Summary

Q5VSR9

Homolog: Q6SJ91.
Function: Sperm protein associated with the nucleus on the X chromosome N1.

Statistics

Total GO Annotation: 14
Unique PROST Go: 11
Unique BLAST Go: 3

Total Homologs: 21
Unique PROST Homologs: 8
Unique BLAST Homologs: 9

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6SJ91 (Sperm protein associated with the nucleus on the X chromosome N1) with a FATCAT P-Value: 3.15e-05 and RMSD of 2.69 angstrom. The sequence alignment identity is 86.1%.
Structural alignment shown in left. Query protein Q5VSR9 colored as red in alignment, homolog Q6SJ91 colored as blue. Query protein Q5VSR9 is also shown in right top, homolog Q6SJ91 showed in right bottom. They are colored based on secondary structures. 

  Q5VSR9 MEQPTSSINGEKRKSPCESNNENDEMQETPNRDLAPEPSLKKMKTSEYSTVLAFCYRKAKKIHSNQLENDQS 72
  Q6SJ91 MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS 72

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0006338 chromatin remodeling
2. P GO:0005102 signaling receptor binding
2. P GO:0005179 hormone activity
2. P GO:0005516 calmodulin binding
2. P GO:0000785 chromatin
2. P GO:0007165 signal transduction
2. P GO:0010468 regulation of gene expression
2. P GO:0034728 nucleosome organization
2. P GO:0008217 regulation of blood pressure
2. P GO:0097746 blood vessel diameter maintenance
2. P GO:0042393 histone binding
3. B GO:0007283 spermatogenesis
3. B GO:0005634 nucleus
3. B GO:0007286 spermatid development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6SJ91 Sperm protein associated with the nucleus on the X chromosome N1 3.15e-05 1.23e-36 2.05e-40
1. PB Q5MJ07 Sperm protein associated with the nucleus on the X chromosome N5 4.75e-05 1.23e-36 2.05e-40
1. PB Q5VSR9 Sperm protein associated with the nucleus on the X chromosome N1 0 8.52e-136 6.93e-48
1. PB Q6SJ84 Sperm protein associated with the nucleus on the X chromosome N1 7.27e-05 2.68e-42 3.42e-41
2. P P29887 Protein F8 NA 2.48e-02 NA
2. P P21857 Urotensin-2 (Fragments) 1.05e-02 6.46e-04 NA
2. P Q05105 Uncharacterized 16.7 kDa protein NA 4.59e-02 NA
2. P Q07286 Uncharacterized protein BLRF3 (Fragment) NA 7.07e-04 NA
2. P Q5R6X9 cAMP-regulated phosphoprotein 21 9.24e-03 1.63e-03 NA
2. P Q3ZBJ9 Protein BEX5 7.48e-04 4.39e-02 NA
2. P Q10239 Histone H2A.Z-specific chaperone chz1 4.89e-02 4.79e-02 NA
2. P P14379 Transcriptional regulator ICP22 homolog (Fragment) NA 1.28e-02 NA
3. B Q0ZNK1 Sperm protein associated with the nucleus on the X chromosome N3 1.64e-02 NA 2.15e-31
3. B Q5MJ09 Sperm protein associated with the nucleus on the X chromosome N3 5.37e-02 NA 1.75e-29
3. B Q9NY87 Sperm protein associated with the nucleus on the X chromosome C 7.86e-02 NA 1.20e-09
3. B Q5MJ08 Sperm protein associated with the nucleus on the X chromosome N4 1.10e-02 NA 5.34e-11
3. B Q9NS25 Sperm protein associated with the nucleus on the X chromosome B1 1.57e-01 NA 5.38e-08
3. B Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 2.50e-02 NA 3.44e-29
3. B Q6SJ82 Sperm protein associated with the nucleus on the X chromosome N2 9.60e-03 NA 2.23e-41
3. B Q9NS26 Sperm protein associated with the nucleus on the X chromosome A 1.13e-02 NA 1.79e-12
3. B Q9BXN6 Sperm protein associated with the nucleus on the X chromosome D 7.94e-02 NA 3.20e-09