Summary

Q68D20

Homolog: Q1RMX6.
Function: Coiled-coil domain-containing protein 190.

Statistics

Total GO Annotation: 37
Unique PROST Go: 21
Unique BLAST Go: 15

Total Homologs: 11
Unique PROST Homologs: 7
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q1RMX6 (Coiled-coil domain-containing protein 190) with a FATCAT P-Value: 0.0136 and RMSD of 3.86 angstrom. The sequence alignment identity is 21.3%.
Structural alignment shown in left. Query protein Q68D20 colored as red in alignment, homolog Q1RMX6 colored as blue. Query protein Q68D20 is also shown in right top, homolog Q1RMX6 showed in right bottom. They are colored based on secondary structures. 

  Q68D20 ----------------------------------------MHAADL--EKPMVEK------QD-QSPSLRT--G--EEKR--DV-SIS-------R-LR- 35
  Q1RMX6 MERHMVRGPLHKHFDLERKSAKQAEARLSQRLQRLEDICLYHVKSLTREQRQLQKELQRLQQDIIKKKLCSYFGNRSQKRPEDVLTLSSQGGQKHRALQA 100

  Q68D20 -EAFSL-RHTTE--NK-----P--H--SPKTPEPRRSPLGQKRGMS-SSSTSDAISDRGVLRPQ-KEAVSSSQGP-SDPT-----DRAEVEK---DSGHG 111
  Q1RMX6 NKASALTTNTTQGRSKTKSQMPPFHHIGPK--DPMKS---KQQALSQNNRTSHFIEEK--LQAQEKESINPPKGKGSNESISLLCHNQDVSTHTVDGGPG 193

  Q68D20 S-TSVDSE-GFSIPD-TGS-HCSSE----CVASTPGD--RGSQEHVDS-Q--------EKA-----------PETDD--SFSDVDCH--SNQ--EDTGCK 175
  Q1RMX6 SGPAGDSEPGHS--DETRSNDASTRPDHNPAKQTPLDPVEGGGDFKDKPQTSTYLELFEKARKAHYLRHRVPPESERLLSIAEIFGHKESSQSRAEKGCE 291

  Q68D20 FQV-LPQPTNLTSPNTKVF 193
  Q1RMX6 NRVTI-------------- 296

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0051321 meiotic cell cycle
2. P GO:0007420 brain development
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0045591 positive regulation of regulatory T cell differentiation
2. P GO:0001669 acrosomal vesicle
2. P GO:0032993 protein-DNA complex
2. P GO:0031106 septin ring organization
2. P GO:0005935 cellular bud neck
2. P GO:0032488 Cdc42 protein signal transduction
2. P GO:1990837 sequence-specific double-stranded DNA binding
2. P GO:0045165 cell fate commitment
2. P GO:0021510 spinal cord development
2. P GO:0000131 incipient cellular bud site
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0005934 cellular bud tip
2. P GO:0030010 establishment of cell polarity
2. P GO:0031267 small GTPase binding
2. P GO:0005938 cell cortex
2. P GO:0007096 regulation of exit from mitosis
2. P GO:0043332 mating projection tip
2. P GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing
3. B GO:0030890 positive regulation of B cell proliferation
3. B GO:0004519 endonuclease activity
3. B GO:0006298 mismatch repair
3. B GO:0036464 cytoplasmic ribonucleoprotein granule
3. B GO:0048304 positive regulation of isotype switching to IgG isotypes
3. B GO:0007095 mitotic G2 DNA damage checkpoint signaling
3. B GO:0032389 MutLalpha complex
3. B GO:0016446 somatic hypermutation of immunoglobulin genes
3. B GO:0032407 MutSalpha complex binding
3. B GO:0032300 mismatch repair complex
3. B GO:0032138 single base insertion or deletion binding
3. B GO:0042493
3. B GO:0048298 positive regulation of isotype switching to IgA isotypes
3. B GO:0016447 somatic recombination of immunoglobulin gene segments
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q68D20 Protein PMS2CL 0 2.88e-143 4.45e-139
2. P Q1RMX6 Coiled-coil domain-containing protein 190 1.36e-02 1.00e-03 NA
2. P Q04890 Transcription factor SOX-12 3.89e-02 3.90e-02 NA
2. P P38785 GTPase-interacting component 1 1.37e-01 9.20e-03 NA
2. P Q9D9U4 Testis-expressed protein 22 2.95e-01 1.89e-03 NA
2. P O74461 Meiotically up-regulated gene 123 protein 1.67e-02 2.13e-02 NA
2. P O14598 Testis-specific basic protein Y 1 3.71e-02 2.28e-02 NA
2. P Q6DC60 Protein FAM219A 3.18e-01 7.52e-05 NA
3. B P54279 Mismatch repair endonuclease PMS2 8.51e-01 NA 1.53e-28
3. B F1NQJ3 Mismatch repair endonuclease PMS2 2.89e-01 NA 4.18e-05
3. B P54278 Mismatch repair endonuclease PMS2 5.37e-01 NA 8.62e-123