL-interacting protein family member 2 1.58e-01 3.62e-02 NA
2. P O43516 WAS/WASL-interacting protein family member 1 2.09e-01 8.76e-04 NA
2. P Q9R050 Single-stranded DNA-binding protein 3 2.28e-01 1.23e-05 NA
2. P Q8IXT2 Doublesex- and mab-3-related transcription factor C2 2.69e-01 4.25e-03 NA
2. P Q16IB4 Protein distal antenna 3.08e-01 3.87e-02 NA
2. P Q29RM2 Protein FAM53C 3.79e-01 1.38e-02 NA
2. P Q9VBW6 Protein distal antenna 4.31e-01 9.27e-03 NA
2. P Q6NVN0 Transcription factor Sox-2 4.27e-01 1.57e-02 NA
2. P Q6GLH8 Transcription factor Sox-17-beta.2 4.76e-01 2.85e-05 NA
2. P Q6DGL6 Transcription factor Sox-1a 1.23e-01 2.41e-02 NA
2. P Q8AWH3 Transcription factor Sox-17-alpha 9.26e-02 1.56e-04 NA
2. P Q8BX46 SKI family transcriptional corepressor 1 7.57e-01 4.25e-04 NA
2. P Q98948 Single-stranded DNA-binding protein 3 2.82e-01 5.44e-07 NA
2. P Q9SWF9 Zinc finger CCCH domain-containing protein ZFN-like 3.07e-01 3.05e-02 NA
2. P Q8BH93 MAPK-interacting and spindle-stabilizing protein-like 5.23e-01 2.32e-02 NA
2. P Q3KQ35 Transcription factor Sox-17-alpha-A 4.92e-01 1.14e-03 NA
2. P Q16633 POU domain class 2-associating factor 1 5.92e-01 8.70e-06 NA
2. P Q8HXM1 Cleavage stimulation factor subunit 2 8.61e-02 4.60e-02 NA
2. P Q9D032 Single-stranded DNA-binding protein 3 2.17e-01 5.44e-07 NA
2. P P28659 CUGBP Elav-like family member 1 4.87e-01 3.07e-02 NA
2. P Q8C7E9 Cleavage stimulation factor subunit 2 tau variant 5.29e-01 2.99e-02 NA
2. P A7XYQ1 Sine oculis-binding protein homolog 3.14e-01 6.35e-04 NA
2. P Q2PG84 Transcription factor Sox-1 7.31e-01 2.68e-03 NA
2. P Q13495 Mastermind-like domain-containing protein 1 2.14e-01 4.00e-03 NA
2. P Q03063 Down-regulator of invasive growth 1 2.61e-01 9.27e-03 NA
2. P A5D8R3 Transcription factor Sox-17-beta.3 1.68e-01 2.11e-05 NA
2. P Q9H6I2 Transcription factor SOX-17 6.14e-02 2.90e-02 NA
2. P Q0P5V2 Sine oculis-binding protein homolog 3.31e-01 2.90e-02 NA
2. P Q9D424 Calcium-binding tyrosine phosphorylation-regulated protein 4.90e-01 1.84e-03 NA
2. P A7XYH9 Sine oculis-binding protein homolog 5.23e-01 8.04e-04 NA
2. P Q4QQT3 CUGBP Elav-like family member 1 6.22e-01 2.09e-02 NA
2. P Q15532 Protein SSXT 1.13e-01 3.52e-02 NA
2. P P81877 Single-stranded DNA-binding protein 2 1.83e-01 1.46e-05 NA
2. P Q9UKI2 Cdc42 effector protein 3 2.85e-01 1.77e-02 NA
2. P O81836 Protein SPOROCYTELESS 1.16e-01 5.06e-03 NA
2. P A2TED3 Transcription factor Sox-1 8.97e-02 1.05e-02 NA
2. P Q61473 Transcription factor SOX-17 4.54e-01 1.37e-03 NA
2. P Q8LFS6 RNA-binding protein BRN1 4.62e-01 3.59e-02 NA
2. P Q6IN36 WAS/WASL-interacting protein family member 1 4.05e-01 4.07e-04 NA
2. P A7XYH5 Sine oculis-binding protein homolog 6.86e-01 4.69e-04 NA
2. P Q6FWU4 Protein DSE3 1.67e-01 5.60e-03 NA
2. P Q9CYZ8 Single-stranded DNA-binding protein 2 3.88e-01 1.92e-05 NA
2. P Q6NZY7 Cdc42 effector protein 5 7.16e-01 7.54e-04 NA
2. P P48430 Transcription factor SOX-2 1.62e-01 5.72e-03 NA
2. P Q9BWG4 Single-stranded DNA-binding protein 4 2.53e-01 1.98e-08 NA
2. P A7XYI6 Sine oculis-binding protein homolog 7.58e-01 7.98e-03 NA
2. P G3CHK5 Protein EARLY FLOWERING 5 3.13e-01 1.80e-02 NA
2. P Q69022 Epstein-Barr nuclear antigen 2 NA 2.00e-03 NA
2. P P97769 Cbp/p300-interacting transactivator 1 5.77e-01 4.34e-02 NA
2. P A6ZMM3 Transcription activator MSS11 4.55e-01 4.26e-02 NA
2. P Q6FQE3 Enhancer of mRNA-decapping protein 1 4.21e-01 1.65e-02 NA
2. P Q64693 POU domain class 2-associating factor 1 2.31e-01 4.91e-05 NA
2. P P84550 SKI family transcriptional corepressor 1 4.51e-01 5.76e-04 NA
2. P O42569 Transcription factor Sox-2 6.50e-01 1.93e-02 NA
2. P Q6IDB0 Protein SPEAR3 3.13e-01 2.04e-03 NA
2. P P06602 Segmentation protein even-skipped 6.33e-02 1.10e-02 NA
2. P P24588 A-kinase anchor protein 5 2.27e-01 7.08e-05 NA
2. P Q91W92 Cdc42 effector protein 1 2.24e-01 1.02e-04 NA
2. P Q94FL7 Transcription factor MYB120 3.10e-01 2.15e-04 NA
2. P Q2Z1R2 Transcription factor Sox-1b 1.48e-01 6.14e-03 NA
2. P Q8AWH2 Transcription factor Sox-17-beta.1 1.13e-01 2.16e-06 NA
2. P B0X560 Protein distal antenna 9.95e-02 3.90e-04 NA
2. P Q84X40 Protein SPEAR1 3.97e-01 2.49e-02 NA
2. P Q92258 Protein GRISEA 3.46e-01 3.20e-06 NA
2. P Q6DDK1 Calcium-responsive transactivator 1.20e-01 1.95e-02 NA
2. P Q8R0W1 CLOCK-interacting pacemaker 8.38e-02 4.64e-02 NA
2. P Q5F3T7 CUGBP Elav-like family member 1 8.33e-01 7.44e-03 NA
2. P A1A5P0 Cdc42 effector protein 1 1.78e-01 4.82e-02 NA
2. P Q9UHV2 SERTA domain-containing protein 1 7.69e-01 4.34e-03 NA
2. P Q6F2F0 Transcription factor Sox-17-beta.3 6.00e-02 4.55e-06 NA
2. P Q9CQC5 Cdc42 effector protein 3 3.67e-01 2.93e-02 NA
2. P Q9JL10 SERTA domain-containing protein 1 7.24e-01 4.30e-02 NA
2. P Q92879 CUGBP Elav-like family member 1 5.69e-01 5.17e-03 NA
2. P P42284 Longitudinals lacking protein, isoforms H/M/V 5.82e-02 3.69e-02 NA
2. P Q06945 Transcription factor SOX-4 6.78e-02 8.49e-04 NA
2. P Q8BS90 Protein aurora borealis 3.57e-01 9.95e-03 NA
2. P Q62280 Protein SSXT 2.80e-01 1.38e-02 NA
2. P Q6PEV3 WAS/WASL-interacting protein family member 2 6.49e-01 3.62e-02 NA
2. P P23758 Paired box pox-neuro protein 2.43e-01 1.09e-02 NA