Summary

Q5VVM6

Homolog: Q6DD09.
Function: Calcium-binding and coiled-coil domain-containing protein 1-B.

Statistics

Total GO Annotation: 151
Unique PROST Go: 124
Unique BLAST Go: 27

Total Homologs: 56
Unique PROST Homologs: 52
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6DD09 (Calcium-binding and coiled-coil domain-containing protein 1-B) with a FATCAT P-Value: 4.57e-07 and RMSD of 8.28 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein Q5VVM6 colored as red in alignment, homolog Q6DD09 colored as blue. Query protein Q5VVM6 is also shown in right top, homolog Q6DD09 showed in right bottom. They are colored based on secondary structures. 

  Q5VVM6 MSQEKNEMFESEWSKEREREKQLASGLDTAEKALKVESEELQKSKSELICLYNEVHNLPGESESKDHFLIACDLLQRENSELETKVLKLSQEFAQLNHFT 100
  Q6DD09 ---------------------------------------------------------------------------------MES-ISQLQPPMG-VN-F- 15

  Q5VVM6 LGGKTAPSNLITSENT---C--KDP----ESNEP---ILETEIQS-RKEET--EELCP-KLGERKQKEIPEESVK-EGSF-PREGQKE------E--GSQ 174
  Q6DD09 L--NIAPTYI---PNTKVECHYTTPFGMKRSTRDWIGIFKVDTSSIRDYETFVWAVPPESSGERS---VSHCSVQFQAYYLPRPGEQQYHFRYVDQYGSV 107

  Q5VVM6 QNRDMKDEEKEQQLTM---KP-EEIVRLREELSHINQSLLQSQSSGDSSDDSGAQHPSSGEKLKYNQQGEVQQLHQNLHRLQILCNSAENELRYERGQNL 270
  Q6DD09 --RGCSDA-----FVFGEPRPMEELVTLEDE---------------DSCMDMLLVVP----KATF--------L-QN--QLE-MAQQERNDLMRAR---L 166

  Q5VVM6 DLKQHNSLLQEENIKIKIELKHAQQKLLDST-KMCSSLTAEYK-HCQQKIKELELEVLKHTQSIKSQNNLQEKL-VQEKSKVADAEEKILDLQRKLEHAH 367
  Q6DD09 ALEEE-VILKE---K---RINHL-EATLETSEKSCFSL----KEQCQ----DL---VMREQLAIE-EQSL---LSCQE----AELRERILQLQGEI---- 235

  Q5VVM6 KVCLTDTCISEK-QQLE--EKIKEATQNEAKV--KQQYQE--EQQKRKLLYQ-NVDELHRQVRTLQDKENLLEMTCSQQQSRIQQQE-ALLKQLENEKRK 458
  Q6DD09 K--IMNKKMQEKDRELEGTVAIKLSLENK-KVVLKQHLAETTVEIKR---YQLQVDSLREKLRSTQD---ML--SASQQKALLMGEELAAISSI-RDRTI 323

  Q5VVM6 YDEHVKS---NQELSEKLSKLQ-QEKEALREEYLRLLK-LLNVHVRNYNEKHHQQKVKLQKVKYRLTNEVEL-RDKRINQFEDEIGILQHKIEKEKAIQD 552
  Q6DD09 SDLH-KSRLETADLAIKVSDLSVKYKEGMGQWWQE--KTALN-H--SMEAKRDQI-VNLKAEKLSLENSLQAERSQR--Q------ALQCKL-------- 400

  Q5VVM6 QITAQNDTLLLEKRKLQEQVIEQEQLIHSNKWTISSIQS--RVLYMDKENKQLQENSLRLTQQIGFLERIIRSIHIRRGENLKEFPVPKWWHRGKLASLP 650
  Q6DD09 ----NQET---DARQVQ---------LSENRRQLSELKSALKVAQMEK--QQLREE--R--Q--GIL-QYARSLE-ERLDKLAD----ELWKEDKM--L- 467

  Q5VVM6 PTKKQKEIYSTEVFTSN--NAELQH---EDESVPEATEKWKHSEQMET-TISDILESEV-VNEILPLSNSSFSGKGLVESFASLQETEEIKSKEAMASSK 743
  Q6DD09 ----MEEI--TDL---NPPTLPVDHSDSDDES-P-GDE--RVSQQLEACSL-D--EQDLTIN--LP-------G------FPC-----EL-YKVVI---N 527

  Q5VVM6 SPEKSPENLVCS------QNSEAGYINVASLKETHGIQEQDQKSEL 783
  Q6DD09 QP--AP--IACQLQPLPEDNSDSW---------------------- 547

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:2000280 regulation of root development
2. P GO:0030500 regulation of bone mineralization
2. P GO:0097224 sperm connecting piece
2. P GO:0030705 cytoskeleton-dependent intracellular transport
2. P GO:0045141 meiotic telomere clustering
2. P GO:1902410 mitotic cytokinetic process
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0050775 positive regulation of dendrite morphogenesis
2. P GO:0071539 protein localization to centrosome
2. P GO:0072660 maintenance of protein location in plasma membrane
2. P GO:0050729 positive regulation of inflammatory response
2. P GO:0030142 COPI-coated Golgi to ER transport vesicle
2. P GO:0010375 stomatal complex patterning
2. P GO:0051026 chiasma assembly
2. P GO:0005819 spindle
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:2000146 negative regulation of cell motility
2. P GO:0044615 nuclear pore nuclear basket
2. P GO:0000022 mitotic spindle elongation
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0034398 telomere tethering at nuclear periphery
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0034451 centriolar satellite
2. P GO:1903861 positive regulation of dendrite extension
2. P GO:0003690 double-stranded DNA binding
2. P GO:1903003 positive regulation of protein deubiquitination
2. P GO:0005092 GDP-dissociation inhibitor activity
2. P GO:0010497 plasmodesmata-mediated intercellular transport
2. P GO:0085032 modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0000280 nuclear division
2. P GO:0035630 bone mineralization involved in bone maturation
2. P GO:0009101 glycoprotein biosynthetic process
2. P GO:0051224 negative regulation of protein transport
2. P GO:0030032 lamellipodium assembly
2. P GO:0035092 sperm DNA condensation
2. P GO:0008406 gonad development
2. P GO:0007030 Golgi organization
2. P GO:0000972 transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
2. P GO:0007099 centriole replication
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0036064 ciliary basal body
2. P GO:0031682 G-protein gamma-subunit binding
2. P GO:0008017 microtubule binding
2. P GO:0005929 cilium
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
2. P GO:0006997 nucleus organization
2. P GO:1901214 regulation of neuron death
2. P GO:0043422 protein kinase B binding
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0001673 male germ cell nucleus
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:0051019 mitogen-activated protein kinase binding
2. P GO:0006954 inflammatory response
2. P GO:1905349 ciliary transition zone assembly
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0070373 negative regulation of ERK1 and ERK2 cascade
2. P GO:0043622 cortical microtubule organization
2. P GO:0005815 microtubule organizing center
2. P GO:0051301 cell division
2. P GO:0051289 protein homotetramerization
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0000775 chromosome, centromeric region
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0098536 deuterosome
2. P GO:0005158 insulin receptor binding
2. P GO:0005136 interleukin-4 receptor binding
2. P GO:0031393 negative regulation of prostaglandin biosynthetic process
2. P GO:0005828 kinetochore microtubule
2. P GO:0000802 transverse filament
2. P GO:1902584 positive regulation of response to water deprivation
2. P GO:0005814 centriole
2. P GO:0042976 activation of Janus kinase activity
2. P GO:0030466 silent mating-type cassette heterochromatin assembly
2. P GO:0032880 regulation of protein localization
2. P GO:0007159 leukocyte cell-cell adhesion
2. P GO:0051959 dynein light intermediate chain binding
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0007283 spermatogenesis
2. P GO:1901925 negative regulation of protein import into nucleus during spindle assembly checkpoint
2. P GO:0051878 lateral element assembly
2. P GO:0000922 spindle pole
2. P GO:0000003 reproduction
2. P GO:0042532 negative regulation of tyrosine phosphorylation of STAT protein
2. P GO:0000800 lateral element
2. P GO:1904491 protein localization to ciliary transition zone
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0060271 cilium assembly
2. P GO:0003009 skeletal muscle contraction
2. P GO:0043184 vascular endothelial growth factor receptor 2 binding
2. P GO:0002755 MyD88-dependent toll-like receptor signaling pathway
2. P GO:0031929 TOR signaling
2. P GO:0005813 centrosome
2. P GO:0032815 negative regulation of natural killer cell activation
2. P GO:0005652 nuclear lamina
2. P GO:0008104 protein localization
2. P GO:0040001 establishment of mitotic spindle localization
2. P GO:0030030 cell projection organization
2. P GO:0051300 spindle pole body organization
2. P GO:0000795 synaptonemal complex
2. P GO:0005694 chromosome
2. P GO:0051296 establishment of meiotic spindle orientation
2. P GO:0051493 regulation of cytoskeleton organization
2. P GO:0051299 centrosome separation
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:1902017 regulation of cilium assembly
2. P GO:0000776 kinetochore
2. P GO:0000801 central element
2. P GO:0003391 amphid sensory organ dendrite retrograde extension
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0019905 syntaxin binding
2. P GO:0040016 embryonic cleavage
2. P GO:0000973 posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery
2. P GO:0051225 spindle assembly
2. P GO:0010564 regulation of cell cycle process
3. B GO:0031175 neuron projection development
3. B GO:0007411 axon guidance
3. B GO:0030334 regulation of cell migration
3. B GO:0061304 retinal blood vessel morphogenesis
3. B GO:0030155 regulation of cell adhesion
3. B GO:0005911 cell-cell junction
3. B GO:0048514 blood vessel morphogenesis
3. B GO:0045995 regulation of embryonic development
3. B GO:0060445 branching involved in salivary gland morphogenesis
3. B GO:0031012 extracellular matrix
3. B GO:0009888 tissue development
3. B GO:0005608 laminin-3 complex
3. B GO:0045198 establishment of epithelial cell apical/basal polarity
3. B GO:0007166 cell surface receptor signaling pathway
3. B GO:0062023 collagen-containing extracellular matrix
3. B GO:0060041 retina development in camera-type eye
3. B GO:0005201 extracellular matrix structural constituent
3. B GO:0002011 morphogenesis of an epithelial sheet
3. B GO:0005604 basement membrane
3. B GO:0043256 laminin complex
3. B GO:0043010 camera-type eye development
3. B GO:0005102 signaling receptor binding
3. B GO:0005606 laminin-1 complex
3. B GO:0008022 protein C-terminus binding
3. B GO:0043208 glycosphingolipid binding
3. B GO:0060441 epithelial tube branching involved in lung morphogenesis
3. B GO:0009887 animal organ morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5VVM6 Coiled-coil domain-containing protein 30 0 2.92e-123 0.0
1. PB Q8BVF4 Coiled-coil domain-containing protein 30 2.63e-03 1.64e-14 1.73e-168
1. PB Q8WP33 Coiled-coil domain-containing protein 30 6.66e-04 2.24e-53 0.0
2. P A6NI56 Coiled-coil domain-containing protein 154 6.09e-06 2.14e-02 NA
2. P Q7ZVT3 Spindle assembly abnormal protein 6 homolog 2.05e-03 7.79e-03 NA
2. P P21249 Major antigen 4.40e-01 1.74e-02 NA
2. P O61308 227 kDa spindle- and centromere-associated protein 7.82e-03 4.77e-03 NA
2. P Q3UPP8 Centrosomal protein of 63 kDa 1.01e-06 1.88e-02 NA
2. P Q9NUQ3 Gamma-taxilin 6.03e-05 9.47e-05 NA
2. P Q9DEX1 Calcium-binding and coiled-coil domain-containing protein 1-A 9.95e-05 1.74e-03 NA
2. P A2IDD5 Coiled-coil domain-containing protein 78 1.27e-02 6.77e-04 NA
2. P Q62209 Synaptonemal complex protein 1 7.18e-04 6.35e-03 NA
2. P Q6UVJ0 Spindle assembly abnormal protein 6 homolog 3.55e-03 3.64e-03 NA
2. P P32448 Anti-silencing protein 2 1.02e-05 1.25e-02 NA
2. P Q9LEZ4 Protein MICROTUBULE BINDING PROTEIN 2C 1.98e-02 2.43e-02 NA
2. P Q6PGZ0 Centrosomal protein of 63 kDa 1.98e-06 4.32e-02 NA
2. P Q6NRG6 Spindle assembly abnormal protein 6 homolog 1.03e-04 1.68e-04 NA
2. P Q8BI22 Centrosomal protein of 128 kDa 2.64e-03 2.54e-06 NA
2. P F3Y5P4 Girdin homolog 1.99e-04 2.74e-05 NA
2. P A0PJT0 RILP-like protein 1 2.33e-05 2.43e-02 NA
2. P Q9PW73 Cytoskeletal protein Sojo 1.50e-02 2.93e-03 NA
2. P Q6DFL0 Coiled-coil domain-containing protein 102A 2.00e-02 1.53e-03 NA
2. P Q5SPX1 Coiled-coil domain-containing protein 157 7.95e-05 1.38e-04 NA
2. P Q60563 Synaptonemal complex protein 1 (Fragment) 3.74e-04 1.89e-04 NA
2. P Q6ZU80 Centrosomal protein of 128 kDa 2.65e-04 1.58e-06 NA
2. P Q2TBH8 ZW10 interactor 3.27e-04 3.91e-02 NA
2. P Q8N137 Centrobin 1.95e-06 2.37e-02 NA
2. P Q4R703 Centrosomal protein of 63 kDa 1.12e-04 1.02e-05 NA
2. P A2BGD5 Calcium-binding and coiled-coil domain-containing protein 1 1.88e-03 5.71e-06 NA
2. P Q5M9N0 Coiled-coil domain-containing protein 158 2.61e-02 1.55e-02 NA
2. P Q8CB62 Centrobin 1.06e-05 1.39e-04 NA
2. P Q4R6W3 Testis-specific gene 10 protein 4.75e-03 7.01e-03 NA
2. P Q6DD09 Calcium-binding and coiled-coil domain-containing protein 1-B 4.57e-07 3.10e-03 NA
2. P Q5ZMV2 Spindle assembly abnormal protein 6 homolog 1.16e-03 4.73e-03 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 1.48e-05 3.75e-02 NA
2. P Q84WU4 Golgin candidate 3 1.57e-05 1.05e-03 NA
2. P Q15431 Synaptonemal complex protein 1 2.01e-03 1.79e-03 NA
2. P Q7FAD5 Synaptonemal complex protein ZEP1 5.12e-02 3.61e-04 NA
2. P P40457 Protein MLP2 2.14e-01 7.79e-03 NA
2. P Q05D60 Deuterosome assembly protein 1 5.15e-07 4.18e-02 NA
2. P Q86Z20 Coiled-coil domain-containing protein 125 3.70e-03 1.43e-02 NA
2. P Q15025 TNFAIP3-interacting protein 1 1.35e-05 2.22e-09 NA
2. P Q9WVQ0 Polyamine-modulated factor 1-binding protein 1 1.80e-06 1.91e-03 NA
2. P Q9I969 Beta-taxilin 1.42e-05 3.27e-02 NA
2. P Q8BHN1 Gamma-taxilin 4.62e-05 5.13e-03 NA
2. P Q3V6T2 Girdin 1.48e-03 1.49e-02 NA
2. P Q0JJ05 Nuclear matrix constituent protein 1b 9.05e-05 1.15e-02 NA
2. P P45970 Spindle apparatus protein lin-5 3.71e-03 1.00e-04 NA
2. P Q17QG3 RILP-like protein 1 2.12e-06 4.25e-02 NA
2. P Q8VYU6 Golgin candidate 4 4.53e-05 4.08e-05 NA
2. P A4IFI1 Coiled-coil domain-containing protein 157 3.36e-06 3.85e-03 NA
2. P Q8WXW3 Progesterone-induced-blocking factor 1 1.31e-05 1.79e-02 NA
2. P Q9WUU8 TNFAIP3-interacting protein 1 1.16e-04 2.80e-05 NA
2. P Q96MT8 Centrosomal protein of 63 kDa 1.73e-04 3.97e-04 NA
2. P Q8TBY8 Polyamine-modulated factor 1-binding protein 1 6.19e-05 4.14e-03 NA
3. B P19137 Laminin subunit alpha-1 NA NA 0.005