Summary

Q5W0V3

Homolog: Q0P4Q0.
Function: FHF complex subunit HOOK interacting protein 2B.

Statistics

Total GO Annotation: 99
Unique PROST Go: 91
Unique BLAST Go: 0

Total Homologs: 84
Unique PROST Homologs: 52
Unique BLAST Homologs: 19

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q0P4Q0 (FHF complex subunit HOOK interacting protein 2B) with a FATCAT P-Value: 0.0 and RMSD of 2.82 angstrom. The sequence alignment identity is 41.8%.
Structural alignment shown in left. Query protein Q5W0V3 colored as red in alignment, homolog Q0P4Q0 colored as blue. Query protein Q5W0V3 is also shown in right top, homolog Q0P4Q0 showed in right bottom. They are colored based on secondary structures. 

  Q5W0V3 MFSKFTSILQHAVEALAPSLPLQEDFVYHWKAITHYYIETSDDKAPVTDTNIPSHLEQMLDILVQEE-N---------ERESG---ETGPCMEYLLHHKI 87
  Q0P4Q0 MWGRLGAFLQQAVETREPTQDLLQSFIQHWKGVTQYYLETSDESCPARETDIPWRLRQLIDILVFEESNNGSQLSSGDEEDSGAGSHAGPCMEYLLQHKI 100

  Q5W0V3 LETLYTLGKADCPPGMKQQVLVFYTKLLGRIRQPLLPHINVHRPVQKLIRLCGE-VLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVP 186
  Q0P4Q0 LETLCTLAKAEYPPGMRQQVLLFYSRLLAKVQRPLLHYLSVHRPVQKLIALAEDPVGAT-AQKEELQFLTAVCTKLEKDPSLL---------------V- 183

  Q5W0V3 NVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQ---TELEDEPPHQMDHLSTSLDNLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEG 283
  Q0P4Q0 HVLEE----G-------SG-SR--VRCSG--G-EQDGETEARN---HK-----------------------PRQ--NLFKALLRLCTCQKGRLCVRAREA 238

  Q5W0V3 LM-LLVSLPEPAAAKCLTQSTCLCELLTDRLASLYKALPQSVDPLDIET-VEAINWGLDSYSHKEDASAFPGKRALISFLSWFDYCDQLIKEAQKTAAVA 381
  Q0P4Q0 LLRVLHSAQQEGPVHLIVQSK-LSQYVTEHLCELHRCIPLSIHPCDI-TALQETDWRKDSGSQESDGME-NAEAALQRFLCWVEYCDCLVRESHEVVAME 335

  Q5W0V3 LAKAVHERFFIGVMEPQLMQTSEMGILTSTALLHRIVRQVTSDVLLQEMVFFILGEQREPETLAEISR-HPLRHRLIEHCDHISDEISIMTLRMFEHLLQ 480
  Q0P4Q0 ITRSIKEGYLQGILQPELLEVSELSILRSTAILTAVLHRFTATPLLRQFLTFLFGDERGPETRGD--RGSQLRSQLIQRCNHLSDEISLASLRLFEEILQ 433

  Q5W0V3 KPNEHILYNLVLRNLEERNYTEYKPLC-PEDKDVVENGLIA----GAVDLEEDPLFTDISPENT---LPNQEWLSSSPPATPDHPKNDGKTEVHKIVNSF 572
  Q0P4Q0 MPEEIALHSLVIRNLETRSY-----LAGGQDES---RGQESETWDGAEELEEDPYFTDGFPD-TGIRLPRSDNAHRTEPA--------G-TE--QWVKSF 513

  Q5W0V3 LCLVPDDAKSSYHVEGTGYDTYLRDAHRQFRDYCAIC---LRWEWPGSPKALEKCNLEAAFFEGHFLKVLFDRMGRILDQPYDVNLQVTSVLSRLSLFPH 669
  Q0P4Q0 LSLVPEEIKSS----DTGYDGYLQDAIVQYRA-C--CQQVAQWGWPVSSKGTGHSQQE--FYEGHFMEVLLGRLGGILDQPYDVNLQVTSLLSRLALFPH 604

  Q5W0V3 PHIHEYLLDPYVNLAPGCRSLFSVIVRVVGDLMLRIQRIQDFTPKLLLVRKRLLGLEPEGPIIDHITLLEGVIVLEEFCKELAAIAFVKYHASSTP--- 765
  Q0P4Q0 PNLQEYLLNPFITLAPGARSLFSVLVRVVADLAQRSLRVPDLQEMLLLVRRQLLA-NSANEQLNHVTLCRGAVVLEEFCKELAAAACVT-H---SPVGF 698

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0008333 endosome to lysosome transport
1. PB GO:0007032 endosome organization
1. PB GO:0007040 lysosome organization
1. PB GO:0005829 cytosol
1. PB GO:0015031 protein transport
1. PB GO:1905719 protein localization to perinuclear region of cytoplasm
1. PB GO:0045022 early endosome to late endosome transport
1. PB GO:0070695 FHF complex
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0032039 integrator complex
2. P GO:0030126 COPI vesicle coat
2. P GO:0034333 adherens junction assembly
2. P GO:0015629 actin cytoskeleton
2. P GO:1903358 regulation of Golgi organization
2. P GO:0006886 intracellular protein transport
2. P GO:0034472 snRNA 3'-end processing
2. P GO:0030100 regulation of endocytosis
2. P GO:0048659 smooth muscle cell proliferation
2. P GO:0051285 cell cortex of cell tip
2. P GO:0048820 hair follicle maturation
2. P GO:0035147 branch fusion, open tracheal system
2. P GO:0031461 cullin-RING ubiquitin ligase complex
2. P GO:0072384 organelle transport along microtubule
2. P GO:0060323 head morphogenesis
2. P GO:0055105 ubiquitin-protein transferase inhibitor activity
2. P GO:0016197 endosomal transport
2. P GO:0032743 positive regulation of interleukin-2 production
2. P GO:0017196 N-terminal peptidyl-methionine acetylation
2. P GO:0006898 receptor-mediated endocytosis
2. P GO:0051666 actin cortical patch localization
2. P GO:0048514 blood vessel morphogenesis
2. P GO:0140312 cargo adaptor activity
2. P GO:0000138 Golgi trans cisterna
2. P GO:0006897 endocytosis
2. P GO:0090498 extrinsic component of Golgi membrane
2. P GO:0016180 snRNA processing
2. P GO:0035158 regulation of tube diameter, open tracheal system
2. P GO:0031417 NatC complex
2. P GO:0042692 muscle cell differentiation
2. P GO:0072583 clathrin-dependent endocytosis
2. P GO:0001835 blastocyst hatching
2. P GO:0007030 Golgi organization
2. P GO:0000147 actin cortical patch assembly
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0008287 protein serine/threonine phosphatase complex
2. P GO:0080008 Cul4-RING E3 ubiquitin ligase complex
2. P GO:0005905 clathrin-coated pit
2. P GO:0030707 ovarian follicle cell development
2. P GO:0032006 regulation of TOR signaling
2. P GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0032515 negative regulation of phosphoprotein phosphatase activity
2. P GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
2. P GO:0030121 AP-1 adaptor complex
2. P GO:0001533 cornified envelope
2. P GO:0019899 enzyme binding
2. P GO:0005844 polysome
2. P GO:0036063 acroblast
2. P GO:0080163 regulation of protein serine/threonine phosphatase activity
2. P GO:0016020 membrane
2. P GO:0046854 phosphatidylinositol phosphate biosynthetic process
2. P GO:0016342 catenin complex
2. P GO:0008356 asymmetric cell division
2. P GO:0008362 chitin-based embryonic cuticle biosynthetic process
2. P GO:0048489 synaptic vesicle transport
2. P GO:0007436 larval salivary gland morphogenesis
2. P GO:0006474 N-terminal protein amino acid acetylation
2. P GO:0010883 regulation of lipid storage
2. P GO:0007424 open tracheal system development
2. P GO:0042327 positive regulation of phosphorylation
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0005794 Golgi apparatus
2. P GO:0098793 presynapse
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0042130 negative regulation of T cell proliferation
2. P GO:0035149 lumen formation, open tracheal system
2. P GO:0019902 phosphatase binding
2. P GO:0035615 clathrin adaptor activity
2. P GO:0040029 regulation of gene expression, epigenetic
2. P GO:0060348 bone development
2. P GO:0038010 positive regulation of signal transduction by receptor internalization
2. P GO:0098609 cell-cell adhesion
2. P GO:0017022 myosin binding
2. P GO:1990386 mitotic cleavage furrow ingression
2. P GO:0071933 Arp2/3 complex binding
2. P GO:0005797 Golgi medial cisterna
2. P GO:0000139 Golgi membrane
2. P GO:0034332 adherens junction organization
2. P GO:0005171 hepatocyte growth factor receptor binding
2. P GO:0048488 synaptic vesicle endocytosis
2. P GO:0043666 regulation of phosphoprotein phosphatase activity
2. P GO:0032434 regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0046664 dorsal closure, amnioserosa morphology change
2. P GO:0007112 male meiosis cytokinesis
2. P GO:0030119 AP-type membrane coat adaptor complex
2. P GO:0031462 Cul2-RING ubiquitin ligase complex
2. P GO:0030122 AP-2 adaptor complex
2. P GO:0003383 apical constriction

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N612 FHF complex subunit HOOK interacting protein 1B 1.49e-06 1.17e-02 1.47e-06
1. PB Q5W0V3 FHF complex subunit HOOK interacting protein 2A 0 2.78e-137 0.0
1. PB Q3U2I3 FHF complex subunit HOOK interacting protein 1B 9.93e-11 1.43e-03 2.10e-08
1. PB Q66H54 FHF complex subunit HOOK interacting protein 1B 4.08e-09 1.70e-10 1.92e-08
1. PB A0JNG7 FHF complex subunit HOOK interacting protein 2A 0.00e+00 3.56e-97 0.0
1. PB A8P7J8 FHIP family protein Bm1_18400 5.76e-05 1.03e-03 0.001
1. PB Q86V87 FHF complex subunit HOOK interacting protein 2B 3.33e-16 1.70e-36 0.0
1. PB Q80YR2 FHF complex subunit HOOK interacting protein 2B 8.33e-15 5.81e-32 0.0
1. PB A0JPF5 FHF complex subunit HOOK interacting protein 2B 0.00e+00 7.05e-29 0.0
1. PB Q0P4Q0 FHF complex subunit HOOK interacting protein 2B 0.00e+00 1.07e-25 2.00e-179
1. PB Q5R8V2 FHF complex subunit HOOK interacting protein 1B 5.86e-10 2.88e-02 1.14e-07
1. PB A0JPG1 FHF complex subunit HOOK interacting protein 2A 0.00e+00 4.08e-75 0.0
1. PB Q8CDM8 FHF complex subunit HOOK interacting protein 2A 0.00e+00 1.78e-89 0.0
2. P Q8C0Y0 Serine/threonine-protein phosphatase 4 regulatory subunit 4 3.40e-02 7.92e-03 NA
2. P Q8CHT3 Integrator complex subunit 5 8.96e-03 1.11e-02 NA
2. P Q6DKG0 N-alpha-acetyltransferase 35, NatC auxiliary subunit 4.43e-02 1.14e-02 NA
2. P Q75A44 Protein LDB17 5.96e-03 1.21e-02 NA
2. P Q9C0W7 AP-2 complex subunit alpha 1.38e-02 1.24e-02 NA
2. P Q8TEL6 Short transient receptor potential channel 4-associated protein 5.98e-03 1.08e-06 NA
2. P O13776 Ubp5-interacting protein ftp105 4.61e-02 3.30e-06 NA
2. P P91926 AP-2 complex subunit alpha 9.89e-03 1.74e-02 NA
2. P Q9JLV2 Short transient receptor potential channel 4-associated protein 4.96e-03 2.31e-07 NA
2. P Q8I0G5 Coatomer subunit gamma 2.32e-02 1.37e-02 NA
2. P Q6PD19 Armadillo-like helical domain-containing protein 3 2.93e-02 6.91e-04 NA
2. P Q5T2E6 Armadillo-like helical domain-containing protein 3 4.74e-03 8.50e-05 NA
2. P Q8R1F6 Protein HID1 1.11e-02 1.12e-06 NA
2. P Q7KNA0 Dymeclin 3.47e-03 2.29e-05 NA
2. P Q8CHY3 Dymeclin 3.31e-02 4.27e-09 NA
2. P Q6DCT2 Armadillo-like helical domain-containing protein 3 3.37e-02 3.96e-04 NA
2. P B4F766 Dymeclin 1.50e-02 8.68e-08 NA
2. P Q8BG67 Protein EFR3 homolog A 2.47e-03 3.44e-02 NA
2. P Q5ZLW3 Dymeclin 1.82e-02 3.85e-09 NA
2. P Q7RTS9 Dymeclin 2.24e-02 2.38e-08 NA
2. P Q4R708 N-alpha-acetyltransferase 35, NatC auxiliary subunit 2.79e-02 2.70e-03 NA
2. P Q54JJ6 Protein HID1 6.57e-03 8.52e-04 NA
2. P Q6PGW3 Armadillo-like helical domain-containing protein 3 4.05e-03 6.70e-04 NA
2. P Q6PHQ8 N-alpha-acetyltransferase 35, NatC auxiliary subunit 2.75e-02 2.67e-03 NA
2. P Q9HDV3 Hid-1 family protein P19A11.07c 6.63e-03 7.71e-04 NA
2. P Q29N38 AP-2 complex subunit alpha 1.49e-02 1.37e-02 NA
2. P Q9P7M6 Hid-1 family protein P27G11.12 2.01e-02 4.12e-03 NA
2. P Q92990 Glomulin 5.74e-04 3.60e-02 NA
2. P A8XW52 FHIP family protein CBG19667 1.02e-05 2.07e-04 NA
2. P F6S215 AP-5 complex subunit beta-1 2.49e-03 6.44e-03 NA
2. P Q8IV36 Protein HID1 1.89e-02 6.87e-07 NA
2. P G3MZC5 AP-5 complex subunit beta-1 1.49e-02 8.27e-08 NA
2. P B0G194 Dymeclin 2.25e-02 2.49e-02 NA
2. P Q5VZE5 N-alpha-acetyltransferase 35, NatC auxiliary subunit 4.35e-02 2.57e-03 NA
2. P Q3TAP4 AP-5 complex subunit beta-1 1.76e-02 2.05e-07 NA
2. P O75843 AP-1 complex subunit gamma-like 2 1.31e-02 2.83e-02 NA
2. P Q6ZQ18 Protein EFR3 homolog B 6.90e-03 1.45e-02 NA
2. P Q2VPB7 AP-5 complex subunit beta-1 1.07e-02 4.82e-07 NA
2. P Q6DCP6 Dymeclin 3.02e-02 6.55e-07 NA
2. P Q9Y2G0 Protein EFR3 homolog B 8.16e-03 9.92e-03 NA
2. P Q14156 Protein EFR3 homolog A 1.03e-03 4.75e-02 NA
2. P P35220 Catenin alpha 4.05e-03 2.53e-02 NA
2. P Q5RAW5 Dymeclin 1.53e-02 2.38e-08 NA
2. P P53036 SIT4-associating protein SAP4 4.26e-03 3.54e-04 NA
2. P Q28BM0 Dymeclin 2.35e-02 8.48e-07 NA
2. P Q293C2 Dymeclin 1.00e-02 8.32e-05 NA
2. P Q5ZHV2 N-alpha-acetyltransferase 35, NatC auxiliary subunit 3.25e-02 1.03e-02 NA
2. P Q7T322 N-alpha-acetyltransferase 35, NatC auxiliary subunit 2.54e-02 1.17e-04 NA
2. P D3ZVB0 AP-5 complex subunit beta-1 9.80e-03 9.64e-07 NA
2. P Q5RBT3 N-alpha-acetyltransferase 35, NatC auxiliary subunit 4.60e-02 2.57e-03 NA
2. P Q7QG73 AP-2 complex subunit alpha 5.70e-03 5.33e-03 NA
2. P Q641A2 Protein EFR3 homolog A 1.69e-03 4.62e-02 NA
3. B B0V207 FHF complex subunit HOOK interacting protein 1B 1.72e-04 NA 6.58e-11
3. B Q05DH4 FHF complex subunit HOOK interacting protein 1A 1.64e-06 NA 1.52e-07
3. B Q505K2 FHF complex subunit HOOK interacting protein 1A 2.63e-05 NA 1.10e-07
3. B A9UYK7 FHIP family protein 36947 5.79e-10 NA 6.68e-06
3. B A7YY62 FHF complex subunit HOOK interacting protein 1B 6.71e-06 NA 7.23e-06
3. B B4NXB9 FHIP family protein GE18198 1.93e-08 NA 1.56e-05
3. B B3NAN9 FHIP family protein GG24907 2.62e-08 NA 1.13e-05
3. B Q9VQK0 FHIP family protein CG3558 7.36e-08 NA 1.24e-07
3. B B5DI68 FHIP family protein GA25918 5.96e-08 NA 1.49e-05
3. B B3MLI0 FHIP family protein GF15501 2.41e-08 NA 2.00e-06
3. B B4LQW4 FHIP family protein GJ17503 3.23e-08 NA 3.86e-06
3. B A7S6A1 FHIP family protein v1g243165 7.30e-10 NA 1.76e-09
3. B B4JQY3 FHIP family protein GH13096 8.84e-09 NA 1.83e-05
3. B B0X755 FHIP family protein CPIJ015043 1.79e-08 NA 1.45e-08
3. B B4KJS5 FHIP family protein GI14169 1.25e-09 NA 7.61e-07
3. B B4MTY2 FHIP family protein GK23746 1.42e-09 NA 5.02e-08
3. B B4G8N3 FHIP family protein GL19323 6.15e-09 NA 1.10e-05
3. B Q7PZ36 FHIP family protein AGAP011705 1.05e-08 NA 4.95e-06
3. B Q17AI4 FHIP family protein AAEL005291 1.41e-07 NA 3.42e-06