Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P61572
(Endogenous retrovirus group K member 19 Rec protein) with a FATCAT P-Value: 2.42e-14 and RMSD of 2.51 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein Q69383 colored as red in alignment, homolog P61572 colored as blue.
Query protein Q69383 is also shown in right top, homolog P61572 showed in right bottom. They are colored based on secondary structures.
Q69383 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 100 P61572 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 100 Q69383 IENGP 105 P61572 IENGP 105
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0003723 | RNA binding |
| 1. PB | GO:0006406 | mRNA export from nucleus |
| 1. PB | GO:0051260 | protein homooligomerization |
| 1. PB | GO:0051028 | mRNA transport |
| 1. PB | GO:0035613 | RNA stem-loop binding |
| 1. PB | GO:0005730 | nucleolus |
| 2. P | GO:0009306 | protein secretion |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0061564 | axon development |
| 2. P | GO:0045926 | negative regulation of growth |
| 2. P | GO:0051087 | chaperone binding |
| 2. P | GO:0045177 | apical part of cell |
| 2. P | GO:0031397 | negative regulation of protein ubiquitination |
| 2. P | GO:1905048 | regulation of metallopeptidase activity |
| 3. B | GO:0005198 | structural molecule activity |
| 3. B | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0097355 | protein localization to heterochromatin |
| 3. B | GO:0031424 | keratinization |
| 3. B | GO:0002218 | activation of innate immune response |
| 3. B | GO:0035458 | cellular response to interferon-beta |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P61571 | Endogenous retrovirus group K member 21 Rec protein | 3.15e-10 | 5.56e-54 | 5.92e-68 |
| 1. PB | P61572 | Endogenous retrovirus group K member 19 Rec protein | 2.42e-14 | 3.07e-142 | 2.44e-71 |
| 1. PB | Q69383 | Endogenous retrovirus group K member 6 Rec protein | 0 | 3.07e-142 | 2.44e-71 |
| 1. PB | P61578 | Endogenous retrovirus group K member 16 Rec protein | 1.80e-08 | 8.59e-52 | 4.09e-47 |
| 1. PB | P61573 | Endogenous retrovirus group K member 9 Rec protein | 3.58e-10 | 3.07e-142 | 2.44e-71 |
| 1. PB | P61575 | Endogenous retrovirus group K member 8 Rec protein | 7.72e-13 | 1.06e-77 | 5.76e-70 |
| 1. PB | P61579 | Endogenous retrovirus group K member 25 Rec protein | 1.16e-12 | 3.07e-142 | 2.44e-71 |
| 1. PB | P61574 | Endogenous retrovirus group K member 113 Rec protein | 9.88e-07 | 4.95e-28 | 1.70e-70 |
| 1. PB | P61576 | Endogenous retrovirus group K member 104 Rec protein | 1.20e-06 | 8.25e-51 | 2.35e-65 |
| 2. P | P9WJ12 | Toxin MT2730 | 4.62e-03 | 2.05e-03 | NA |
| 2. P | Q69548 | Uncharacterized protein U13 | NA | 1.73e-02 | NA |
| 2. P | Q4R7E8 | TSSK6-activating co-chaperone protein | 1.86e-02 | 7.37e-04 | NA |
| 2. P | P9WJ13 | Toxin Rv2653c | 7.39e-03 | 2.05e-03 | NA |
| 2. P | P0C8M3 | Small vasohibin-binding protein | 1.06e-02 | 1.26e-02 | NA |
| 2. P | Q96A04 | TSSK6-activating co-chaperone protein | 1.52e-02 | 1.17e-02 | NA |
| 3. B | O71037 | Endogenous retrovirus group K member 19 Env polyprotein | 2.12e-01 | NA | 1.96e-52 |
| 3. B | Q902F8 | Endogenous retrovirus group K member 8 Env polyprotein | 2.08e-01 | NA | 2.10e-52 |
| 3. B | P61570 | Endogenous retrovirus group K member 25 Env polyprotein | 1.91e-01 | NA | 1.29e-52 |
| 3. B | Q69384 | Endogenous retrovirus group K member 6 Env polyprotein | 2.05e-01 | NA | 2.19e-52 |
| 3. B | P61565 | Endogenous retrovirus group K member 21 Env polyprotein | 5.43e-02 | NA | 2.78e-49 |
| 3. B | Q902F9 | Endogenous retrovirus group K member 113 Env polyprotein | 2.90e-01 | NA | 1.36e-52 |
| 3. B | Q8NEY8 | Periphilin-1 | 2.53e-02 | NA | 0.044 |
| 3. B | Q9UKH3 | Endogenous retrovirus group K member 9 Env polyprotein | 8.75e-02 | NA | 1.86e-52 |
| 3. B | Q3V3Q4 | Pyrin domain-containing protein 3 | 7.02e-02 | NA | 2.88e-05 |