Summary

Q5XKR9

Homolog: Q74ZL7.
Function: Ribosome assembly protein 3.

Statistics

Total GO Annotation: 56
Unique PROST Go: 56
Unique BLAST Go: 0

Total Homologs: 48
Unique PROST Homologs: 46
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q74ZL7 (Ribosome assembly protein 3) with a FATCAT P-Value: 0.0106 and RMSD of 2.68 angstrom. The sequence alignment identity is 15.8%.
Structural alignment shown in left. Query protein Q5XKR9 colored as red in alignment, homolog Q74ZL7 colored as blue. Query protein Q5XKR9 is also shown in right top, homolog Q74ZL7 showed in right bottom. They are colored based on secondary structures. 

  Q5XKR9 -------------MGG---CPVRKRRR----NGSKEGNH--HSTQP----KRNKRNPIFQDSQDTEFSWSDNERSSSRINIPERASGPEGNLNQI-VTEP 73
  Q74ZL7 MSTEISAAAPRRAANGKKRANRRKKRRTQAESDSSDSSDSSESSQPSADEQEAKTDDVAVELSDVELSDSENKTVSHSEKLDDES---KAKLKSIQLTAT 97

  Q5XKR9 DANFPQF-LHEG----LSKPVYVINWFMSFGPE--IKL--NTSQQ--GRNQAV----------------------------------------------- 115
  Q74ZL7 DLS-SKFALQQNRNIDLQKAGREV----DHGLEKLAKLDAQTSEQESGR---LKTGYINMLFEHVGEDVNQLRNAPDFTPKSLVVLANALKDGGDMFDIE 189

  Q5XKR9 --------- 115
  Q74ZL7 SLRALVDNK 198

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0045839 negative regulation of mitotic nuclear division
2. P GO:0009637 response to blue light
2. P GO:0051301 cell division
2. P GO:0032039 integrator complex
2. P GO:0051028 mRNA transport
2. P GO:0009639 response to red or far red light
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0009646 response to absence of light
2. P GO:0071922 regulation of cohesin loading
2. P GO:0009416 response to light stimulus
2. P GO:0048240 sperm capacitation
2. P GO:0034472 snRNA 3'-end processing
2. P GO:0051455 monopolar spindle attachment to meiosis I kinetochore
2. P GO:1901000 regulation of response to salt stress
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0061608 nuclear import signal receptor activity
2. P GO:0019079 viral genome replication
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0000278 mitotic cell cycle
2. P GO:0060271 cilium assembly
2. P GO:0030991 intraciliary transport particle A
2. P GO:0030317 flagellated sperm motility
2. P GO:0010218 response to far red light
2. P GO:0051457 maintenance of protein location in nucleus
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0006302 double-strand break repair
2. P GO:0030687 preribosome, large subunit precursor
2. P GO:0097228 sperm principal piece
2. P GO:0044877 protein-containing complex binding
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:0035613 RNA stem-loop binding
2. P GO:0034090 maintenance of meiotic sister chromatid cohesion
2. P GO:0005634 nucleus
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0031536 positive regulation of exit from mitosis
2. P GO:0009640 photomorphogenesis
2. P GO:0004860 protein kinase inhibitor activity
2. P GO:0005856 cytoskeleton
2. P GO:0005929 cilium
2. P GO:0036128 CatSper complex
2. P GO:0010029 regulation of seed germination
2. P GO:0000939 inner kinetochore
2. P GO:0032875 regulation of DNA endoreduplication
2. P GO:0000027 ribosomal large subunit assembly
2. P GO:0003723 RNA binding
2. P GO:0010114 response to red light
2. P GO:0007140 male meiotic nuclear division
2. P GO:0051177 meiotic sister chromatid cohesion
2. P GO:0019905 syntaxin binding
2. P GO:1990813 meiotic centromeric cohesion protection
2. P GO:0031048 heterochromatin assembly by small RNA
2. P GO:0005730 nucleolus
2. P GO:0010018 far-red light signaling pathway
2. P GO:0005654 nucleoplasm
2. P GO:0042803 protein homodimerization activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5XKR9 Protein FAM104B 0 1.31e-151 3.11e-82
2. P Q9CYQ5 Host cell factor C1 regulator 1 9.62e-02 4.42e-02 NA
2. P Q9BSF0 Small membrane A-kinase anchor protein 8.71e-02 3.28e-02 NA
2. P P16826 Uncharacterized protein UL101 NA 5.73e-03 NA
2. P P61572 Endogenous retrovirus group K member 19 Rec protein 2.69e-01 3.47e-02 NA
2. P Q9FKB5 Cyclin-dependent kinase inhibitor 3 9.52e-02 2.02e-02 NA
2. P Q96FF9 Sororin 9.29e-02 5.88e-04 NA
2. P P61579 Endogenous retrovirus group K member 25 Rec protein 2.17e-01 3.47e-02 NA
2. P Q8NHU0 Cancer/testis antigen family 45 member A3 3.88e-02 2.82e-02 NA
2. P P0DMU9 Cancer/testis antigen family 45 member A10 1.12e-01 1.04e-02 NA
2. P Q9CQP8 Cation channel sperm-associated protein subunit zeta 4.65e-01 5.05e-06 NA
2. P Q9LVX6 Cyclin-dependent protein kinase inhibitor SMR7 1.84e-01 2.06e-02 NA
2. P P0DMV0 Cancer/testis antigen family 45 member A7 2.54e-02 4.80e-02 NA
2. P P0DMV1 Cancer/testis antigen family 45 member A8 2.72e-02 2.68e-03 NA
2. P Q283L0 Cyclin-dependent kinase inhibitor 5 5.42e-02 7.85e-03 NA
2. P Q07286 Uncharacterized protein BLRF3 (Fragment) NA 4.13e-03 NA
2. P A0JM83 UPF0688 protein C1orf174 homolog 5.22e-02 4.00e-05 NA
2. P Q9CPY3 Sororin 2.19e-01 2.93e-02 NA
2. P Q69383 Endogenous retrovirus group K member 6 Rec protein 2.37e-01 3.47e-02 NA
2. P Q5HYN5 Cancer/testis antigen family 45 member A1 2.91e-02 3.91e-02 NA
2. P Q5DJT8 Cancer/testis antigen family 45 member A2 5.86e-02 2.68e-03 NA
2. P Q6C818 Ribosome assembly protein 3 3.07e-02 1.41e-02 NA
2. P B5X392 Proline-rich nuclear receptor coactivator 2 4.41e-02 4.38e-03 NA
2. P P0DMU7 Cancer/testis antigen family 45 member A6 1.86e-02 4.80e-02 NA
2. P E7F555 Intraflagellar transport protein 43 homolog 2.77e-01 1.30e-02 NA
2. P P61573 Endogenous retrovirus group K member 9 Rec protein 7.18e-02 3.47e-02 NA
2. P Q28HN4 Coiled-coil domain-containing protein 124 7.57e-01 4.21e-02 NA
2. P A8MR65 Protein FAR-RED-ELONGATED HYPOCOTYL 1-LIKE 8.33e-02 1.72e-02 NA
2. P Q3KQW6 UPF0688 protein C1orf174 homolog 2.57e-02 7.47e-03 NA
2. P Q8S4Q6 Protein FAR-RED ELONGATED HYPOCOTYL 1 1.36e-01 1.38e-03 NA
2. P Q6GVM5 Putative gamma-taxilin 2 2.99e-02 2.82e-04 NA
2. P P0DMU8 Cancer/testis antigen family 45 member A5 2.64e-02 4.80e-02 NA
2. P P30890 Non-structural protein 5 NA 2.09e-04 NA
2. P Q05942 Ribosome assembly protein 3 4.09e-02 2.16e-03 NA
2. P B5G1P1 Intraflagellar transport protein 43 homolog 6.01e-02 1.31e-02 NA
2. P Q28CW2 Intraflagellar transport protein 43 homolog 1.10e-01 3.99e-02 NA
2. P Q59VF9 Ribosome assembly protein 3 3.59e-02 1.33e-02 NA
2. P P18571 Non-structural protein 5 NA 7.47e-03 NA
2. P Q6CK62 Ribosome assembly protein 3 9.10e-02 4.06e-04 NA
2. P Q7XDH8 Cyclin-dependent kinase inhibitor 4 4.13e-02 3.84e-02 NA
2. P Q3B8E9 Intraflagellar transport protein 43 homolog 1.35e-01 5.67e-03 NA
2. P Q6BWS4 Ribosome assembly protein 3 1.15e-01 3.04e-08 NA
2. P Q74ZL7 Ribosome assembly protein 3 1.06e-02 3.50e-02 NA
2. P P61575 Endogenous retrovirus group K member 8 Rec protein 3.02e-01 4.10e-02 NA
2. P P0DMV2 Cancer/testis antigen family 45 member A9 3.84e-02 2.68e-03 NA
2. P Q6FX31 Ribosome assembly protein 3 2.54e-02 1.21e-03 NA
2. P Q9UTI4 Monopolar attachment protein 1 5.33e-02 2.79e-03 NA
3. B Q969W3 Protein FAM104A 6.49e-02 NA 4.19e-10