Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q6XJU9
(Osteoclast-stimulating factor 1) with a FATCAT P-Value: 1.44e-09 and RMSD of 1.20 angstrom. The sequence alignment identity is 9.3%.
Structural alignment shown in left. Query protein Q69YU3 colored as red in alignment, homolog Q6XJU9 colored as blue.
Query protein Q69YU3 is also shown in right top, homolog Q6XJU9 showed in right bottom. They are colored based on secondary structures.
Q69YU3 --------------------------------------------------------------------MLHTEGHALLRAVGQGKLRLARLLLEG--GAY 30 Q6XJU9 MSKPPPKPAKPGQVKVFRALFTFDPRTPDELYFEEGDILYISDTSDTNWWKGTCRGRTGLIPSNYVAEQAETIDHPMHEAAKRGNLSWLRECVENKVG-- 98 Q69YU3 VNEG-DAQGETALMAACRARYDDPQNKARMVRYLLEQ-GADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVR-D-HAGASALVHALDRGDRET 126 Q6XJU9 IN-GLDKAGNTALYWACHGGHKD------VVELLLNQPSVELNQQNKLGDTVL-HAAAWKGYSDIVEMLL----DKNARTDIRNNENKL--ALEMATNAQ 184 Q69YU3 LATLLDACKAK-GTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDP 225 Q6XJU9 CASLL---KRKQGTNV----TRT----LSNAEEYLDDDDS----D------------------------------------------------------- 214 Q69YU3 SPSEPLPKPPRHPPKPLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPPWAEKVTSGGPLSRRNTAPEAQESGP 325 Q6XJU9 ---------------------------------------------------------------------------------------------------- 214 Q69YU3 PSGLRQKLSRMEPVELDTPGHLCPDSPESSRLSLERRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQTRPGFL 425 Q6XJU9 ---------------------------------------------------------------------------------------------------- 214 Q69YU3 PPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIRLLGGFQSLGGPGEPGR 496 Q6XJU9 ----------------------------------------------------------------------- 214
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0043063 | intercellular bridge organization |
| 1. PB | GO:0030155 | regulation of cell adhesion |
| 1. PB | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 1. PB | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 1. PB | GO:0097543 | ciliary inversin compartment |
| 1. PB | GO:0017124 | SH3 domain binding |
| 1. PB | GO:0030507 | spectrin binding |
| 1. PB | GO:0015629 | actin cytoskeleton |
| 1. PB | GO:0004857 | enzyme inhibitor activity |
| 1. PB | GO:0051306 | mitotic sister chromatid separation |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:0043197 | dendritic spine |
| 1. PB | GO:0001822 | kidney development |
| 1. PB | GO:0072357 | PTW/PP1 phosphatase complex |
| 1. PB | GO:0019208 | phosphatase regulator activity |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 1. PB | GO:0007507 | heart development |
| 1. PB | GO:0006929 | substrate-dependent cell migration |
| 1. PB | GO:0001701 | in utero embryonic development |
| 1. PB | GO:0045171 | intercellular bridge |
| 1. PB | GO:0032466 | negative regulation of cytokinesis |
| 1. PB | GO:0032421 | stereocilium bundle |
| 1. PB | GO:0007368 | determination of left/right symmetry |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0007140 | male meiotic nuclear division |
| 1. PB | GO:0030018 | Z disc |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0016322 | neuron remodeling |
| 2. P | GO:0031932 | TORC2 complex |
| 2. P | GO:0005902 | microvillus |
| 2. P | GO:0051010 | microtubule plus-end binding |
| 2. P | GO:0051015 | actin filament binding |
| 2. P | GO:0032426 | stereocilium tip |
| 2. P | GO:0030034 | microvillar actin bundle assembly |
| 2. P | GO:0051491 | positive regulation of filopodium assembly |
| 2. P | GO:0060122 | inner ear receptor cell stereocilium organization |
| 2. P | GO:1904106 | protein localization to microvillus |
| 2. P | GO:0060113 | inner ear receptor cell differentiation |
| 2. P | GO:0050957 | equilibrioception |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0048013 | ephrin receptor signaling pathway |
| 2. P | GO:0048793 | pronephros development |
| 2. P | GO:0051639 | actin filament network formation |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:0007626 | locomotory behavior |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0032391 | photoreceptor connecting cilium |
| 2. P | GO:0034976 | response to endoplasmic reticulum stress |
| 2. P | GO:0030046 | parallel actin filament bundle assembly |
| 2. P | GO:0031929 | TOR signaling |
| 2. P | GO:0007605 | sensory perception of sound |
| 2. P | GO:0051017 | actin filament bundle assembly |
| 2. P | GO:0042472 | inner ear morphogenesis |
| 2. P | GO:1904970 | brush border assembly |
| 2. P | GO:0005903 | brush border |
| 2. P | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 2. P | GO:0035371 | microtubule plus-end |
| 2. P | GO:0030950 | establishment or maintenance of actin cytoskeleton polarity |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0046875 | ephrin receptor binding |
| 2. P | GO:0045494 | photoreceptor cell maintenance |
| 2. P | GO:0050953 | sensory perception of light stimulus |
| 2. P | GO:0051494 | negative regulation of cytoskeleton organization |
| 2. P | GO:0032420 | stereocilium |
| 2. P | GO:0001917 | photoreceptor inner segment |
| 2. P | GO:0034622 | |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0031941 | filamentous actin |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0060292 | long-term synaptic depression |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0042088 | T-helper 1 type immune response |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 3. B | GO:0034968 | histone lysine methylation |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0035690 | |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0072659 | protein localization to plasma membrane |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0031286 | negative regulation of sorocarp stalk cell differentiation |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0010564 | regulation of cell cycle process |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0005764 | lysosome |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0030502 | negative regulation of bone mineralization |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0048699 | generation of neurons |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:1903077 | negative regulation of protein localization to plasma membrane |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0034605 | cellular response to heat |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:1902902 | negative regulation of autophagosome assembly |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0031398 | positive regulation of protein ubiquitination |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0015271 | outward rectifier potassium channel activity |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0050678 | regulation of epithelial cell proliferation |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0008306 | associative learning |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0051101 | regulation of DNA binding |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:2001257 | regulation of cation channel activity |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0007098 | centrosome cycle |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0010225 | response to UV-C |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0035994 | response to muscle stretch |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0043001 | Golgi to plasma membrane protein transport |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0030330 | DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:1990830 | cellular response to leukemia inhibitory factor |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0030216 | keratinocyte differentiation |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0086004 | regulation of cardiac muscle cell contraction |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0031674 | I band |
| 3. B | GO:0045668 | negative regulation of osteoblast differentiation |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0048856 | anatomical structure development |
| 3. B | GO:0050750 | low-density lipoprotein particle receptor binding |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0031100 | animal organ regeneration |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060582 | cell fate determination involved in pattern specification |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:1902253 | regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0035518 | histone H2A monoubiquitination |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0021654 | rhombomere boundary formation |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0003170 | heart valve development |
| 3. B | GO:0019730 | antimicrobial humoral response |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0035640 | exploration behavior |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0032717 | negative regulation of interleukin-8 production |
| 3. B | GO:0001779 | natural killer cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0043052 | thermotaxis |
| 3. B | GO:0039022 | pronephric duct development |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0002467 | germinal center formation |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1905456 | regulation of lymphoid progenitor cell differentiation |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0048536 | spleen development |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0090212 | negative regulation of establishment of blood-brain barrier |
| 3. B | GO:0030219 | megakaryocyte differentiation |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0032996 | Bcl3-Bcl10 complex |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0051569 | regulation of histone H3-K4 methylation |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0070316 | regulation of G0 to G1 transition |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0042663 | regulation of endodermal cell fate specification |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0045874 | positive regulation of sevenless signaling pathway |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0070650 | actin filament bundle distribution |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0003408 | optic cup formation involved in camera-type eye development |
| 3. B | GO:1901981 | phosphatidylinositol phosphate binding |
| 3. B | GO:1905453 | regulation of myeloid progenitor cell differentiation |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0046957 | negative phototaxis |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0002315 | marginal zone B cell differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0048148 | behavioral response to cocaine |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0002268 | follicular dendritic cell differentiation |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0000776 | kinetochore |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0014065 | phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0034703 | cation channel complex |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:1903670 | regulation of sprouting angiogenesis |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0032091 | negative regulation of protein binding |
| 3. B | GO:0035308 | negative regulation of protein dephosphorylation |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0060707 | trophoblast giant cell differentiation |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0009610 | response to symbiotic fungus |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:0035265 | organ growth |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:2000310 | regulation of NMDA receptor activity |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0045064 | T-helper 2 cell differentiation |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0043422 | protein kinase B binding |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0060361 | flight |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0031532 | actin cytoskeleton reorganization |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0060708 | spongiotrophoblast differentiation |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:0048916 | posterior lateral line development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 4.92e-02 | 8.80e-05 | 1.55e-08 |
| 1. PB | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 1.82e-02 | 1.75e-10 | 0.022 |
| 1. PB | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 1.86e-02 | 1.18e-02 | 0.016 |
| 1. PB | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.43e-02 | 2.87e-03 | 7.64e-07 |
| 1. PB | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 0 | 1.89e-121 | 0.0 |
| 1. PB | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 2.84e-05 | 3.51e-32 | 2.60e-49 |
| 1. PB | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 2.94e-01 | 1.51e-03 | 1.71e-06 |
| 1. PB | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 4.56e-04 | 7.40e-31 | 5.04e-99 |
| 1. PB | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 1.02e-02 | 4.50e-10 | 0.011 |
| 1. PB | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 5.44e-06 | 1.52e-35 | 1.91e-105 |
| 1. PB | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 2.87e-02 | 1.02e-05 | 9.89e-06 |
| 1. PB | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 1.52e-05 | 4.51e-40 | 2.60e-104 |
| 1. PB | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.35e-02 | 3.46e-03 | 2.66e-05 |
| 1. PB | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 7.80e-03 | 1.14e-02 | 7.83e-09 |
| 1. PB | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 2.77e-03 | 1.03e-03 | 0.001 |
| 1. PB | O60237 | Protein phosphatase 1 regulatory subunit 12B | 1.44e-01 | 1.63e-08 | 2.46e-06 |
| 1. PB | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 1.49e-02 | 2.50e-04 | 6.22e-06 |
| 1. PB | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 5.47e-04 | 1.20e-35 | 6.43e-79 |
| 1. PB | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 1.68e-05 | 9.13e-99 | 0.0 |
| 1. PB | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 8.56e-02 | 1.08e-07 | 7.02e-06 |
| 1. PB | Q6ZVH7 | Espin-like protein | 3.82e-02 | 5.57e-04 | 0.003 |
| 1. PB | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | 3.39e-03 | 0.002 |
| 2. P | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 2.58e-03 | 8.55e-04 | NA |
| 2. P | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 4.93e-02 | 2.11e-06 | NA |
| 2. P | Q9LUZ4 | Zinc finger CCCH domain-containing protein 66 | 7.40e-02 | 4.62e-02 | NA |
| 2. P | Q7XI08 | Probable E3 ubiquitin-protein ligase XBOS34 | 1.30e-03 | 3.82e-02 | NA |
| 2. P | Q80YS5 | Leucine-rich repeat-containing protein 27 | 8.91e-01 | 2.79e-02 | NA |
| 2. P | Q9ET47 | Espin | 3.82e-02 | 9.68e-03 | NA |
| 2. P | Q8VHK1 | Caskin-2 | 4.30e-02 | 3.72e-04 | NA |
| 2. P | Q4FE47 | Putative E3 ubiquitin-protein ligase XBAT35 | 1.91e-03 | 2.38e-02 | NA |
| 2. P | Q63618 | Espin | 4.91e-02 | 1.02e-02 | NA |
| 2. P | Q04749 | Target of rapamycin complex 2 subunit AVO2 | 5.62e-03 | 5.20e-05 | NA |
| 2. P | Q3UYR4 | Espin-like protein | 1.03e-01 | 3.65e-04 | NA |
| 2. P | Q8CI96 | CAP-Gly domain-containing linker protein 4 | 1.90e-01 | 3.53e-02 | NA |
| 2. P | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 1.60e-03 | 1.32e-03 | NA |
| 2. P | Q8N3C7 | CAP-Gly domain-containing linker protein 4 | 6.28e-03 | 1.60e-02 | NA |
| 2. P | Q5XK72 | Protein FAM83G | 3.75e-01 | 4.66e-02 | NA |
| 2. P | Q80T11 | Usher syndrome type-1G protein homolog | 8.24e-03 | 1.38e-04 | NA |
| 2. P | Q495M9 | Usher syndrome type-1G protein | 5.00e-02 | 3.57e-04 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 5.14e-06 | NA | 0.004 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 9.43e-06 | NA | 8.74e-05 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 7.85e-02 | NA | 7.26e-07 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 8.83e-01 | NA | 3.05e-07 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 2.25e-06 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 2.07e-03 | NA | 1.83e-09 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 1.53e-04 | NA | 0.004 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 6.76e-01 | NA | 7.35e-05 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 5.16e-04 | NA | 0.021 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 1.60e-02 | NA | 0.012 |
| 3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 1.77e-06 | NA | 0.001 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 7.95e-02 | NA | 6.50e-05 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 4.52e-01 | NA | 1.42e-10 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.72e-04 | NA | 1.20e-09 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 1.20e-03 | NA | 0.023 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 6.99e-01 | NA | 1.11e-05 |
| 3. B | O89019 | Inversin | 1.67e-01 | NA | 8.52e-08 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.63e-05 | NA | 2.00e-07 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 6.74e-06 | NA | 1.33e-05 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 2.45e-03 | NA | 0.017 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 2.24e-05 | NA | 0.002 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 2.06e-04 | NA | 7.84e-09 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 5.80e-07 | NA | 0.001 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 1.09e-03 | NA | 1.52e-07 |
| 3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 4.76e-03 | NA | 0.003 |
| 3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 1.82e-06 | NA | 3.08e-04 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 5.39e-08 |
| 3. B | D3J162 | Protein VAPYRIN | 1.62e-03 | NA | 4.05e-08 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 8.18e-07 | NA | 0.005 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 5.43e-03 | NA | 0.001 |
| 3. B | Q06527 | Ankyrin homolog | 2.47e-04 | NA | 7.62e-13 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.89e-05 | NA | 6.02e-10 |
| 3. B | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.25e-05 | NA | 1.41e-06 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 3.59e-01 | NA | 0.011 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 2.81e-02 | NA | 6.38e-04 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 5.91e-06 | NA | 6.29e-05 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 1.06e-05 | NA | 0.006 |
| 3. B | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.64e-05 | NA | 1.27e-07 |
| 3. B | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 3.85e-02 | NA | 0.005 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 2.81e-01 | NA | 3.22e-06 |
| 3. B | O14593 | DNA-binding protein RFXANK | 3.69e-08 | NA | 2.10e-04 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 4.71e-06 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 8.33e-01 | NA | 1.98e-08 |
| 3. B | Q9UPQ3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 4.03e-01 | NA | 0.014 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 4.57e-04 | NA | 1.21e-04 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 0.001 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.52e-05 | NA | 1.52e-08 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 5.71e-01 | NA | 3.72e-05 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 7.17e-01 | NA | 7.16e-06 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 9.43e-07 | NA | 4.83e-04 |
| 3. B | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 3.77e-02 | NA | 0.006 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 1.49e-05 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 0.001 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 2.99e-04 | NA | 2.25e-06 |
| 3. B | Q5ZJJ9 | Osteoclast-stimulating factor 1 | 4.89e-06 | NA | 0.002 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 2.28e-03 | NA | 4.01e-05 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.63e-05 | NA | 9.43e-10 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 2.62e-04 | NA | 2.02e-05 |
| 3. B | Q02357 | Ankyrin-1 | 8.81e-01 | NA | 0.019 |
| 3. B | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 9.45e-06 | NA | 1.21e-04 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 3.63e-02 | NA | 4.69e-04 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 4.16e-03 | NA | 9.99e-06 |
| 3. B | O74205 | Transcription factor TOXE | 9.35e-06 | NA | 0.032 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.27e-05 | NA | 3.05e-10 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.39e-06 | NA | 2.55e-09 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 1.29e-05 | NA | 0.002 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.29e-03 | NA | 0.003 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 2.80e-06 | NA | 2.17e-04 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 2.55e-02 | NA | 0.003 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.74e-05 | NA | 1.53e-08 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 5.17e-04 | NA | 2.42e-05 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.48e-03 | NA | 0.002 |
| 3. B | Q5U312 | Ankycorbin | 2.25e-02 | NA | 1.69e-07 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 3.06e-01 | NA | 4.74e-05 |
| 3. B | Q62422 | Osteoclast-stimulating factor 1 | 4.85e-06 | NA | 2.86e-04 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 0.002 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 8.98e-07 | NA | 4.65e-04 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 2.49e-05 | NA | 3.84e-07 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 9.05e-04 | NA | 0.011 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 2.74e-04 | NA | 7.98e-09 |
| 3. B | Q8IV38 | Ankyrin repeat and MYND domain-containing protein 2 | 8.63e-05 | NA | 0.010 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 3.91e-03 | NA | 6.50e-07 |
| 3. B | Q5UQ58 | Putative ankyrin repeat protein R664 | NA | NA | 0.045 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 5.63e-04 | NA | 3.87e-06 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 4.55e-03 | NA | 0.001 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 1.63e-01 | NA | 0.001 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 7.51e-02 | NA | 0.005 |
| 3. B | G5E8K5 | Ankyrin-3 | 8.20e-01 | NA | 5.34e-05 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.86e-03 | NA | 7.48e-04 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 5.93e-06 | NA | 0.017 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 2.82e-09 | NA | 0.010 |
| 3. B | V6CLA2 | E3 ubiquitin-protein ligase hecd-1 | 9.30e-01 | NA | 0.001 |
| 3. B | Q7T0Q1 | Myotrophin | 1.02e-08 | NA | 2.89e-04 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 2.63e-01 | NA | 4.88e-08 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 4.17e-01 | NA | 2.60e-05 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 2.38e-03 | NA | 3.17e-06 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 9.40e-01 | NA | 0.001 |
| 3. B | O70511 | Ankyrin-3 | 7.96e-01 | NA | 1.32e-05 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 6.74e-06 | NA | 3.27e-04 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 7.92e-02 | NA | 0.001 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 8.40e-03 | NA | 5.39e-04 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 3.55e-06 | NA | 4.99e-04 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 9.48e-02 | NA | 5.05e-08 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 2.67e-03 | NA | 1.34e-04 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 1.07e-06 | NA | 7.93e-05 |
| 3. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 8.31e-01 | NA | 0.039 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 9.17e-01 | NA | 5.02e-08 |
| 3. B | Q8NAG6 | Ankyrin repeat and LEM domain-containing protein 1 | 2.37e-02 | NA | 0.050 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 0.031 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.97e-05 | NA | 2.41e-11 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 4.86e-03 | NA | 0.003 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 2.83e-03 | NA | 0.008 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 5.73e-02 | NA | 5.29e-05 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 3.76e-01 | NA | 4.38e-07 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 3.95e-02 | NA | 1.41e-05 |
| 3. B | Q4UJY2 | Putative ankyrin repeat protein RF_1306 | 1.96e-04 | NA | 0.002 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 8.15e-01 | NA | 8.14e-07 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 1.65e-03 | NA | 0.021 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 1.40e-02 | NA | 0.015 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 3.25e-05 | NA | 0.012 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 3.81e-01 | NA | 0.001 |
| 3. B | A2A690 | Protein TANC2 | 7.34e-02 | NA | 4.28e-12 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 6.60e-01 | NA | 4.16e-07 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 4.87e-02 | NA | 5.96e-05 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 2.31e-03 | NA | 0.036 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 1.79e-04 | NA | 6.27e-06 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 5.86e-01 | NA | 3.36e-06 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 8.40e-01 | NA | 5.26e-06 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 4.42e-04 | NA | 3.39e-04 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 5.47e-06 | NA | 1.34e-04 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 3.07e-03 | NA | 0.006 |
| 3. B | Q8H569 | Potassium channel AKT3 | 9.59e-02 | NA | 3.32e-04 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 9.26e-01 | NA | 2.35e-04 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 1.23e-04 | NA | 6.47e-05 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 3.38e-04 | NA | 0.002 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 9.70e-04 | NA | 3.11e-08 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 7.60e-01 | NA | 1.11e-06 |
| 3. B | Q74ZH9 | Glycerophosphocholine phosphodiesterase GDE1 | 2.88e-01 | NA | 0.004 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 3.68e-05 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 9.66e-07 | NA | 0.003 |
| 3. B | P17221 | Sex-determining protein fem-1 | 4.93e-04 | NA | 7.79e-06 |
| 3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 2.39e-04 | NA | 0.012 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 4.43e-01 | NA | 1.20e-10 |
| 3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 1.17e-04 | NA | 0.010 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 5.88e-06 | NA | 3.36e-04 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 7.18e-01 | NA | 2.35e-06 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 1.14e-03 | NA | 1.62e-07 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 1.42e-04 | NA | 1.75e-04 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 2.89e-04 | NA | 1.62e-08 |
| 3. B | Q69ZR2 | E3 ubiquitin-protein ligase HECTD1 | 9.41e-01 | NA | 8.40e-06 |
| 3. B | Q8BXK8 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 4.81e-01 | NA | 0.025 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 8.30e-02 | NA | 1.43e-05 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.41e-05 | NA | 5.86e-10 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 3.83e-08 | NA | 0.001 |
| 3. B | P55271 | Cyclin-dependent kinase 4 inhibitor B | 1.63e-08 | NA | 8.70e-05 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 7.10e-01 | NA | 2.20e-04 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 2.46e-01 | NA | 2.06e-05 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 1.94e-01 | NA | 0.002 |
| 3. B | Q5URB8 | Putative ankyrin repeat protein R841 | NA | NA | 1.48e-04 |
| 3. B | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 3.16e-05 | NA | 4.31e-05 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 1.25e-09 |
| 3. B | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 1.08e-03 | NA | 0.003 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 1.48e-04 | NA | 0.009 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 7.14e-06 | NA | 1.81e-04 |
| 3. B | Q8UVC1 | Inversin | 8.94e-02 | NA | 7.28e-08 |
| 3. B | Q8GSP8 | Zygote-specific protein 3 | 4.75e-03 | NA | 3.26e-07 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 7.71e-03 | NA | 0.001 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 3.34e-01 | NA | 3.86e-04 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 2.26e-01 | NA | 3.60e-04 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 1.60e-08 | NA | 6.04e-06 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.24e-05 | NA | 1.39e-08 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 2.90e-01 | NA | 0.007 |
| 3. B | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 2.72e-05 | NA | 5.88e-04 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 2.50e-01 | NA | 0.016 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.54e-05 | NA | 3.18e-09 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 6.93e-01 | NA | 3.75e-10 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 2.11e-01 | NA | 5.86e-05 |
| 3. B | Q8MJ50 | Osteoclast-stimulating factor 1 | 5.03e-06 | NA | 0.001 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 6.07e-03 | NA | 0.039 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.67e-02 | NA | 3.36e-04 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 6.77e-02 | NA | 6.57e-04 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 6.73e-04 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 8.31e-01 | NA | 6.28e-04 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 5.04e-02 | NA | 7.24e-06 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 8.96e-05 | NA | 0.006 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 2.07e-07 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 9.47e-01 | NA | 3.03e-04 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 1.17e-06 | NA | 7.95e-04 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 9.50e-09 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 7.87e-03 | NA | 9.17e-07 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 7.58e-02 | NA | 5.79e-05 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 7.53e-04 | NA | 0.005 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 5.83e-09 |
| 3. B | Q54F46 | Homeobox protein Wariai | 1.64e-02 | NA | 5.08e-06 |
| 3. B | F1LTE0 | Protein TANC2 | 5.25e-01 | NA | 4.55e-12 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 1.65e-01 | NA | 5.49e-07 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 6.23e-06 | NA | 1.98e-04 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 6.66e-01 | NA | 0.001 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 4.01e-02 | NA | 3.98e-05 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.00e-02 | NA | 1.50e-04 |
| 3. B | Q8UVC3 | Inversin | 8.52e-02 | NA | 6.59e-05 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 2.85e-03 | NA | 1.00e-06 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 2.01e-04 | NA | 0.001 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 8.07e-03 | NA | 0.027 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 5.10e-02 | NA | 1.29e-05 |
| 3. B | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.00e-05 | NA | 1.08e-07 |
| 3. B | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.76e-03 | NA | 1.38e-07 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 4.97e-04 | NA | 2.86e-09 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 1.20e-04 | NA | 1.54e-04 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 1.08e-01 | NA | 8.16e-04 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.71e-04 | NA | 6.31e-09 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 1.02e-02 | NA | 2.33e-05 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 4.71e-07 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 1.16e-06 | NA | 4.99e-04 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 5.81e-03 | NA | 7.79e-05 |
| 3. B | B7WN72 | Protein shank | 2.75e-02 | NA | 0.012 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 9.62e-02 | NA | 6.00e-06 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 5.00e-08 | NA | 0.003 |
| 3. B | Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 | 9.92e-01 | NA | 4.30e-06 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.98e-01 | NA | 0.003 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.93e-03 | NA | 0.019 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 2.27e-06 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 2.40e-04 | NA | 6.09e-09 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 5.85e-03 | NA | 2.21e-04 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 1.06e-01 | NA | 0.002 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.61e-05 | NA | 1.34e-09 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 1.85e-03 | NA | 0.005 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 8.05e-04 | NA | 2.84e-04 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 5.80e-07 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 4.87e-02 | NA | 6.01e-05 |
| 3. B | Q9U518 | L-asparaginase | 7.10e-03 | NA | 0.015 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.76e-03 | NA | 0.042 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 0.005 |
| 3. B | Q9Y283 | Inversin | 1.34e-01 | NA | 7.42e-08 |
| 3. B | Q4UKI1 | Putative ankyrin repeat protein RF_1099 | 5.07e-04 | NA | 1.34e-04 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.50e-05 | NA | 7.92e-11 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 2.09e-05 | NA | 0.007 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 1.63e-02 | NA | 0.005 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 7.63e-01 | NA | 1.68e-08 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 4.02e-04 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 5.87e-06 | NA | 2.04e-04 |
| 3. B | Q9C0D5 | Protein TANC1 | 2.24e-01 | NA | 1.76e-10 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 0.030 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 5.11e-01 | NA | 0.003 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 3.90e-01 | NA | 2.14e-07 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 4.88e-04 | NA | 0.005 |
| 3. B | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.07e-05 | NA | 1.09e-08 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 1.71e-14 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 4.36e-05 | NA | 1.29e-05 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 2.57e-03 | NA | 8.62e-05 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 1.01e-05 | NA | 4.17e-05 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 8.83e-03 | NA | 0.007 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 6.64e-01 | NA | 3.66e-06 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 1.64e-03 | NA | 4.05e-04 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.92e-05 | NA | 1.03e-10 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 5.38e-01 | NA | 4.69e-07 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 1.95e-06 | NA | 0.002 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 1.17e-02 | NA | 0.008 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 5.26e-01 | NA | 4.65e-06 |
| 3. B | P16157 | Ankyrin-1 | 9.02e-01 | NA | 0.020 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 5.80e-02 | NA | 0.001 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 4.55e-06 | NA | 0.002 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 5.25e-03 | NA | 0.003 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 2.87e-02 | NA | 6.12e-05 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 3.76e-01 | NA | 2.07e-05 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 6.19e-02 | NA | 2.19e-04 |
| 3. B | Q0VGY8 | Protein TANC1 | 4.80e-02 | NA | 1.03e-10 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 8.45e-02 | NA | 1.16e-04 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.78e-03 | NA | 0.005 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.14e-02 | NA | 2.64e-06 |
| 3. B | Q3TPE9 | Ankyrin repeat and MYND domain-containing protein 2 | 2.79e-02 | NA | 7.07e-04 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.86e-06 | NA | 3.63e-08 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 5.58e-01 | NA | 8.01e-04 |
| 3. B | Q9EP71 | Ankycorbin | 9.95e-03 | NA | 1.35e-07 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 2.59e-01 | NA | 0.019 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 8.15e-01 | NA | 7.74e-06 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 2.49e-02 | NA | 3.86e-05 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 5.76e-06 | NA | 0.002 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 2.71e-01 | NA | 4.05e-07 |
| 3. B | Q09655 | G patch domain and ankyrin repeat-containing protein 1 homolog | 2.15e-02 | NA | 0.003 |
| 3. B | Q653P0 | Potassium channel KOR1 | 2.59e-02 | NA | 0.009 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 5.28e-01 | NA | 1.24e-04 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 3.38e-01 | NA | 1.04e-04 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.69e-05 | NA | 5.69e-10 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 1.53e-06 |
| 3. B | Q6P1S6 | Myotrophin | 1.08e-08 | NA | 1.06e-04 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 5.12e-06 | NA | 2.19e-04 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 1.64e-03 | NA | 2.63e-04 |
| 3. B | C7B178 | Protein VAPYRIN | 1.50e-03 | NA | 1.41e-08 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 2.68e-03 | NA | 0.001 |
| 3. B | Q09103 | Eye-specific diacylglycerol kinase | 6.28e-01 | NA | 8.94e-06 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 7.82e-06 | NA | 1.12e-04 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 2.46e-05 | NA | 1.23e-04 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 2.15e-05 | NA | 0.011 |
| 3. B | Q71S21 | Inversin-B | 3.83e-01 | NA | 4.36e-04 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 5.21e-01 | NA | 3.72e-07 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 8.44e-03 | NA | 0.015 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 8.09e-06 | NA | 2.48e-05 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 3.06e-02 | NA | 0.001 |
| 3. B | Q9P0K7 | Ankycorbin | 9.72e-03 | NA | 4.64e-07 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 1.66e-02 | NA | 0.008 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 4.89e-06 | NA | 0.001 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 9.71e-06 |
| 3. B | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 9.63e-06 | NA | 0.013 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 1.33e-04 | NA | 5.46e-08 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 9.36e-01 | NA | 0.001 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 4.14e-04 | NA | 1.22e-04 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.09e-05 | NA | 3.04e-08 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 2.38e-04 | NA | 5.25e-05 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.04e-02 | NA | 6.23e-04 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 1.66e-03 | NA | 2.28e-05 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 7.69e-06 | NA | 3.71e-04 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.49e-05 | NA | 5.78e-09 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 1.21e-04 | NA | 5.27e-04 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 3.09e-03 | NA | 0.003 |
| 3. B | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 3.02e-01 | NA | 0.005 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 8.73e-08 | NA | 3.90e-05 |
| 3. B | Q7ZYG4 | Osteoclast-stimulating factor 1 | 5.48e-06 | NA | 8.33e-04 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 7.21e-01 | NA | 5.65e-04 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 7.02e-01 | NA | 5.47e-09 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 8.79e-01 | NA | 0.001 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 9.37e-02 | NA | 0.007 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 4.16e-05 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 3.44e-02 | NA | 0.001 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 7.08e-04 | NA | 3.17e-06 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 1.60e-02 | NA | 0.015 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.98e-05 | NA | 6.18e-10 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 6.13e-01 | NA | 6.17e-09 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 2.31e-02 | NA | 5.05e-05 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.00e-06 | NA | 1.39e-07 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.73e-01 | NA | 8.55e-07 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 2.51e-04 | NA | 1.81e-09 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 2.58e-06 | NA | 3.28e-05 |
| 3. B | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 4.76e-06 | NA | 0.010 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 7.21e-01 | NA | 3.44e-07 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 7.03e-04 | NA | 1.14e-06 |
| 3. B | P55272 | Cyclin-dependent kinase 4 inhibitor B | 2.83e-08 | NA | 7.39e-05 |
| 3. B | Q94A76 | Potassium channel GORK | 1.58e-02 | NA | 4.46e-04 |
| 3. B | Q810B6 | Rabankyrin-5 | 3.32e-02 | NA | 0.001 |
| 3. B | A0A1D8PNZ7 | Glycerophosphocholine phosphodiesterase GDE1 | 2.52e-01 | NA | 0.003 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 8.50e-04 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 1.83e-07 | NA | 8.25e-11 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 9.37e-01 | NA | 4.09e-07 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 2.89e-05 | NA | 5.36e-07 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 5.01e-06 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 4.31e-06 | NA | 1.37e-04 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 1.07e-02 | NA | 0.022 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 5.10e-01 | NA | 1.02e-06 |
| 3. B | Q38998 | Potassium channel AKT1 | 1.59e-01 | NA | 0.003 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 1.45e-04 | NA | 0.008 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 7.89e-05 | NA | 6.46e-10 |
| 3. B | P20749 | B-cell lymphoma 3 protein | 1.49e-03 | NA | 0.011 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 5.89e-09 | NA | 0.001 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 9.90e-03 | NA | 1.75e-04 |
| 3. B | Q6XJU9 | Osteoclast-stimulating factor 1 | 1.44e-09 | NA | 0.002 |
| 3. B | Q9XX14 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 | 7.99e-01 | NA | 0.002 |
| 3. B | Q6P686 | Osteoclast-stimulating factor 1 | 4.46e-06 | NA | 3.63e-04 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 3.85e-01 | NA | 1.13e-04 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 1.47e-03 | NA | 1.55e-04 |
| 3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 2.78e-03 | NA | 4.76e-09 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 1.18e-06 | NA | 6.16e-04 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.25e-05 | NA | 4.29e-09 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 1.12e-05 | NA | 7.98e-04 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.29e-05 | NA | 1.89e-09 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 4.55e-02 | NA | 1.88e-05 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 1.47e-02 | NA | 7.53e-08 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 7.79e-01 | NA | 6.02e-05 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 4.00e-02 | NA | 2.74e-05 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 1.92e-01 | NA | 2.16e-05 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 3.65e-04 | NA | 0.001 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 6.29e-01 | NA | 4.42e-07 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 3.03e-06 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 7.31e-02 | NA | 0.005 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 4.95e-04 | NA | 0.001 |
| 3. B | Q6F6B3 | Protein TANC1 | 6.10e-01 | NA | 1.32e-09 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 7.32e-06 | NA | 3.71e-04 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 4.06e-01 | NA | 1.03e-04 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.94e-05 | NA | 1.72e-08 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.04e-05 | NA | 4.12e-10 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 9.63e-06 | NA | 3.58e-05 |
| 3. B | P40480 | Protein HOS4 | 1.87e-01 | NA | 5.10e-08 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 8.68e-08 | NA | 4.98e-05 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 6.67e-06 | NA | 7.83e-06 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 4.98e-01 | NA | 4.03e-06 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 3.08e-01 | NA | 0.005 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 4.27e-04 | NA | 2.46e-05 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.91e-05 | NA | 5.21e-09 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 2.55e-03 | NA | 1.12e-06 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.25e-05 | NA | 7.73e-08 |
| 3. B | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 1.25e-01 | NA | 0.001 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 4.42e-01 | NA | 0.003 |
| 3. B | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 1.07e-05 | NA | 0.019 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 7.82e-01 | NA | 5.97e-05 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 1.57e-02 | NA | 1.32e-06 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 9.25e-02 | NA | 1.83e-04 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 5.68e-01 | NA | 3.63e-04 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 5.49e-06 | NA | 0.006 |
| 3. B | Q9H078 | Caseinolytic peptidase B protein homolog | 4.52e-03 | NA | 0.003 |
| 3. B | Q9VL06 | E3 ubiquitin-protein ligase Ufd4 | NA | NA | 1.67e-05 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 6.21e-01 | NA | 5.38e-05 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 9.28e-02 | NA | 0.002 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 1.10e-02 | NA | 5.14e-04 |
| 3. B | Q9HCD6 | Protein TANC2 | 1.92e-01 | NA | 2.33e-12 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 3.31e-01 | NA | 2.93e-06 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 1.38e-08 | NA | 0.001 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 7.28e-01 | NA | 1.06e-04 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.14e-02 | NA | 5.00e-05 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 6.95e-02 | NA | 2.09e-04 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 4.10e-02 | NA | 2.38e-08 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 2.58e-11 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 6.96e-01 | NA | 2.47e-05 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 5.11e-01 | NA | 3.20e-06 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 6.09e-01 | NA | 4.35e-06 |
| 3. B | Q71S22 | Inversin-A | 6.71e-02 | NA | 1.69e-05 |
| 3. B | Q92882 | Osteoclast-stimulating factor 1 | 4.59e-06 | NA | 8.88e-04 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 7.73e-02 | NA | 5.75e-05 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 5.91e-06 | NA | 2.04e-04 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 1.40e-06 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.20e-05 | NA | 7.44e-10 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 2.65e-03 | NA | 1.06e-04 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 5.07e-02 | NA | 1.64e-08 |
| 3. B | P53355 | Death-associated protein kinase 1 | 1.66e-01 | NA | 0.002 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 8.29e-02 | NA | 0.004 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 3.41e-04 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 9.84e-05 | NA | 0.006 |
| 3. B | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 2.99e-05 | NA | 0.028 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 5.92e-01 | NA | 3.85e-04 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 5.05e-03 | NA | 0.035 |
| 3. B | P0C550 | Potassium channel AKT1 | 5.31e-02 | NA | 6.66e-04 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 4.96e-01 | NA | 9.00e-06 |
| 3. B | G5EGA3 | Ankyrin repeat and LEM domain-containing protein 1 homolog | 1.79e-02 | NA | 5.07e-04 |
| 3. B | Q8TF27 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 | 3.67e-01 | NA | 0.027 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 8.05e-02 | NA | 7.66e-04 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 9.14e-03 | NA | 0.009 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 8.41e-04 | NA | 0.011 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.27e-05 | NA | 6.02e-07 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 4.47e-03 | NA | 0.005 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 8.88e-01 | NA | 2.49e-06 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 1.47e-04 | NA | 3.13e-08 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 3.33e-02 | NA | 3.83e-09 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.62e-01 | NA | 4.16e-04 |
| 3. B | Q0VCS9 | Ankyrin repeat and MYND domain-containing protein 2 | 8.53e-05 | NA | 0.035 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 3.72e-03 | NA | 0.013 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 1.53e-02 | NA | 9.33e-06 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.55e-05 | NA | 9.50e-08 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 3.57e-01 | NA | 5.12e-08 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 8.15e-01 | NA | 5.65e-04 |
| 3. B | Q6JAN1 | Inversin | 5.91e-02 | NA | 8.34e-08 |
| 3. B | F4IS56 | Integrin-linked protein kinase 1 | 2.62e-02 | NA | 0.017 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 1.15e-05 | NA | 0.004 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 3.71e-01 | NA | 8.39e-04 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 3.74e-01 | NA | 3.51e-06 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 1.02e-01 | NA | 4.49e-04 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 2.51e-05 | NA | 0.001 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 8.80e-01 | NA | 4.70e-06 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 4.76e-03 | NA | 0.046 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.21e-05 | NA | 1.01e-09 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 1.95e-05 | NA | 0.025 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 1.16e-02 | NA | 0.009 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 2.42e-04 | NA | 5.07e-05 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 5.08e-04 | NA | 6.71e-04 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 2.99e-01 | NA | 4.73e-06 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 9.48e-04 | NA | 1.52e-07 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 8.57e-02 | NA | 6.01e-06 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 4.41e-01 | NA | 7.03e-04 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 8.70e-01 | NA | 4.47e-06 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 8.29e-05 | NA | 0.049 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 3.11e-03 | NA | 0.013 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 3.51e-04 | NA | 0.023 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 1.12e-02 | NA | 0.002 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 2.17e-01 | NA | 1.89e-04 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 1.34e-02 | NA | 1.26e-04 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 3.03e-01 | NA | 9.36e-06 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 8.11e-02 | NA | 0.007 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 3.18e-01 | NA | 3.54e-07 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 1.10e-05 | NA | 0.001 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 8.00e-02 | NA | 1.76e-05 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 1.13e-04 | NA | 1.98e-07 |