Summary

Q68DL7

Homolog: Q9Y6X4.
Function: Soluble lamin-associated protein of 75 kDa.

Statistics

Total GO Annotation: 99
Unique PROST Go: 99
Unique BLAST Go: 0

Total Homologs: 95
Unique PROST Homologs: 94
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9Y6X4 (Soluble lamin-associated protein of 75 kDa) with a FATCAT P-Value: 0.0322 and RMSD of 4.71 angstrom. The sequence alignment identity is 21.8%.
Structural alignment shown in left. Query protein Q68DL7 colored as red in alignment, homolog Q9Y6X4 colored as blue. Query protein Q68DL7 is also shown in right top, homolog Q9Y6X4 showed in right bottom. They are colored based on secondary structures. 

  Q68DL7 -----------------------MNDSR----QQ----SLFFITLP-DLNKLCAVRII---LSNKV------ADTEIRTIQMKMCRQLLFLHQDIL-TS- 57
  Q9Y6X4 MAFPVDMLENCSHEELENSAEDYMSDLRCGDPENPECFSLLNITIPISLSNVGFVPLYGGDQTQKILALFAPEDS-LTAVALYLADQWWAID-DIVKTSV 98

  Q68DL7 PVS--GILNQIWVVMA-IPFYKARKLNAYVEKYGAKMEAPQRVIPVILQNCLSYSFMARLAPAWNRTGHLLIQGRDFLSQMGKQSAVVLNINVTET-QVC 153
  Q9Y6X4 P-SREG-LKQVSTLGERVVLY---VLNRII--Y-RKQEMERNEIPFL---CHSSTDYAKI--LWKK-GEAI--G--FYS-------------VKPTGSIC 167

  Q68DL7 LSIEACTIRLPAPE---L------KEFEISQSIIKDFHANKHAVIERHSI-LSNWCYVLPSMKMGQIINIFHAIPAACP--FHSY-GDFQRHWDALYG-- 238
  Q9Y6X4 ASFLTQSYQLPVLDTMFLRKKYRGKDFGL--HMLEDF---VDSFTE-DALGLR---YPLSSL-M------Y----TACKQYFEKYPGDHELLWE-VEGVG 246

  Q68DL7 --Y-KLP------GDCGKI-KIYCNIYFK--MLGERTFTY-PLSC----IR-----SQPMQFFPRVDSEVVLK-SFLS-----DLKSKL-PHI-CG---F 305
  Q9Y6X4 HWYQRIPVTRALQREALKILALSQN-EPKRPMSGE----YGPASVPEYEARTEDNQSSEMQL--TIDS---LKDAFASTSEGHD-KTSVSTHTRSGNLKR 335

  Q68DL7 PIKMTSKPCYYTQELTKPNIQEHKVKPPNLTTKKMLRASLT--QATSRKPA-CAQSLL---PCSVAV---DHKVELSVSQPTSGIFSALHLQP--ESVQG 394
  Q9Y6X4 P-KIGKR--FQDSEFSSSQGEDEK------TSQTSLTASINKLESTAR-PSESSEEFLEEEPEQRGIEFEDESSDRD-ARP------ALETQPQQEKQDG 418

  Q68DL7 RKKS-L----------SIRAPQV------HSEV------LMPNRGNTQVQHTNL------SSQ-SNI-----TPKFVPVFKNRLLQMNKNTSVLGSPKRK 459
  Q9Y6X4 EKESELEPMNGEIMDDSLKTSLITEEEDSTSEVLDEELKLQPF--NSSEDSTNLVPLVVESSKPPEVDAPDKTPR-IP--DSEML-MDEGTS-----DEK 507

  Q68DL7 QHDVTQSKLFSLKTSMIQHDKLNLGPAIKNRYSSNI-QMQAANNLNQE----NS-------RPLQEKNTESSENMTKFPSSRGKSTVSLNKNKQLSNSAV 547
  Q9Y6X4 GH--MEEKL-----SLLPRKKAHLG------SSDNVATM--SNEERSDGGFPNSVIAEFSEEPVSE-NL--SPNTTSSLEDQGEEGVS---EPQETSTA- 585

  Q68DL7 FVVSNNNLGVVKSAVDFQMKGKENLTGKGITQILGKSHGSLKLKRQPHIFE-SDGETEDPRLLQQQSENQAKEVGTSDHRL-IVSKIAHRSKRKLCPESS 645
  Q9Y6X4 --LPQSSL------IEVEL---EDVP---FSQNAGQ-------KNQSE--EQSEASSEQ---LDQFTQSAEKAVDSSSEEIEVEVPVVDR--RNL---RR 654

  Q68DL7 KTSKKHHSDTVHYGQSSSSKKQILDSDKSKLKKSLIIHNA 685
  Q9Y6X4 K-AKGHK------G---PAKK------KAKLT-------- 670

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1990414 replication-born double-strand break repair via sister chromatid exchange
2. P GO:0016032 viral process
2. P GO:0034967 Set3 complex
2. P GO:0000976 transcription cis-regulatory region binding
2. P GO:0019076 viral release from host cell
2. P GO:0016236 macroautophagy
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0050821 protein stabilization
2. P GO:0030430 host cell cytoplasm
2. P GO:0060760 positive regulation of response to cytokine stimulus
2. P GO:0070056 prospore membrane leading edge
2. P GO:0034503 protein localization to nucleolar rDNA repeats
2. P GO:0034244 negative regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0060963 positive regulation of ribosomal protein gene transcription by RNA polymerase II
2. P GO:1990483 Clr6 histone deacetylase complex I''
2. P GO:0003713 transcription coactivator activity
2. P GO:0043966 histone H3 acetylation
2. P GO:1990619 histone H3-K9 deacetylation
2. P GO:0034728 nucleosome organization
2. P GO:0039708 nuclear capsid assembly
2. P GO:0034727 piecemeal microautophagy of the nucleus
2. P GO:0071211 protein targeting to vacuole involved in autophagy
2. P GO:0006366 transcription by RNA polymerase II
2. P GO:0032021 NELF complex
2. P GO:0031507 heterochromatin assembly
2. P GO:0019887 protein kinase regulator activity
2. P GO:0035613 RNA stem-loop binding
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:0051764 actin crosslink formation
2. P GO:0000423 mitophagy
2. P GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0071255 Cvt vesicle assembly
2. P GO:0019033 viral tegument
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:1902065 response to L-glutamate
2. P GO:1902166 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0070742 C2H2 zinc finger domain binding
2. P GO:0000045 autophagosome assembly
2. P GO:0000785 chromatin
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0030914
2. P GO:0070210 Rpd3L-Expanded complex
2. P GO:1990316 Atg1/ULK1 kinase complex
2. P GO:0005669 transcription factor TFIID complex
2. P GO:0033276 transcription factor TFTC complex
2. P GO:0039695 DNA-templated viral transcription
2. P GO:0000183 rDNA heterochromatin assembly
2. P GO:1990877 FNIP-folliculin RagC/D GAP
2. P GO:0070555 response to interleukin-1
2. P GO:0005884 actin filament
2. P GO:0000125
2. P GO:0071339 MLL1 complex
2. P GO:0006352 DNA-templated transcription, initiation
2. P GO:0051455 monopolar spindle attachment to meiosis I kinetochore
2. P GO:0030036 actin cytoskeleton organization
2. P GO:0045665 negative regulation of neuron differentiation
2. P GO:0019074 viral RNA genome packaging
2. P GO:0033551 monopolin complex
2. P GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
2. P GO:0070550 rDNA condensation
2. P GO:0051117 ATPase binding
2. P GO:0034497 protein localization to phagophore assembly site
2. P GO:0051598 meiotic recombination checkpoint signaling
2. P GO:0061435 positive regulation of transcription from a mobile element promoter
2. P GO:0070064 proline-rich region binding
2. P GO:0000800 lateral element
2. P GO:0000124 SAGA complex
2. P GO:0004252 serine-type endopeptidase activity
2. P GO:0042025 host cell nucleus
2. P GO:0005198 structural molecule activity
2. P GO:0045747 positive regulation of Notch signaling pathway
2. P GO:0070761 pre-snoRNP complex
2. P GO:0098780 response to mitochondrial depolarisation
2. P GO:0045143 homologous chromosome segregation
2. P GO:0019898 extrinsic component of membrane
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0000407 phagophore assembly site
2. P GO:0003712 transcription coregulator activity
2. P GO:0015031 protein transport
2. P GO:0005637 nuclear inner membrane
2. P GO:0002039 p53 binding
2. P GO:0044805 late nucleophagy
2. P GO:0000492 box C/D snoRNP assembly
2. P GO:2000042 negative regulation of double-strand break repair via homologous recombination
2. P GO:0043666 regulation of phosphoprotein phosphatase activity
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0051571 positive regulation of histone H3-K4 methylation
2. P GO:0032147 activation of protein kinase activity
2. P GO:0008093 cytoskeletal anchor activity
2. P GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
2. P GO:0042802 identical protein binding
2. P GO:0044204 host cell nuclear matrix
2. P GO:0000433 carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
2. P GO:0006914 autophagy
2. P GO:0046982 protein heterodimerization activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q68DL7 Uncharacterized protein C18orf63 0 9.02e-132 0.0
2. P P03203 Epstein-Barr nuclear antigen 4 NA 2.07e-07 NA
2. P Q9H706 GRB2-associated and regulator of MAPK protein 1 2.95e-01 4.77e-02 NA
2. P Q2ULT1 Autophagy-related protein 13 7.68e-01 1.24e-04 NA
2. P F5HCV3 Putative transcription activator ORF50 NA 4.59e-03 NA
2. P I1RW37 Autophagy-related protein 13 1.32e-01 4.10e-03 NA
2. P Q6FIU0 GLC7-interacting protein 4 4.59e-02 2.35e-08 NA
2. P Q6CXP4 Protein LST4 7.20e-01 9.61e-03 NA
2. P O36019 Autophagy protein 13 1.47e-01 6.76e-04 NA
2. P Q9QJ30 Capsid scaffolding protein NA 1.17e-02 NA
2. P P24433 Capsid scaffolding protein NA 3.28e-03 NA
2. P Q5BKE0 Transcription initiation factor TFIID subunit 9 5.59e-01 9.27e-03 NA
2. P Q10369 Uncharacterized protein C22E12.19 4.69e-01 1.69e-02 NA
2. P Q1PDD0 Nucleoprotein NA 1.95e-02 NA
2. P W0TA43 Autophagy-related protein 13 2.01e-01 8.16e-03 NA
2. P A2QWA6 Autophagy-related protein 13 3.85e-01 1.25e-04 NA
2. P Q9BXK5 Bcl-2-like protein 13 1.52e-01 2.43e-02 NA
2. P Q3KST2 Epstein-Barr nuclear antigen 3 NA 1.28e-03 NA
2. P Q6BQ20 Autophagy-related protein 13 4.10e-01 1.14e-05 NA
2. P Q8VI33 Transcription initiation factor TFIID subunit 9 5.11e-01 6.27e-03 NA
2. P Q5A1Z5 Autophagy-related protein 13 3.44e-01 1.78e-02 NA
2. P A5DQA8 Autophagy-related protein 13 3.47e-01 6.76e-04 NA
2. P Q9H3P2 Negative elongation factor A 7.96e-02 9.27e-03 NA
2. P A6ZX59 Autophagy-related protein 13 1.41e-01 2.72e-03 NA
2. P Q18LF5 Protein ORF A NA 9.40e-04 NA
2. P Q1E891 Autophagy-related protein 13 4.07e-01 1.08e-07 NA
2. P Q5VYV7 Protein SLX4IP 2.46e-01 4.92e-09 NA
2. P Q758N2 Autophagy-related protein 13 1.58e-01 2.41e-03 NA
2. P P34379 Autophagy-related protein 13 homolog 4.91e-01 3.04e-02 NA
2. P Q6CLJ6 GLC7-interacting protein 4 4.62e-01 1.73e-02 NA
2. P A7TTE2 Autophagy-related protein 13 4.34e-01 3.96e-03 NA
2. P Q759B7 GLC7-interacting protein 4 7.48e-01 2.07e-06 NA
2. P P12977 Epstein-Barr nuclear antigen 3 NA 4.12e-02 NA
2. P Q9EQ10 PCNA-interacting partner 2.26e-01 3.65e-04 NA
2. P Q17QQ4 Transcription initiation factor TFIID subunit 9 5.53e-01 1.23e-03 NA
2. P Q9Y6X4 Soluble lamin-associated protein of 75 kDa 3.22e-02 4.20e-05 NA
2. P Q9E6P2 Capsid scaffolding protein NA 4.18e-03 NA
2. P Q16594 Transcription initiation factor TFIID subunit 9 4.10e-01 3.40e-04 NA
2. P Q5BBK4 Autophagy-related protein 13 2.53e-01 1.32e-02 NA
2. P A0A0D1E9B9 Spore development regulator umv1 1.60e-01 1.43e-02 NA
2. P Q283Q6 Protein DBF4 homolog B 4.32e-01 3.98e-02 NA
2. P P14291 Protein RED1 2.69e-01 2.11e-03 NA
2. P Q1HVG4 Epstein-Barr nuclear antigen 4 NA 1.36e-06 NA
2. P Q23523 Mediator of RNA polymerase II transcription subunit 4 3.31e-01 1.05e-02 NA
2. P Q01012 Putative transcription activator BRLF1 homolog NA 1.75e-06 NA
2. P Q3KST4 Envelope glycoprotein GP350 NA 2.26e-02 NA
2. P A7F7B2 Autophagy-related protein 13 2.15e-01 6.44e-04 NA
2. P P52519 Large structural phosphoprotein NA 6.02e-07 NA
2. P Q0UPX4 Autophagy-related protein 13 5.45e-01 1.73e-02 NA
2. P P89449 Capsid scaffolding protein NA 4.19e-04 NA
2. P Q08118 Uncharacterized protein IRC10 6.26e-01 4.85e-04 NA
2. P O45962 Regulation of longevity by E3 ubiquitin-protein ligase 2.33e-01 5.46e-03 NA
2. P F4J8V5 Autophagy-related protein 13b 1.77e-01 1.05e-02 NA
2. P Q5ZKL9 PCNA-interacting partner 2.23e-01 1.49e-02 NA
2. P Q90186 Non-structural protein NS2 NA 3.18e-02 NA
2. P Q5A2B9 Transcription factor SPT20 6.29e-01 2.26e-02 NA
2. P P29548 Telomere-binding protein subunit beta 3.55e-01 4.18e-03 NA
2. P Q9H869 YY1-associated protein 1 1.78e-01 5.01e-05 NA
2. P Q86XJ1 GAS2-like protein 3 3.15e-01 1.68e-05 NA
2. P P68343 Envelope glycoprotein GP350 NA 5.82e-03 NA
2. P Q4WHN5 Autophagy-related protein 13 5.18e-01 4.94e-03 NA
2. P Q66652 Putative transcription activator BRLF1 homolog NA 6.54e-09 NA
2. P A7KAM4 Autophagy-related protein 13 6.57e-01 1.11e-05 NA
2. P P16046 Capsid scaffolding protein NA 4.81e-02 NA
2. P P0C7V6 Putative transcription factor SPT20 homolog-like 2 2.77e-01 3.59e-02 NA
2. P Q3UWW6 GAS2-like protein 3 4.61e-02 1.50e-05 NA
2. P Q3KST1 Epstein-Barr nuclear antigen 4 NA 1.38e-07 NA
2. P Q3ZLR7 Transcription factor SPT20 homolog-like 1 9.67e-02 2.58e-02 NA
2. P P39732 GLC7-interacting protein 4 2.31e-01 1.01e-04 NA
2. P P30005 120 kDa Glycoprotein O NA 2.97e-02 NA
2. P Q8R2U2 Nucleolus and neural progenitor protein 5.08e-01 9.58e-04 NA
2. P Q6IRT3 PCNA-interacting partner 2.43e-01 7.45e-03 NA
2. P Q00041 Tegument protein UL46 homolog NA 2.97e-02 NA
2. P Q9P7I7 Uncharacterized protein C24B10.19c 8.89e-01 2.11e-03 NA
2. P Q69535 Large structural phosphoprotein NA 2.74e-05 NA
2. P Q04087 Monopolin complex subunit LRS4 4.57e-01 9.02e-03 NA
2. P Q00701 Large structural phosphoprotein NA 1.79e-06 NA
2. P A7KAJ8 Autophagy-related protein 13 1.09e-01 1.96e-02 NA
2. P Q08DY8 Autophagy-related protein 13 4.94e-01 3.50e-02 NA
2. P Q6CWK2 Autophagy-related protein 13 1.06e-01 4.89e-03 NA
2. P Q06628 Autophagy-related protein 13 8.71e-02 2.46e-03 NA
2. P Q6UDK6 Capsid scaffolding protein NA 1.46e-02 NA
2. P Q3KSP9 Capsid scaffolding protein NA 2.46e-03 NA
2. P Q69138 Epstein-Barr nuclear antigen 3 NA 9.31e-04 NA
2. P Q4V3C1 Mediator of RNA polymerase II transcription subunit 8 3.74e-01 2.51e-02 NA
2. P P07261 Glycolytic genes transcriptional activator GCR1 3.79e-01 4.46e-02 NA
2. P Q6FSJ9 Autophagy-related protein 13 8.94e-02 1.59e-02 NA
2. P P03234 Capsid scaffolding protein NA 3.22e-03 NA
2. P Q5HYC2 Uncharacterized protein KIAA2026 6.27e-01 8.39e-05 NA
2. P Q02479 Putative transcription activator BRLF1 homolog NA 2.67e-03 NA
2. P P68344 Envelope glycoprotein GP340 NA 5.82e-03 NA
2. P Q1HVC7 Capsid scaffolding protein NA 4.34e-03 NA
2. P A4IGL8 Protein SLX4IP 2.01e-01 7.12e-03 NA
2. P Q5XG69 Soluble lamin-associated protein of 75 kDa 1.21e-01 5.00e-04 NA
2. P Q6NW34 Nucleolus and neural progenitor protein 6.29e-01 4.31e-04 NA