Results | PROST

Summary

Q69YU3

Homolog: Q6XJU9.
Function: Osteoclast-stimulating factor 1.

Statistics

Total GO Annotation: 645
Unique PROST Go: 41
Unique BLAST Go: 568

Total Homologs: 517
Unique PROST Homologs: 17
Unique BLAST Homologs: 478

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6XJU9 (Osteoclast-stimulating factor 1) with a FATCAT P-Value: 1.44e-09 and RMSD of 1.20 angstrom. The sequence alignment identity is 9.3%.
Structural alignment shown in left. Query protein Q69YU3 colored as red in alignment, homolog Q6XJU9 colored as blue. Query protein Q69YU3 is also shown in right top, homolog Q6XJU9 showed in right bottom. They are colored based on secondary structures.

  Q69YU3 --------------------------------------------------------------------MLHTEGHALLRAVGQGKLRLARLLLEG--GAY 30
  Q6XJU9 MSKPPPKPAKPGQVKVFRALFTFDPRTPDELYFEEGDILYISDTSDTNWWKGTCRGRTGLIPSNYVAEQAETIDHPMHEAAKRGNLSWLRECVENKVG-- 98

  Q69YU3 VNEG-DAQGETALMAACRARYDDPQNKARMVRYLLEQ-GADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVR-D-HAGASALVHALDRGDRET 126
  Q6XJU9 IN-GLDKAGNTALYWACHGGHKD------VVELLLNQPSVELNQQNKLGDTVL-HAAAWKGYSDIVEMLL----DKNARTDIRNNENKL--ALEMATNAQ 184

  Q69YU3 LATLLDACKAK-GTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDP 225
  Q6XJU9 CASLL---KRKQGTNV----TRT----LSNAEEYLDDDDS----D------------------------------------------------------- 214

  Q69YU3 SPSEPLPKPPRHPPKPLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPPWAEKVTSGGPLSRRNTAPEAQESGP 325
  Q6XJU9 ---------------------------------------------------------------------------------------------------- 214

  Q69YU3 PSGLRQKLSRMEPVELDTPGHLCPDSPESSRLSLERRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQTRPGFL 425
  Q6XJU9 ---------------------------------------------------------------------------------------------------- 214

  Q69YU3 PPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIRLLGGFQSLGGPGEPGR 496
  Q6XJU9 ----------------------------------------------------------------------- 214

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0043063	intercellular bridge organization
1. PB	GO:0030155	regulation of cell adhesion
1. PB	GO:0008608	attachment of spindle microtubules to kinetochore
1. PB	GO:0007094	mitotic spindle assembly checkpoint signaling
1. PB	GO:0097543	ciliary inversin compartment
1. PB	GO:0017124	SH3 domain binding
1. PB	GO:0030507	spectrin binding
1. PB	GO:0015629	actin cytoskeleton
1. PB	GO:0004857	enzyme inhibitor activity
1. PB	GO:0051306	mitotic sister chromatid separation
1. PB	GO:0019901	protein kinase binding
1. PB	GO:0043197	dendritic spine
1. PB	GO:0001822	kidney development
1. PB	GO:0072357	PTW/PP1 phosphatase complex
1. PB	GO:0019208	phosphatase regulator activity
1. PB	GO:0090090	negative regulation of canonical Wnt signaling pathway
1. PB	GO:1901187	regulation of ephrin receptor signaling pathway
1. PB	GO:0007507	heart development
1. PB	GO:0006929	substrate-dependent cell migration
1. PB	GO:0001701	in utero embryonic development
1. PB	GO:0045171	intercellular bridge
1. PB	GO:0032466	negative regulation of cytokinesis
1. PB	GO:0032421	stereocilium bundle
1. PB	GO:0007368	determination of left/right symmetry
1. PB	GO:0005634	nucleus
1. PB	GO:0071889	14-3-3 protein binding
1. PB	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
1. PB	GO:0031672	A band
1. PB	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
1. PB	GO:0005856	cytoskeleton
1. PB	GO:0005929	cilium
1. PB	GO:0007140	male meiotic nuclear division
1. PB	GO:0030018	Z disc
1. PB	GO:0007165	signal transduction
1. PB	GO:0035507	regulation of myosin-light-chain-phosphatase activity
1. PB	GO:0016322	neuron remodeling
2. P	GO:0031932	TORC2 complex
2. P	GO:0005902	microvillus
2. P	GO:0051010	microtubule plus-end binding
2. P	GO:0051015	actin filament binding
2. P	GO:0032426	stereocilium tip
2. P	GO:0030034	microvillar actin bundle assembly
2. P	GO:0051491	positive regulation of filopodium assembly
2. P	GO:0060122	inner ear receptor cell stereocilium organization
2. P	GO:1904106	protein localization to microvillus
2. P	GO:0060113	inner ear receptor cell differentiation
2. P	GO:0050957	equilibrioception
2. P	GO:0006937	regulation of muscle contraction
2. P	GO:0048013	ephrin receptor signaling pathway
2. P	GO:0048793	pronephros development
2. P	GO:0051639	actin filament network formation
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:0007626	locomotory behavior
2. P	GO:0031122	cytoplasmic microtubule organization
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0034976	response to endoplasmic reticulum stress
2. P	GO:0030046	parallel actin filament bundle assembly
2. P	GO:0031929	TOR signaling
2. P	GO:0007605	sensory perception of sound
2. P	GO:0051017	actin filament bundle assembly
2. P	GO:0042472	inner ear morphogenesis
2. P	GO:1904970	brush border assembly
2. P	GO:0005903	brush border
2. P	GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
2. P	GO:0035371	microtubule plus-end
2. P	GO:0030950	establishment or maintenance of actin cytoskeleton polarity
2. P	GO:0036064	ciliary basal body
2. P	GO:0046875	ephrin receptor binding
2. P	GO:0045494	photoreceptor cell maintenance
2. P	GO:0050953	sensory perception of light stimulus
2. P	GO:0051494	negative regulation of cytoskeleton organization
2. P	GO:0032420	stereocilium
2. P	GO:0001917	photoreceptor inner segment
2. P	GO:0034622
2. P	GO:0042802	identical protein binding
2. P	GO:0031941	filamentous actin
3. B	GO:0005770	late endosome
3. B	GO:0034765	regulation of ion transmembrane transport
3. B	GO:0071625	vocalization behavior
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0060292	long-term synaptic depression
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0051835	positive regulation of synapse structural plasticity
3. B	GO:0048709	oligodendrocyte differentiation
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0035148	tube formation
3. B	GO:0042088	T-helper 1 type immune response
3. B	GO:0070563	negative regulation of vitamin D receptor signaling pathway
3. B	GO:0030334	regulation of cell migration
3. B	GO:0003270	Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B	GO:0010812	negative regulation of cell-substrate adhesion
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0021514	ventral spinal cord interneuron differentiation
3. B	GO:0070372	regulation of ERK1 and ERK2 cascade
3. B	GO:1903522	regulation of blood circulation
3. B	GO:0006306	DNA methylation
3. B	GO:0097190	apoptotic signaling pathway
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0003252	negative regulation of cell proliferation involved in heart valve morphogenesis
3. B	GO:0085020	protein K6-linked ubiquitination
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0001837	epithelial to mesenchymal transition
3. B	GO:0048259	regulation of receptor-mediated endocytosis
3. B	GO:0045070	positive regulation of viral genome replication
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0015095	magnesium ion transmembrane transporter activity
3. B	GO:0051489	regulation of filopodium assembly
3. B	GO:2000822	regulation of behavioral fear response
3. B	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B	GO:0033257	Bcl3/NF-kappaB2 complex
3. B	GO:0034968	histone lysine methylation
3. B	GO:0016571	histone methylation
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0035304	regulation of protein dephosphorylation
3. B	GO:0071546	pi-body
3. B	GO:0003162	atrioventricular node development
3. B	GO:0035690
3. B	GO:0007283	spermatogenesis
3. B	GO:0007492	endoderm development
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:0030534	adult behavior
3. B	GO:0031069	hair follicle morphogenesis
3. B	GO:0072659	protein localization to plasma membrane
3. B	GO:0086015	SA node cell action potential
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0097107	postsynaptic density assembly
3. B	GO:0007520	myoblast fusion
3. B	GO:1902807	negative regulation of cell cycle G1/S phase transition
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:0006913	nucleocytoplasmic transport
3. B	GO:0002437	inflammatory response to antigenic stimulus
3. B	GO:0002039	p53 binding
3. B	GO:0031286	negative regulation of sorocarp stalk cell differentiation
3. B	GO:0002052	positive regulation of neuroblast proliferation
3. B	GO:0042734	presynaptic membrane
3. B	GO:1902309	negative regulation of peptidyl-serine dephosphorylation
3. B	GO:0031462	Cul2-RING ubiquitin ligase complex
3. B	GO:0048715	negative regulation of oligodendrocyte differentiation
3. B	GO:0010564	regulation of cell cycle process
3. B	GO:0005123	death receptor binding
3. B	GO:0043409	negative regulation of MAPK cascade
3. B	GO:1900273	positive regulation of long-term synaptic potentiation
3. B	GO:0003160	endocardium morphogenesis
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0005764	lysosome
3. B	GO:0050894	determination of affect
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0097546	ciliary base
3. B	GO:0001947	heart looping
3. B	GO:0035116	embryonic hindlimb morphogenesis
3. B	GO:0090201	negative regulation of release of cytochrome c from mitochondria
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0008593	regulation of Notch signaling pathway
3. B	GO:0030496	midbody
3. B	GO:0072116	pronephros formation
3. B	GO:1990760	osmolarity-sensing cation channel activity
3. B	GO:0019888	protein phosphatase regulator activity
3. B	GO:0010366	negative regulation of ethylene biosynthetic process
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening
3. B	GO:0072044	collecting duct development
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:0030660	Golgi-associated vesicle membrane
3. B	GO:1900246	positive regulation of RIG-I signaling pathway
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0060999	positive regulation of dendritic spine development
3. B	GO:0007253	cytoplasmic sequestering of NF-kappaB
3. B	GO:0005516	calmodulin binding
3. B	GO:0045603	positive regulation of endothelial cell differentiation
3. B	GO:0030502	negative regulation of bone mineralization
3. B	GO:0097604	temperature-gated cation channel activity
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0055016	hypochord development
3. B	GO:0031877	somatostatin receptor binding
3. B	GO:0033292	T-tubule organization
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0048699	generation of neurons
3. B	GO:0071372	cellular response to follicle-stimulating hormone stimulus
3. B	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
3. B	GO:1904108	protein localization to ciliary inversin compartment
3. B	GO:1900245	positive regulation of MDA-5 signaling pathway
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0006915	apoptotic process
3. B	GO:0035924	cellular response to vascular endothelial growth factor stimulus
3. B	GO:0097114	NMDA glutamate receptor clustering
3. B	GO:1903077	negative regulation of protein localization to plasma membrane
3. B	GO:0014832	urinary bladder smooth muscle contraction
3. B	GO:0090521	glomerular visceral epithelial cell migration
3. B	GO:0031436	BRCA1-BARD1 complex
3. B	GO:0034605	cellular response to heat
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0050768	negative regulation of neurogenesis
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0005249	voltage-gated potassium channel activity
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:1902902	negative regulation of autophagosome assembly
3. B	GO:0036336	dendritic cell migration
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0061195	taste bud formation
3. B	GO:0031398	positive regulation of protein ubiquitination
3. B	GO:0018345	protein palmitoylation
3. B	GO:0021515	cell differentiation in spinal cord
3. B	GO:0015271	outward rectifier potassium channel activity
3. B	GO:0014807	regulation of somitogenesis
3. B	GO:0031670	cellular response to nutrient
3. B	GO:0030279	negative regulation of ossification
3. B	GO:0048663	neuron fate commitment
3. B	GO:0030016	myofibril
3. B	GO:0060743	epithelial cell maturation involved in prostate gland development
3. B	GO:0003182	coronary sinus valve morphogenesis
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:1902339	positive regulation of apoptotic process involved in morphogenesis
3. B	GO:0035307	positive regulation of protein dephosphorylation
3. B	GO:0007409	axonogenesis
3. B	GO:0035255	ionotropic glutamate receptor binding
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0050678	regulation of epithelial cell proliferation
3. B	GO:0031430	M band
3. B	GO:0008306	associative learning
3. B	GO:0043046	DNA methylation involved in gamete generation
3. B	GO:0070198	protein localization to chromosome, telomeric region
3. B	GO:0007030	Golgi organization
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:1902263	apoptotic process involved in embryonic digit morphogenesis
3. B	GO:0036371	protein localization to T-tubule
3. B	GO:0003344	pericardium morphogenesis
3. B	GO:0044030	regulation of DNA methylation
3. B	GO:0060076	excitatory synapse
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0003208	cardiac ventricle morphogenesis
3. B	GO:0003214	cardiac left ventricle morphogenesis
3. B	GO:2000812	regulation of barbed-end actin filament capping
3. B	GO:0010424	DNA methylation on cytosine within a CG sequence
3. B	GO:0051101	regulation of DNA binding
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0044309	neuron spine
3. B	GO:0005737	cytoplasm
3. B	GO:0098978	glutamatergic synapse
3. B	GO:2000001	regulation of DNA damage checkpoint
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0071560	cellular response to transforming growth factor beta stimulus
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:2001257	regulation of cation channel activity
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0014704	intercalated disc
3. B	GO:0097113	AMPA glutamate receptor clustering
3. B	GO:0042995	cell projection
3. B	GO:0007098	centrosome cycle
3. B	GO:0046959	habituation
3. B	GO:0001955	blood vessel maturation
3. B	GO:0010225	response to UV-C
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0035994	response to muscle stretch
3. B	GO:0060354	negative regulation of cell adhesion molecule production
3. B	GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B	GO:0031441	negative regulation of mRNA 3'-end processing
3. B	GO:0032232	negative regulation of actin filament bundle assembly
3. B	GO:0021546	rhombomere development
3. B	GO:0003332	negative regulation of extracellular matrix constituent secretion
3. B	GO:0043001	Golgi to plasma membrane protein transport
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0030330	DNA damage response, signal transduction by p53 class mediator
3. B	GO:0045794	negative regulation of cell volume
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:1904717	regulation of AMPA glutamate receptor clustering
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0042048	olfactory behavior
3. B	GO:0071447	cellular response to hydroperoxide
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0035914	skeletal muscle cell differentiation
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0071800	podosome assembly
3. B	GO:0051497	negative regulation of stress fiber assembly
3. B	GO:0140374	antiviral innate immune response
3. B	GO:1990830	cellular response to leukemia inhibitory factor
3. B	GO:0005096	GTPase activator activity
3. B	GO:1901222	regulation of NIK/NF-kappaB signaling
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:0030216	keratinocyte differentiation
3. B	GO:0003241	growth involved in heart morphogenesis
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0086004	regulation of cardiac muscle cell contraction
3. B	GO:0055007	cardiac muscle cell differentiation
3. B	GO:0031674	I band
3. B	GO:0045668	negative regulation of osteoblast differentiation
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:0003198	epithelial to mesenchymal transition involved in endocardial cushion formation
3. B	GO:0005112	Notch binding
3. B	GO:0010378	temperature compensation of the circadian clock
3. B	GO:0061028	establishment of endothelial barrier
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0001889	liver development
3. B	GO:0039529	RIG-I signaling pathway
3. B	GO:0036309	protein localization to M-band
3. B	GO:0065001	specification of axis polarity
3. B	GO:0048856	anatomical structure development
3. B	GO:0050750	low-density lipoprotein particle receptor binding
3. B	GO:0060317	cardiac epithelial to mesenchymal transition
3. B	GO:0097117	guanylate kinase-associated protein clustering
3. B	GO:0060948	cardiac vascular smooth muscle cell development
3. B	GO:0045732	positive regulation of protein catabolic process
3. B	GO:0098919	structural constituent of postsynaptic density
3. B	GO:0002357	defense response to tumor cell
3. B	GO:0002070	epithelial cell maturation
3. B	GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0031432	titin binding
3. B	GO:0051968	positive regulation of synaptic transmission, glutamatergic
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0031100	animal organ regeneration
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0070531	BRCA1-A complex
3. B	GO:0030154	cell differentiation
3. B	GO:0060582	cell fate determination involved in pattern specification
3. B	GO:0060842	arterial endothelial cell differentiation
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:1900452	regulation of long-term synaptic depression
3. B	GO:1902253	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
3. B	GO:0045955	negative regulation of calcium ion-dependent exocytosis
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:2001027	negative regulation of endothelial cell chemotaxis
3. B	GO:0038180	nerve growth factor signaling pathway
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0035518	histone H2A monoubiquitination
3. B	GO:0016021	integral component of membrane
3. B	GO:0031267	small GTPase binding
3. B	GO:0042981	regulation of apoptotic process
3. B	GO:0060035	notochord cell development
3. B	GO:0002193	MAML1-RBP-Jkappa- ICN1 complex
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:0021654	rhombomere boundary formation
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:2000737	negative regulation of stem cell differentiation
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B	GO:0010001	glial cell differentiation
3. B	GO:1902531	regulation of intracellular signal transduction
3. B	GO:0000062	fatty-acyl-CoA binding
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0031960	response to corticosteroid
3. B	GO:0003256	regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B	GO:1901201	regulation of extracellular matrix assembly
3. B	GO:0048892	lateral line nerve development
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0003170	heart valve development
3. B	GO:0019730	antimicrobial humoral response
3. B	GO:0005938	cell cortex
3. B	GO:0035640	exploration behavior
3. B	GO:0048708	astrocyte differentiation
3. B	GO:0005654	nucleoplasm
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0003222	ventricular trabecula myocardium morphogenesis
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0060740	prostate gland epithelium morphogenesis
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly
3. B	GO:0060411	cardiac septum morphogenesis
3. B	GO:0032717	negative regulation of interleukin-8 production
3. B	GO:0001779	natural killer cell differentiation
3. B	GO:0045967	negative regulation of growth rate
3. B	GO:0043034	costamere
3. B	GO:0021986	habenula development
3. B	GO:0018230	peptidyl-L-cysteine S-palmitoylation
3. B	GO:0016567	protein ubiquitination
3. B	GO:0036166	phenotypic switching
3. B	GO:0043052	thermotaxis
3. B	GO:0039022	pronephric duct development
3. B	GO:0070986	left/right axis specification
3. B	GO:0005576	extracellular region
3. B	GO:0019887	protein kinase regulator activity
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0098908	regulation of neuronal action potential
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0045814	negative regulation of gene expression, epigenetic
3. B	GO:0021915	neural tube development
3. B	GO:0002467	germinal center formation
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0061419	positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B	GO:0099612	protein localization to axon
3. B	GO:0007221	positive regulation of transcription of Notch receptor target
3. B	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0005524	ATP binding
3. B	GO:1905456	regulation of lymphoid progenitor cell differentiation
3. B	GO:0097422	tubular endosome
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0035176	social behavior
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:0001650	fibrillar center
3. B	GO:0048536	spleen development
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0140261	BCOR complex
3. B	GO:0035418	protein localization to synapse
3. B	GO:0005886	plasma membrane
3. B	GO:0042325	regulation of phosphorylation
3. B	GO:0010614	negative regulation of cardiac muscle hypertrophy
3. B	GO:0035646	endosome to melanosome transport
3. B	GO:0090212	negative regulation of establishment of blood-brain barrier
3. B	GO:0030219	megakaryocyte differentiation
3. B	GO:0048899	anterior lateral line development
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0062043	positive regulation of cardiac epithelial to mesenchymal transition
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0007009	plasma membrane organization
3. B	GO:0045607	regulation of inner ear auditory receptor cell differentiation
3. B	GO:0043292	contractile fiber
3. B	GO:0032996	Bcl3-Bcl10 complex
3. B	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0019843	rRNA binding
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:1900271	regulation of long-term synaptic potentiation
3. B	GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin
3. B	GO:1904058	positive regulation of sensory perception of pain
3. B	GO:0060979	vasculogenesis involved in coronary vascular morphogenesis
3. B	GO:0000151	ubiquitin ligase complex
3. B	GO:0030160	synaptic receptor adaptor activity
3. B	GO:0045662	negative regulation of myoblast differentiation
3. B	GO:0019228	neuronal action potential
3. B	GO:0072017	distal tubule development
3. B	GO:0007440	foregut morphogenesis
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0072073	kidney epithelium development
3. B	GO:0045859	regulation of protein kinase activity
3. B	GO:0051569	regulation of histone H3-K4 methylation
3. B	GO:0035023	regulation of Rho protein signal transduction
3. B	GO:0007386	compartment pattern specification
3. B	GO:0070316	regulation of G0 to G1 transition
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0042663	regulation of endodermal cell fate specification
3. B	GO:0021773	striatal medium spiny neuron differentiation
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0045874	positive regulation of sevenless signaling pathway
3. B	GO:0060768	regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0006897	endocytosis
3. B	GO:0070650	actin filament bundle distribution
3. B	GO:0045608	negative regulation of inner ear auditory receptor cell differentiation
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0071314	cellular response to cocaine
3. B	GO:0000242	pericentriolar material
3. B	GO:0003197	endocardial cushion development
3. B	GO:0016604	nuclear body
3. B	GO:1903589	positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003203	endocardial cushion morphogenesis
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0003408	optic cup formation involved in camera-type eye development
3. B	GO:1901981	phosphatidylinositol phosphate binding
3. B	GO:1905453	regulation of myeloid progenitor cell differentiation
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0016409	palmitoyltransferase activity
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0046957	negative phototaxis
3. B	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0003169	coronary vein morphogenesis
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:0047389	glycerophosphocholine phosphodiesterase activity
3. B	GO:0010832	negative regulation of myotube differentiation
3. B	GO:0002315	marginal zone B cell differentiation
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070682	proteasome regulatory particle assembly
3. B	GO:0070412	R-SMAD binding
3. B	GO:0140439	protein-cysteine S-stearoyltransferase activity
3. B	GO:0051438	regulation of ubiquitin-protein transferase activity
3. B	GO:0045648	positive regulation of erythrocyte differentiation
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0071244	cellular response to carbon dioxide
3. B	GO:0048148	behavioral response to cocaine
3. B	GO:0060982	coronary artery morphogenesis
3. B	GO:0007616	long-term memory
3. B	GO:0045687	positive regulation of glial cell differentiation
3. B	GO:0014069	postsynaptic density
3. B	GO:0002268	follicular dendritic cell differentiation
3. B	GO:0010780	meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B	GO:0031867	EP4 subtype prostaglandin E2 receptor binding
3. B	GO:0000776	kinetochore
3. B	GO:0048103	somatic stem cell division
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:0050955	thermoception
3. B	GO:0060843	venous endothelial cell differentiation
3. B	GO:0001838	embryonic epithelial tube formation
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0014065	phosphatidylinositol 3-kinase signaling
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0003207	cardiac chamber formation
3. B	GO:0061384	heart trabecula morphogenesis
3. B	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
3. B	GO:0048060	negative gravitaxis
3. B	GO:0034703	cation channel complex
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0030315	T-tubule
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0003209	cardiac atrium morphogenesis
3. B	GO:1905936	regulation of germ cell proliferation
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:1903670	regulation of sprouting angiogenesis
3. B	GO:0021531	spinal cord radial glial cell differentiation
3. B	GO:0032091	negative regulation of protein binding
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:2000969	positive regulation of AMPA receptor activity
3. B	GO:0005262	calcium channel activity
3. B	GO:0017020	myosin phosphatase regulator activity
3. B	GO:0097062	dendritic spine maintenance
3. B	GO:0031901	early endosome membrane
3. B	GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
3. B	GO:0003213	cardiac right atrium morphogenesis
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0060707	trophoblast giant cell differentiation
3. B	GO:0009912	auditory receptor cell fate commitment
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0043066	negative regulation of apoptotic process
3. B	GO:1904355	positive regulation of telomere capping
3. B	GO:0033270	paranode region of axon
3. B	GO:0001895	retina homeostasis
3. B	GO:0045184	establishment of protein localization
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0046822	regulation of nucleocytoplasmic transport
3. B	GO:0048170	positive regulation of long-term neuronal synaptic plasticity
3. B	GO:0048854	brain morphogenesis
3. B	GO:0003219	cardiac right ventricle formation
3. B	GO:0072144	glomerular mesangial cell development
3. B	GO:0009610	response to symbiotic fungus
3. B	GO:0016235	aggresome
3. B	GO:0060956	endocardial cell differentiation
3. B	GO:0035265	organ growth
3. B	GO:0042383	sarcolemma
3. B	GO:1901189	positive regulation of ephrin receptor signaling pathway
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0060038	cardiac muscle cell proliferation
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:0042297	vocal learning
3. B	GO:0002040	sprouting angiogenesis
3. B	GO:2000310	regulation of NMDA receptor activity
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:0045064	T-helper 2 cell differentiation
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0061025	membrane fusion
3. B	GO:0051386	regulation of neurotrophin TRK receptor signaling pathway
3. B	GO:0097110	scaffold protein binding
3. B	GO:1990393	3M complex
3. B	GO:0045618	positive regulation of keratinocyte differentiation
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0060013	righting reflex
3. B	GO:0050968	detection of chemical stimulus involved in sensory perception of pain
3. B	GO:0042246	tissue regeneration
3. B	GO:0003157	endocardium development
3. B	GO:0002455	humoral immune response mediated by circulating immunoglobulin
3. B	GO:0090314	positive regulation of protein targeting to membrane
3. B	GO:1900451	positive regulation of glutamate receptor signaling pathway
3. B	GO:1903343	positive regulation of meiotic DNA double-strand break formation
3. B	GO:0090029	negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B	GO:0046533	negative regulation of photoreceptor cell differentiation
3. B	GO:0097150	neuronal stem cell population maintenance
3. B	GO:0060045	positive regulation of cardiac muscle cell proliferation
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:1903849	positive regulation of aorta morphogenesis
3. B	GO:0003713	transcription coactivator activity
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0051865	protein autoubiquitination
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0003192	mitral valve formation
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0000415	negative regulation of histone H3-K36 methylation
3. B	GO:0033268	node of Ranvier
3. B	GO:0048665	neuron fate specification
3. B	GO:0003264	regulation of cardioblast proliferation
3. B	GO:0019705	protein-cysteine S-myristoyltransferase activity
3. B	GO:0001835	blastocyst hatching
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0061314	Notch signaling involved in heart development
3. B	GO:0071709	membrane assembly
3. B	GO:0015278	calcium-release channel activity
3. B	GO:0043422	protein kinase B binding
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0060992	response to fungicide
3. B	GO:2000463	positive regulation of excitatory postsynaptic potential
3. B	GO:0030673	axolemma
3. B	GO:0014732	skeletal muscle atrophy
3. B	GO:0019899	enzyme binding
3. B	GO:0060361	flight
3. B	GO:0099173	postsynapse organization
3. B	GO:0051570	regulation of histone H3-K9 methylation
3. B	GO:0034587	piRNA metabolic process
3. B	GO:2000974	negative regulation of pro-B cell differentiation
3. B	GO:0031532	actin cytoskeleton reorganization
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:0048845	venous blood vessel morphogenesis
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:2000311	regulation of AMPA receptor activity
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:0060253	negative regulation of glial cell proliferation
3. B	GO:0050966	detection of mechanical stimulus involved in sensory perception of pain
3. B	GO:0014031	mesenchymal cell development
3. B	GO:0051151	negative regulation of smooth muscle cell differentiation
3. B	GO:0005829	cytosol
3. B	GO:0046872	metal ion binding
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0097553	calcium ion transmembrane import into cytosol
3. B	GO:0007528	neuromuscular junction development
3. B	GO:2000821	regulation of grooming behavior
3. B	GO:0000139	Golgi membrane
3. B	GO:0060708	spongiotrophoblast differentiation
3. B	GO:0035556	intracellular signal transduction
3. B	GO:0019706	protein-cysteine S-palmitoyltransferase activity
3. B	GO:0003273	cell migration involved in endocardial cushion formation
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0048916	posterior lateral line development
3. B	GO:1903793	positive regulation of anion transport
3. B	GO:0070168	negative regulation of biomineral tissue development
3. B	GO:0044354	macropinosome
3. B	GO:0060074	synapse maturation
3. B	GO:0061344	regulation of cell adhesion involved in heart morphogenesis
3. B	GO:0032088	negative regulation of NF-kappaB transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q6ZW76	Ankyrin repeat and SAM domain-containing protein 3	4.92e-02	8.80e-05	1.55e-08
1. PB	Q9Y2G4	Ankyrin repeat domain-containing protein 6	1.82e-02	1.75e-10	0.022
1. PB	P59672	Ankyrin repeat and SAM domain-containing protein 1A	1.86e-02	1.18e-02	0.016
1. PB	P0C0T2	Ankyrin repeat and SAM domain-containing protein 6	1.43e-02	2.87e-03	7.64e-07
1. PB	Q69YU3	Ankyrin repeat domain-containing protein 34A	0	1.89e-121	0.0
1. PB	Q3UUF8	Ankyrin repeat domain-containing protein 34B	2.84e-05	3.51e-32	2.60e-49
1. PB	Q80VM7	Ankyrin repeat domain-containing protein 24	2.94e-01	1.51e-03	1.71e-06
1. PB	Q5PQ89	Ankyrin repeat domain-containing protein 34B	4.56e-04	7.40e-31	5.04e-99
1. PB	Q69ZU8	Ankyrin repeat domain-containing protein 6	1.02e-02	4.50e-10	0.011
1. PB	Q8BLB8	Ankyrin repeat domain-containing protein 34C	5.44e-06	1.52e-35	1.91e-105
1. PB	Q90623	Protein phosphatase 1 regulatory subunit 12A	2.87e-02	1.02e-05	9.89e-06
1. PB	P0C6C1	Ankyrin repeat domain-containing protein 34C	1.52e-05	4.51e-40	2.60e-104
1. PB	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	1.35e-02	3.46e-03	2.66e-05
1. PB	Q9CZK6	Ankyrin repeat and SAM domain-containing protein 3	7.80e-03	1.14e-02	7.83e-09
1. PB	Q3UMT1	Protein phosphatase 1 regulatory subunit 12C	2.77e-03	1.03e-03	0.001
1. PB	O60237	Protein phosphatase 1 regulatory subunit 12B	1.44e-01	1.63e-08	2.46e-06
1. PB	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	1.49e-02	2.50e-04	6.22e-06
1. PB	A5PLL1	Ankyrin repeat domain-containing protein 34B	5.47e-04	1.20e-35	6.43e-79
1. PB	Q5BJT1	Ankyrin repeat domain-containing protein 34A	1.68e-05	9.13e-99	0.0
1. PB	Q8BG95	Protein phosphatase 1 regulatory subunit 12B	8.56e-02	1.08e-07	7.02e-06
1. PB	Q6ZVH7	Espin-like protein	3.82e-02	5.57e-04	0.003
1. PB	F1M5M3	Inactive serine/threonine-protein kinase TEX14	NA	3.39e-03	0.002
2. P	Q8N8V4	Ankyrin repeat and SAM domain-containing protein 4B	2.58e-03	8.55e-04	NA
2. P	Q5XJ13	Ankyrin repeat and SAM domain-containing protein 6	4.93e-02	2.11e-06	NA
2. P	Q9LUZ4	Zinc finger CCCH domain-containing protein 66	7.40e-02	4.62e-02	NA
2. P	Q7XI08	Probable E3 ubiquitin-protein ligase XBOS34	1.30e-03	3.82e-02	NA
2. P	Q80YS5	Leucine-rich repeat-containing protein 27	8.91e-01	2.79e-02	NA
2. P	Q9ET47	Espin	3.82e-02	9.68e-03	NA
2. P	Q8VHK1	Caskin-2	4.30e-02	3.72e-04	NA
2. P	Q4FE47	Putative E3 ubiquitin-protein ligase XBAT35	1.91e-03	2.38e-02	NA
2. P	Q63618	Espin	4.91e-02	1.02e-02	NA
2. P	Q04749	Target of rapamycin complex 2 subunit AVO2	5.62e-03	5.20e-05	NA
2. P	Q3UYR4	Espin-like protein	1.03e-01	3.65e-04	NA
2. P	Q8CI96	CAP-Gly domain-containing linker protein 4	1.90e-01	3.53e-02	NA
2. P	Q8K3X6	Ankyrin repeat and SAM domain-containing protein 4B	1.60e-03	1.32e-03	NA
2. P	Q8N3C7	CAP-Gly domain-containing linker protein 4	6.28e-03	1.60e-02	NA
2. P	Q5XK72	Protein FAM83G	3.75e-01	4.66e-02	NA
2. P	Q80T11	Usher syndrome type-1G protein homolog	8.24e-03	1.38e-04	NA
2. P	Q495M9	Usher syndrome type-1G protein	5.00e-02	3.57e-04	NA
3. B	Q9H560	Putative ankyrin repeat domain-containing protein 19	5.14e-06	NA	0.004
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	9.43e-06	NA	8.74e-05
3. B	Q8BX02	KN motif and ankyrin repeat domain-containing protein 2	7.85e-02	NA	7.26e-07
3. B	Q00PJ1	Cortactin-binding protein 2	8.83e-01	NA	3.05e-07
3. B	Q9VCA8	Ankyrin repeat and KH domain-containing protein mask	NA	NA	2.25e-06
3. B	A2ARS0	Ankyrin repeat domain-containing protein 63	2.07e-03	NA	1.83e-09
3. B	Q8IUH5	Palmitoyltransferase ZDHHC17	1.53e-04	NA	0.004
3. B	F1MJR8	Inactive serine/threonine-protein kinase TEX14	6.76e-01	NA	7.35e-05
3. B	Q15327	Ankyrin repeat domain-containing protein 1	5.16e-04	NA	0.021
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	1.60e-02	NA	0.012
3. B	Q6AFL2	Putative ankyrin-containing lipoprotein Lxx09580	1.77e-06	NA	0.001
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	7.95e-02	NA	6.50e-05
3. B	Q99NH0	Ankyrin repeat domain-containing protein 17	4.52e-01	NA	1.42e-10
3. B	Q2QL84	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	8.72e-04	NA	1.20e-09
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	1.20e-03	NA	0.023
3. B	Q6P9J5	KN motif and ankyrin repeat domain-containing protein 4	6.99e-01	NA	1.11e-05
3. B	O89019	Inversin	1.67e-01	NA	8.52e-08
3. B	Q2QLB5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.63e-05	NA	2.00e-07
3. B	Q1LZC5	Ankyrin repeat domain-containing protein 54	6.74e-06	NA	1.33e-05
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	2.45e-03	NA	0.017
3. B	Q66JD7	Acyl-CoA-binding domain-containing protein 6	2.24e-05	NA	0.002
3. B	P0C6P7	Protein fem-1 homolog B	2.06e-04	NA	7.84e-09
3. B	Q53RE8	Ankyrin repeat domain-containing protein 39	5.80e-07	NA	0.001
3. B	Q8CEF1	Protein fem-1 homolog C	1.09e-03	NA	1.52e-07
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	4.76e-03	NA	0.003
3. B	Q54HW1	26S proteasome non-ATPase regulatory subunit 10	1.82e-06	NA	3.08e-04
3. B	Q9J5H8	Putative ankyrin repeat protein FPV023	NA	NA	5.39e-08
3. B	D3J162	Protein VAPYRIN	1.62e-03	NA	4.05e-08
3. B	Q0P5B9	Ankyrin repeat domain-containing protein 39	8.18e-07	NA	0.005
3. B	Q4UJ75	Putative ankyrin repeat domain-containing protein 20A4	5.43e-03	NA	0.001
3. B	Q06527	Ankyrin homolog	2.47e-04	NA	7.62e-13
3. B	Q8WMX8	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.89e-05	NA	6.02e-10
3. B	Q07DZ7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.25e-05	NA	1.41e-06
3. B	Q8N7Z5	Ankyrin repeat domain-containing protein 31	3.59e-01	NA	0.011
3. B	Q0JKV1	Potassium channel AKT1	2.81e-02	NA	6.38e-04
3. B	Q566C8	Ankyrin repeat domain-containing protein 54	5.91e-06	NA	6.29e-05
3. B	Q641X1	Ankyrin repeat domain-containing protein 61	1.06e-05	NA	0.006
3. B	Q09YH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.64e-05	NA	1.27e-07
3. B	Q96T49	Protein phosphatase 1 regulatory inhibitor subunit 16B	3.85e-02	NA	0.005
3. B	Q2IBB2	Cortactin-binding protein 2	2.81e-01	NA	3.22e-06
3. B	O14593	DNA-binding protein RFXANK	3.69e-08	NA	2.10e-04
3. B	Q5UPG7	Putative ankyrin repeat protein L91	NA	NA	4.71e-06
3. B	Q9EQG6	Kinase D-interacting substrate of 220 kDa	8.33e-01	NA	1.98e-08
3. B	Q9UPQ3	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1	4.03e-01	NA	0.014
3. B	Q4KL97	Ankyrin repeat domain-containing protein 1	4.57e-04	NA	1.21e-04
3. B	P14368	Putative ankyrin repeat protein FPV234	NA	NA	0.001
3. B	Q00PJ3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.52e-05	NA	1.52e-08
3. B	Q07E41	Cortactin-binding protein 2	5.71e-01	NA	3.72e-05
3. B	Q2QLG9	Cortactin-binding protein 2	7.17e-01	NA	7.16e-06
3. B	Q9Z2X2	26S proteasome non-ATPase regulatory subunit 10	9.43e-07	NA	4.83e-04
3. B	Q95N27	Protein phosphatase 1 regulatory inhibitor subunit 16B	3.77e-02	NA	0.006
3. B	Q9J5A7	Putative ankyrin repeat protein FPV115	NA	NA	1.49e-05
3. B	Q9J4Z6	Putative ankyrin repeat protein FPV244	NA	NA	0.001
3. B	Q9WV06	Ankyrin repeat domain-containing protein 2	2.99e-04	NA	2.25e-06
3. B	Q5ZJJ9	Osteoclast-stimulating factor 1	4.89e-06	NA	0.002
3. B	B2RU33	POTE ankyrin domain family member C	2.28e-03	NA	4.01e-05
3. B	Q07E17	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.63e-05	NA	9.43e-10
3. B	Q9UVH3	Palmitoyltransferase AKR1 (Fragment)	2.62e-04	NA	2.02e-05
3. B	Q02357	Ankyrin-1	8.81e-01	NA	0.019
3. B	Q6NSI1	Putative ankyrin repeat domain-containing protein 26-like protein	9.45e-06	NA	1.21e-04
3. B	P0CG38	POTE ankyrin domain family member I	3.63e-02	NA	4.69e-04
3. B	A0JP26	POTE ankyrin domain family member B3	4.16e-03	NA	9.99e-06
3. B	O74205	Transcription factor TOXE	9.35e-06	NA	0.032
3. B	Q09YJ5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.27e-05	NA	3.05e-10
3. B	Q2QLC6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.39e-06	NA	2.55e-09
3. B	Q4ULZ2	Putative ankyrin repeat protein RF_0580	1.29e-05	NA	0.002
3. B	Q8N8A2	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	2.29e-03	NA	0.003
3. B	Q9D504	Ankyrin repeat domain-containing protein 7	2.80e-06	NA	2.17e-04
3. B	Q29RM5	Protein fem-1 homolog A	2.55e-02	NA	0.003
3. B	Q8WMX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.74e-05	NA	1.53e-08
3. B	Q6S5H5	POTE ankyrin domain family member G	5.17e-04	NA	2.42e-05
3. B	Q5F478	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	2.48e-03	NA	0.002
3. B	Q5U312	Ankycorbin	2.25e-02	NA	1.69e-07
3. B	Q21920	Ankyrin repeat and KH domain-containing protein mask-1	3.06e-01	NA	4.74e-05
3. B	Q62422	Osteoclast-stimulating factor 1	4.85e-06	NA	2.86e-04
3. B	Q9J507	Putative ankyrin repeat protein FPV228	NA	NA	0.002
3. B	Q5R6D7	Ankyrin repeat and SOCS box protein 8	8.98e-07	NA	4.65e-04
3. B	S0DPL8	Apicidin F cluster transcription factor apf2	2.49e-05	NA	3.84e-07
3. B	P0CS67	Palmitoyltransferase AKR1	9.05e-04	NA	0.011
3. B	Q9Z2G0	Protein fem-1 homolog B	2.74e-04	NA	7.98e-09
3. B	Q8IV38	Ankyrin repeat and MYND domain-containing protein 2	8.63e-05	NA	0.010
3. B	A1ZBY1	Protein fem-1 homolog B	3.91e-03	NA	6.50e-07
3. B	Q5UQ58	Putative ankyrin repeat protein R664	NA	NA	0.045
3. B	Q554E7	Putative ZDHHC-type palmitoyltransferase 5	5.63e-04	NA	3.87e-06
3. B	Q4JHE0	Probable E3 ubiquitin-protein ligase XBOS36	4.55e-03	NA	0.001
3. B	A6QL64	Ankyrin repeat domain-containing protein 36A	1.63e-01	NA	0.001
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	7.51e-02	NA	0.005
3. B	G5E8K5	Ankyrin-3	8.20e-01	NA	5.34e-05
3. B	Q8K0L0	Ankyrin repeat and SOCS box protein 2	1.86e-03	NA	7.48e-04
3. B	Q9SQK3	Ankyrin repeat domain-containing protein EMB506, chloroplastic	5.93e-06	NA	0.017
3. B	A0PJZ0	Putative ankyrin repeat domain-containing protein 20A5	2.82e-09	NA	0.010
3. B	V6CLA2	E3 ubiquitin-protein ligase hecd-1	9.30e-01	NA	0.001
3. B	Q7T0Q1	Myotrophin	1.02e-08	NA	2.89e-04
3. B	Q3TYA6	M-phase phosphoprotein 8	2.63e-01	NA	4.88e-08
3. B	Q8TF21	Ankyrin repeat domain-containing protein 24	4.17e-01	NA	2.60e-05
3. B	A0A0A6YYL3	POTE ankyrin domain family member B	2.38e-03	NA	3.17e-06
3. B	A2AQH4	BCL-6 corepressor-like protein 1	9.40e-01	NA	0.001
3. B	O70511	Ankyrin-3	7.96e-01	NA	1.32e-05
3. B	Q5R8C8	Ankyrin repeat domain-containing protein 46	6.74e-06	NA	3.27e-04
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	7.92e-02	NA	0.001
3. B	Q5CZ79	Ankyrin repeat domain-containing protein 20B	8.40e-03	NA	5.39e-04
3. B	Q9H765	Ankyrin repeat and SOCS box protein 8	3.55e-06	NA	4.99e-04
3. B	Q99549	M-phase phosphoprotein 8	9.48e-02	NA	5.05e-08
3. B	Q3KP44	Ankyrin repeat domain-containing protein 55	2.67e-03	NA	1.34e-04
3. B	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	1.07e-06	NA	7.93e-05
3. B	Q54HC6	Ankyrin repeat-containing protein kinase A	8.31e-01	NA	0.039
3. B	Q7T163	Kinase D-interacting substrate of 220 kDa B	9.17e-01	NA	5.02e-08
3. B	Q8NAG6	Ankyrin repeat and LEM domain-containing protein 1	2.37e-02	NA	0.050
3. B	Q9J505	Putative ankyrin repeat protein FPV230	NA	NA	0.031
3. B	A1X154	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.97e-05	NA	2.41e-11
3. B	Q7XUW4	Potassium channel KOR2	4.86e-03	NA	0.003
3. B	Q6RI86	Transient receptor potential cation channel subfamily A member 1	2.83e-03	NA	0.008
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	5.73e-02	NA	5.29e-05
3. B	Q9WV48	SH3 and multiple ankyrin repeat domains protein 1	3.76e-01	NA	4.38e-07
3. B	Q8N2N9	Ankyrin repeat domain-containing protein 36B	3.95e-02	NA	1.41e-05
3. B	Q4UJY2	Putative ankyrin repeat protein RF_1306	1.96e-04	NA	0.002
3. B	Q07DV1	Cortactin-binding protein 2	8.15e-01	NA	8.14e-07
3. B	D3J163	Protein VAPYRIN-LIKE	1.65e-03	NA	0.021
3. B	Q9W0T5	Transient receptor potential channel pyrexia	1.40e-02	NA	0.015
3. B	Q9NWX5	Ankyrin repeat and SOCS box protein 6	3.25e-05	NA	0.012
3. B	Q5W7F2	ADP-ribosylation factor GTPase-activating protein AGD3	3.81e-01	NA	0.001
3. B	A2A690	Protein TANC2	7.34e-02	NA	4.28e-12
3. B	Q07DW4	Cortactin-binding protein 2	6.60e-01	NA	4.16e-07
3. B	A5A3E0	POTE ankyrin domain family member F	4.87e-02	NA	5.96e-05
3. B	Q6KAE5	Probable E3 ubiquitin-protein ligase XBOS32	2.31e-03	NA	0.036
3. B	Q4R3S3	Ankyrin repeat domain-containing protein 7	1.79e-04	NA	6.27e-06
3. B	Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2	5.86e-01	NA	3.36e-06
3. B	Q07DX4	Cortactin-binding protein 2	8.40e-01	NA	5.26e-06
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	4.42e-04	NA	3.39e-04
3. B	Q8BTZ5	Ankyrin repeat domain-containing protein 46	5.47e-06	NA	1.34e-04
3. B	Q8BLA8	Transient receptor potential cation channel subfamily A member 1	3.07e-03	NA	0.006
3. B	Q8H569	Potassium channel AKT3	9.59e-02	NA	3.32e-04
3. B	Q8CGN4	BCL-6 corepressor	9.26e-01	NA	2.35e-04
3. B	A6NI47	Putative POTE ankyrin domain family member M	1.23e-04	NA	6.47e-05
3. B	Q6C520	Palmitoyltransferase AKR1	3.38e-04	NA	0.002
3. B	Q7T3P8	Protein fem-1 homolog C	9.70e-04	NA	3.11e-08
3. B	Q2QLA2	Cortactin-binding protein 2	7.60e-01	NA	1.11e-06
3. B	Q74ZH9	Glycerophosphocholine phosphodiesterase GDE1	2.88e-01	NA	0.004
3. B	Q5UPX1	Putative ankyrin repeat protein L289	NA	NA	3.68e-05
3. B	Q9D2X0	Ankyrin repeat domain-containing protein 39	9.66e-07	NA	0.003
3. B	P17221	Sex-determining protein fem-1	4.93e-04	NA	7.79e-06
3. B	Q9Z2F6	B-cell lymphoma 3 protein homolog	2.39e-04	NA	0.012
3. B	O75179	Ankyrin repeat domain-containing protein 17	4.43e-01	NA	1.20e-10
3. B	Q5ZMD2	Ankyrin repeat and MYND domain-containing protein 2	1.17e-04	NA	0.010
3. B	O83515	Putative ankyrin repeat-containing protein TP_0502	5.88e-06	NA	3.36e-04
3. B	Q09YM8	Cortactin-binding protein 2	7.18e-01	NA	2.35e-06
3. B	A7MB89	Protein fem-1 homolog C	1.14e-03	NA	1.62e-07
3. B	Q9WTT2	Caseinolytic peptidase B protein homolog	1.42e-04	NA	1.75e-04
3. B	Q6GPE5	Protein fem-1 homolog B	2.89e-04	NA	1.62e-08
3. B	Q69ZR2	E3 ubiquitin-protein ligase HECTD1	9.41e-01	NA	8.40e-06
3. B	Q8BXK8	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1	4.81e-01	NA	0.025
3. B	Q9H2K2	Poly [ADP-ribose] polymerase tankyrase-2	8.30e-02	NA	1.43e-05
3. B	Q07E30	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.41e-05	NA	5.86e-10
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	3.83e-08	NA	0.001
3. B	P55271	Cyclin-dependent kinase 4 inhibitor B	1.63e-08	NA	8.70e-05
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	7.10e-01	NA	2.20e-04
3. B	Q9BXX2	Ankyrin repeat domain-containing protein 30B	2.46e-01	NA	2.06e-05
3. B	Q80YE7	Death-associated protein kinase 1	1.94e-01	NA	0.002
3. B	Q5URB8	Putative ankyrin repeat protein R841	NA	NA	1.48e-04
3. B	Q91ZT7	Ankyrin repeat and SOCS box protein 10	3.16e-05	NA	4.31e-05
3. B	Q5UPG0	Putative ankyrin repeat protein L86	NA	NA	1.25e-09
3. B	Q4UMP3	Putative ankyrin repeat protein RF_0314	1.08e-03	NA	0.003
3. B	E9PTT0	Palmitoyltransferase ZDHHC17	1.48e-04	NA	0.009
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	7.14e-06	NA	1.81e-04
3. B	Q8UVC1	Inversin	8.94e-02	NA	7.28e-08
3. B	Q8GSP8	Zygote-specific protein 3	4.75e-03	NA	3.26e-07
3. B	Q5SQ80	Putative ankyrin repeat domain-containing protein 20A2	7.71e-03	NA	0.001
3. B	Q2IBD4	Cortactin-binding protein 2	3.34e-01	NA	3.86e-04
3. B	P0CG39	POTE ankyrin domain family member J	2.26e-01	NA	3.60e-04
3. B	Q978J0	Putative ankyrin repeat protein TV1425	1.60e-08	NA	6.04e-06
3. B	Q2IBF5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.24e-05	NA	1.39e-08
3. B	P46530	Neurogenic locus notch homolog protein 1	2.90e-01	NA	0.007
3. B	Q6ZVZ8	Ankyrin repeat and SOCS box protein 18	2.72e-05	NA	5.88e-04
3. B	Q9VSA4	Tonsoku-like protein	2.50e-01	NA	0.016
3. B	Q2IBE3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.54e-05	NA	3.18e-09
3. B	Q8IWZ3	Ankyrin repeat and KH domain-containing protein 1	6.93e-01	NA	3.75e-10
3. B	B9EJA2	Cortactin-binding protein 2	2.11e-01	NA	5.86e-05
3. B	Q8MJ50	Osteoclast-stimulating factor 1	5.03e-06	NA	0.001
3. B	Q4V890	Protein fem-1 homolog A	6.07e-03	NA	0.039
3. B	Q8CGB3	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.67e-02	NA	3.36e-04
3. B	Q8IVF6	Ankyrin repeat domain-containing protein 18A	6.77e-02	NA	6.57e-04
3. B	Q9J5H5	Putative ankyrin repeat protein FPV026	NA	NA	6.73e-04
3. B	Q8IWB6	Inactive serine/threonine-protein kinase TEX14	8.31e-01	NA	6.28e-04
3. B	Q3UES3	Poly [ADP-ribose] polymerase tankyrase-2	5.04e-02	NA	7.24e-06
3. B	A5WVX9	Palmitoyltransferase ZDHHC17	8.96e-05	NA	0.006
3. B	Q9J504	Putative ankyrin repeat protein FPV231	NA	NA	2.07e-07
3. B	Q6W2J9	BCL-6 corepressor	9.47e-01	NA	3.03e-04
3. B	Q91ZT9	Ankyrin repeat and SOCS box protein 8	1.17e-06	NA	7.95e-04
3. B	Q9J4Z4	Putative ankyrin repeat protein FPV246	NA	NA	9.50e-09
3. B	A6NC57	Ankyrin repeat domain-containing protein 62	7.87e-03	NA	9.17e-07
3. B	Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3	7.58e-02	NA	5.79e-05
3. B	Q8C6Y6	Ankyrin repeat and SOCS box protein 14	7.53e-04	NA	0.005
3. B	Q5UPJ9	Putative ankyrin repeat protein L122	NA	NA	5.83e-09
3. B	Q54F46	Homeobox protein Wariai	1.64e-02	NA	5.08e-06
3. B	F1LTE0	Protein TANC2	5.25e-01	NA	4.55e-12
3. B	Q108T9	Cortactin-binding protein 2	1.65e-01	NA	5.49e-07
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	6.23e-06	NA	1.98e-04
3. B	Q9ERC1	Unconventional myosin-XVI	6.66e-01	NA	0.001
3. B	Q9P2R3	Rabankyrin-5	4.01e-02	NA	3.98e-05
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	1.00e-02	NA	1.50e-04
3. B	Q8UVC3	Inversin	8.52e-02	NA	6.59e-05
3. B	Q05921	2-5A-dependent ribonuclease	2.85e-03	NA	1.00e-06
3. B	Q9GKW8	Ankyrin repeat and death domain-containing protein 1A (Fragment)	2.01e-04	NA	0.001
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	8.07e-03	NA	0.027
3. B	Q9SCX5	Probable potassium channel AKT5	5.10e-02	NA	1.29e-05
3. B	Q2QLG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.00e-05	NA	1.08e-07
3. B	Q07DV3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.76e-03	NA	1.38e-07
3. B	Q05823	2-5A-dependent ribonuclease	4.97e-04	NA	2.86e-09
3. B	Q8ZWC4	Putative ankyrin repeat protein PAE1861	1.20e-04	NA	1.54e-04
3. B	Q75HP9	Potassium channel AKT2	1.08e-01	NA	8.16e-04
3. B	Q8WMX7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.71e-04	NA	6.31e-09
3. B	Q12013	Probable palmitoyltransferase AKR2	1.02e-02	NA	2.33e-05
3. B	Q5UPG6	Putative ankyrin repeat protein L92	NA	NA	4.71e-07
3. B	Q08E43	Ankyrin repeat and SOCS box protein 8	1.16e-06	NA	4.99e-04
3. B	Q1RHT6	Putative ankyrin repeat protein RBE_0997	5.81e-03	NA	7.79e-05
3. B	B7WN72	Protein shank	2.75e-02	NA	0.012
3. B	Q14678	KN motif and ankyrin repeat domain-containing protein 1	9.62e-02	NA	6.00e-06
3. B	Q9Z205	DNA-binding protein RFXANK	5.00e-08	NA	0.003
3. B	Q9ULT8	E3 ubiquitin-protein ligase HECTD1	9.92e-01	NA	4.30e-06
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.98e-01	NA	0.003
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	1.93e-03	NA	0.019
3. B	Q01484	Ankyrin-2	NA	NA	2.27e-06
3. B	Q9UK73	Protein fem-1 homolog B	2.40e-04	NA	6.09e-09
3. B	Q9VUW9	Palmitoyltransferase Hip14	5.85e-03	NA	2.21e-04
3. B	Q9UPS8	Ankyrin repeat domain-containing protein 26	1.06e-01	NA	0.002
3. B	Q2QLH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.61e-05	NA	1.34e-09
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	1.85e-03	NA	0.005
3. B	Q96Q27	Ankyrin repeat and SOCS box protein 2	8.05e-04	NA	2.84e-04
3. B	Q9J513	Putative ankyrin repeat protein FPV222	NA	NA	5.80e-07
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	4.87e-02	NA	6.01e-05
3. B	Q9U518	L-asparaginase	7.10e-03	NA	0.015
3. B	Q6NLQ8	E3 ubiquitin-protein ligase XBAT32	1.76e-03	NA	0.042
3. B	Q9J508	Putative ankyrin repeat protein FPV227	NA	NA	0.005
3. B	Q9Y283	Inversin	1.34e-01	NA	7.42e-08
3. B	Q4UKI1	Putative ankyrin repeat protein RF_1099	5.07e-04	NA	1.34e-04
3. B	A4D7T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.50e-05	NA	7.92e-11
3. B	Q495B1	Ankyrin repeat and death domain-containing protein 1A	2.09e-05	NA	0.007
3. B	Q9M8S6	Potassium channel SKOR	1.63e-02	NA	0.005
3. B	Q9ULH0	Kinase D-interacting substrate of 220 kDa	7.63e-01	NA	1.68e-08
3. B	G3I6Z6	Neurogenic locus notch homolog protein 1	NA	NA	4.02e-04
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	5.87e-06	NA	2.04e-04
3. B	Q9C0D5	Protein TANC1	2.24e-01	NA	1.76e-10
3. B	P14360	Putative ankyrin repeat protein FPV240	NA	NA	0.030
3. B	O70445	BRCA1-associated RING domain protein 1	5.11e-01	NA	0.003
3. B	Q9Z1P7	KN motif and ankyrin repeat domain-containing protein 3	3.90e-01	NA	2.14e-07
3. B	Q5BKI6	Ankyrin repeat domain-containing protein 1	4.88e-04	NA	0.005
3. B	Q09YK6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.07e-05	NA	1.09e-08
3. B	Q5UPG5	Putative ankyrin repeat protein L93	NA	NA	1.71e-14
3. B	Q86SG2	Ankyrin repeat domain-containing protein 23	4.36e-05	NA	1.29e-05
3. B	Q9WV72	Ankyrin repeat and SOCS box protein 3	2.57e-03	NA	8.62e-05
3. B	Q91WK7	Ankyrin repeat domain-containing protein 54	1.01e-05	NA	4.17e-05
3. B	Q876L4	Probable palmitoyltransferase AKR2	8.83e-03	NA	0.007
3. B	Q07DZ5	Cortactin-binding protein 2	6.64e-01	NA	3.66e-06
3. B	Q5U2S6	Ankyrin repeat and SOCS box protein 2	1.64e-03	NA	4.05e-04
3. B	Q09YN0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.92e-05	NA	1.03e-10
3. B	D3YZU1	SH3 and multiple ankyrin repeat domains protein 1	5.38e-01	NA	4.69e-07
3. B	Q92527	Ankyrin repeat domain-containing protein 7	1.95e-06	NA	0.002
3. B	Q876L5	Palmitoyltransferase AKR1	1.17e-02	NA	0.008
3. B	Q60J38	Ankyrin repeat and KH domain-containing protein CBG24701	5.26e-01	NA	4.65e-06
3. B	P16157	Ankyrin-1	9.02e-01	NA	0.020
3. B	Q5VUR7	Putative ankyrin repeat domain-containing protein 20A3	5.80e-02	NA	0.001
3. B	Q502M6	Ankyrin repeat domain-containing protein 29	4.55e-06	NA	0.002
3. B	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	5.25e-03	NA	0.003
3. B	Q6S8J3	POTE ankyrin domain family member E	2.87e-02	NA	6.12e-05
3. B	D3ZD05	KN motif and ankyrin repeat domain-containing protein 2	3.76e-01	NA	2.07e-05
3. B	Q8T2Q0	Putative ZDHHC-type palmitoyltransferase 6	6.19e-02	NA	2.19e-04
3. B	Q0VGY8	Protein TANC1	4.80e-02	NA	1.03e-10
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	8.45e-02	NA	1.16e-04
3. B	B2RXR6	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	2.78e-03	NA	0.005
3. B	Q502K3	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	5.14e-02	NA	2.64e-06
3. B	Q3TPE9	Ankyrin repeat and MYND domain-containing protein 2	2.79e-02	NA	7.07e-04
3. B	Q66H07	Fibronectin type 3 and ankyrin repeat domains 1 protein	2.86e-06	NA	3.63e-08
3. B	Q7M6U3	Inactive serine/threonine-protein kinase TEX14	5.58e-01	NA	8.01e-04
3. B	Q9EP71	Ankycorbin	9.95e-03	NA	1.35e-07
3. B	Q9FIT8	ADP-ribosylation factor GTPase-activating protein AGD1	2.59e-01	NA	0.019
3. B	Q2QLB3	Cortactin-binding protein 2	8.15e-01	NA	7.74e-06
3. B	Q8HYY4	Uveal autoantigen with coiled-coil domains and ankyrin repeats protein	2.49e-02	NA	3.86e-05
3. B	Q05753	Ankyrin repeat domain-containing protein, chloroplastic	5.76e-06	NA	0.002
3. B	Q9Y566	SH3 and multiple ankyrin repeat domains protein 1	2.71e-01	NA	4.05e-07
3. B	Q09655	G patch domain and ankyrin repeat-containing protein 1 homolog	2.15e-02	NA	0.003
3. B	Q653P0	Potassium channel KOR1	2.59e-02	NA	0.009
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	5.28e-01	NA	1.24e-04
3. B	Q6UB99	Ankyrin repeat domain-containing protein 11	3.38e-01	NA	1.04e-04
3. B	Q2IBG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.69e-05	NA	5.69e-10
3. B	Q9J5I3	Putative ankyrin repeat protein FPV018	NA	NA	1.53e-06
3. B	Q6P1S6	Myotrophin	1.08e-08	NA	1.06e-04
3. B	Q8MJ49	Osteoclast-stimulating factor 1	5.12e-06	NA	2.19e-04
3. B	Q3SX45	Ankyrin repeat and SOCS box protein 2	1.64e-03	NA	2.63e-04
3. B	C7B178	Protein VAPYRIN	1.50e-03	NA	1.41e-08
3. B	Q08DV6	Ankyrin repeat and SOCS box protein 3	2.68e-03	NA	0.001
3. B	Q09103	Eye-specific diacylglycerol kinase	6.28e-01	NA	8.94e-06
3. B	Q76K24	Ankyrin repeat domain-containing protein 46	7.82e-06	NA	1.12e-04
3. B	Q4V8X4	Acyl-CoA-binding domain-containing protein 6	2.46e-05	NA	1.23e-04
3. B	Q5R4M7	Ankyrin repeat and SOCS box protein 6	2.15e-05	NA	0.011
3. B	Q71S21	Inversin-B	3.83e-01	NA	4.36e-04
3. B	Q09YI1	Cortactin-binding protein 2	5.21e-01	NA	3.72e-07
3. B	Q7Z020	Transient receptor potential cation channel subfamily A member 1	8.44e-03	NA	0.015
3. B	Q6DGX3	Ankyrin repeat domain-containing protein 54	8.09e-06	NA	2.48e-05
3. B	Q5JPF3	Ankyrin repeat domain-containing protein 36C	3.06e-02	NA	0.001
3. B	Q9P0K7	Ankycorbin	9.72e-03	NA	4.64e-07
3. B	Q4P6L3	Palmitoyltransferase AKR1	1.66e-02	NA	0.008
3. B	Q8N6D5	Ankyrin repeat domain-containing protein 29	4.89e-06	NA	0.001
3. B	Q9J4Z5	Putative ankyrin repeat protein FPV245	NA	NA	9.71e-06
3. B	Q5RFS1	Ankyrin repeat and SOCS box protein 11	9.63e-06	NA	0.013
3. B	Q6P9Z4	Protein fem-1 homolog A	1.33e-04	NA	5.46e-08
3. B	Q5DU14	Unconventional myosin-XVI	9.36e-01	NA	0.001
3. B	E5RJM6	Ankyrin repeat domain-containing protein 65	4.14e-04	NA	1.22e-04
3. B	Q108U1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.09e-05	NA	3.04e-08
3. B	Q9GZV1	Ankyrin repeat domain-containing protein 2	2.38e-04	NA	5.25e-05
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	5.04e-02	NA	6.23e-04
3. B	Q86YR6	POTE ankyrin domain family member D	1.66e-03	NA	2.28e-05
3. B	Q3SX00	Ankyrin repeat domain-containing protein 46	7.69e-06	NA	3.71e-04
3. B	Q2IBB1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.49e-05	NA	5.78e-09
3. B	Q60649	Caseinolytic peptidase B protein homolog	1.21e-04	NA	5.27e-04
3. B	Q923M0	Protein phosphatase 1 regulatory subunit 16A	3.09e-03	NA	0.003
3. B	Q8VHQ3	Protein phosphatase 1 regulatory inhibitor subunit 16B	3.02e-01	NA	0.005
3. B	Q99PE2	Ankyrin repeat family A protein 2	8.73e-08	NA	3.90e-05
3. B	Q7ZYG4	Osteoclast-stimulating factor 1	5.48e-06	NA	8.33e-04
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	7.21e-01	NA	5.65e-04
3. B	Q07E28	Cortactin-binding protein 2	7.02e-01	NA	5.47e-09
3. B	Q5H9F3	BCL-6 corepressor-like protein 1	8.79e-01	NA	0.001
3. B	Q28BK1	E3 ubiquitin-protein ligase HACE1	9.37e-02	NA	0.007
3. B	Q9J5I7	Putative ankyrin repeat protein FPV014	NA	NA	4.16e-05
3. B	Q5TYW2	Ankyrin repeat domain-containing protein 20A1	3.44e-02	NA	0.001
3. B	H3BUK9	POTE ankyrin domain family member B2	7.08e-04	NA	3.17e-06
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.60e-02	NA	0.015
3. B	Q09YI3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.98e-05	NA	6.18e-10
3. B	A0M8T5	Cortactin-binding protein 2	6.13e-01	NA	6.17e-09
3. B	Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	2.31e-02	NA	5.05e-05
3. B	Q9DAM9	Fibronectin type 3 and ankyrin repeat domains 1 protein	2.00e-06	NA	1.39e-07
3. B	Q8N283	Ankyrin repeat domain-containing protein 35	1.73e-01	NA	8.55e-07
3. B	Q5ZM55	Protein fem-1 homolog B	2.51e-04	NA	1.81e-09
3. B	Q2KI79	Ankyrin repeat family A protein 2	2.58e-06	NA	3.28e-05
3. B	Q8WXH4	Ankyrin repeat and SOCS box protein 11	4.76e-06	NA	0.010
3. B	Q07E15	Cortactin-binding protein 2	7.21e-01	NA	3.44e-07
3. B	A6QPE7	Ankyrin repeat domain-containing protein 65	7.03e-04	NA	1.14e-06
3. B	P55272	Cyclin-dependent kinase 4 inhibitor B	2.83e-08	NA	7.39e-05
3. B	Q94A76	Potassium channel GORK	1.58e-02	NA	4.46e-04
3. B	Q810B6	Rabankyrin-5	3.32e-02	NA	0.001
3. B	A0A1D8PNZ7	Glycerophosphocholine phosphodiesterase GDE1	2.52e-01	NA	0.003
3. B	Q9J517	Putative ankyrin repeat protein FPV218	NA	NA	8.50e-04
3. B	Q8Q0U0	Putative ankyrin repeat protein MM_0045	1.83e-07	NA	8.25e-11
3. B	Q09YJ3	Cortactin-binding protein 2	9.37e-01	NA	4.09e-07
3. B	Q8VHS5	Ankyrin repeat and SOCS box protein 16	2.89e-05	NA	5.36e-07
3. B	Q12955	Ankyrin-3	NA	NA	5.01e-06
3. B	Q6TNT2	Ankyrin repeat domain-containing protein 46	4.31e-06	NA	1.37e-04
3. B	Q8C0T1	Protein fem-1 homolog A-B	1.07e-02	NA	0.022
3. B	Q2QL82	Cortactin-binding protein 2	5.10e-01	NA	1.02e-06
3. B	Q38998	Potassium channel AKT1	1.59e-01	NA	0.003
3. B	Q80TN5	Palmitoyltransferase ZDHHC17	1.45e-04	NA	0.008
3. B	C9JTQ0	Ankyrin repeat domain-containing protein 63	7.89e-05	NA	6.46e-10
3. B	P20749	B-cell lymphoma 3 protein	1.49e-03	NA	0.011
3. B	Q5VYY1	Ankyrin repeat domain-containing protein 22	5.89e-09	NA	0.001
3. B	Q755Y0	Palmitoyltransferase AKR1	9.90e-03	NA	1.75e-04
3. B	Q6XJU9	Osteoclast-stimulating factor 1	1.44e-09	NA	0.002
3. B	Q9XX14	Arf-GAP with ANK repeat and PH domain-containing protein cnt-2	7.99e-01	NA	0.002
3. B	Q6P686	Osteoclast-stimulating factor 1	4.46e-06	NA	3.63e-04
3. B	B8N0E6	Ankyrin-repeat domain containing transcription coregulator asaA	3.85e-01	NA	1.13e-04
3. B	Q4UKX2	Putative ankyrin repeat protein RF_0950	1.47e-03	NA	1.55e-04
3. B	Q5M9H0	Ankyrin repeat and SAM domain-containing protein 3	2.78e-03	NA	4.76e-09
3. B	O75832	26S proteasome non-ATPase regulatory subunit 10	1.18e-06	NA	6.16e-04
3. B	Q8VD46	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.25e-05	NA	4.29e-09
3. B	Q9CQM6	Ankyrin repeat domain-containing protein 61	1.12e-05	NA	7.98e-04
3. B	Q2IBB4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.29e-05	NA	1.89e-09
3. B	Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3	4.55e-02	NA	1.88e-05
3. B	Q6NY19	KN motif and ankyrin repeat domain-containing protein 3	1.47e-02	NA	7.53e-08
3. B	A0M8S4	Cortactin-binding protein 2	7.79e-01	NA	6.02e-05
3. B	Q8GXE6	Potassium channel AKT6	4.00e-02	NA	2.74e-05
3. B	A0A140LI88	Ankyrin repeat domain-containing protein 31	1.92e-01	NA	2.16e-05
3. B	Q5E9N5	Caseinolytic peptidase B protein homolog	3.65e-04	NA	0.001
3. B	Q09YK4	Cortactin-binding protein 2	6.29e-01	NA	4.42e-07
3. B	Q8C8R3	Ankyrin-2	NA	NA	3.03e-06
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	7.31e-02	NA	0.005
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	4.95e-04	NA	0.001
3. B	Q6F6B3	Protein TANC1	6.10e-01	NA	1.32e-09
3. B	Q86W74	Ankyrin repeat domain-containing protein 46	7.32e-06	NA	3.71e-04
3. B	E9Q4F7	Ankyrin repeat domain-containing protein 11	4.06e-01	NA	1.03e-04
3. B	Q8WWH4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.94e-05	NA	1.72e-08
3. B	Q07DY6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.04e-05	NA	4.12e-10
3. B	Q1RJN6	Putative ankyrin repeat protein RBE_0347	9.63e-06	NA	3.58e-05
3. B	P40480	Protein HOS4	1.87e-01	NA	5.10e-08
3. B	Q9H9E1	Ankyrin repeat family A protein 2	8.68e-08	NA	4.98e-05
3. B	Q6NXT1	Ankyrin repeat domain-containing protein 54	6.67e-06	NA	7.83e-06
3. B	Q5T7N3	KN motif and ankyrin repeat domain-containing protein 4	4.98e-01	NA	4.03e-06
3. B	Q9QZH2	BRCA1-associated RING domain protein 1	3.08e-01	NA	0.005
3. B	Q7ZT11	Ankyrin repeat domain-containing protein 1	4.27e-04	NA	2.46e-05
3. B	Q07E43	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.91e-05	NA	5.21e-09
3. B	Q9VFD5	Protein fem-1 homolog CG6966	2.55e-03	NA	1.12e-06
3. B	Q8TC84	Fibronectin type 3 and ankyrin repeat domains protein 1	1.25e-05	NA	7.73e-08
3. B	Q9BZL4	Protein phosphatase 1 regulatory subunit 12C	1.25e-01	NA	0.001
3. B	Q99728	BRCA1-associated RING domain protein 1	4.42e-01	NA	0.003
3. B	Q2T9W8	Ankyrin repeat domain-containing protein 61	1.07e-05	NA	0.019
3. B	Q2IBA2	Cortactin-binding protein 2	7.82e-01	NA	5.97e-05
3. B	Q6S8J7	POTE ankyrin domain family member A	1.57e-02	NA	1.32e-06
3. B	Q3UMR0	Ankyrin repeat domain-containing protein 27	9.25e-02	NA	1.83e-04
3. B	Q07008	Neurogenic locus notch homolog protein 1	5.68e-01	NA	3.63e-04
3. B	Q812A3	Ankyrin repeat domain-containing protein 23	5.49e-06	NA	0.006
3. B	Q9H078	Caseinolytic peptidase B protein homolog	4.52e-03	NA	0.003
3. B	Q9VL06	E3 ubiquitin-protein ligase Ufd4	NA	NA	1.67e-05
3. B	Q07DY4	Cortactin-binding protein 2	6.21e-01	NA	5.38e-05
3. B	Q811D2	Ankyrin repeat domain-containing protein 26	9.28e-02	NA	0.002
3. B	Q876A6	Palmitoyltransferase AKR1	1.10e-02	NA	5.14e-04
3. B	Q9HCD6	Protein TANC2	1.92e-01	NA	2.33e-12
3. B	A1X157	Cortactin-binding protein 2	3.31e-01	NA	2.93e-06
3. B	Q9D3J5	Ankyrin repeat domain-containing protein 22	1.38e-08	NA	0.001
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	7.28e-01	NA	1.06e-04
3. B	Q9GL21	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.14e-02	NA	5.00e-05
3. B	Q6S545	POTE ankyrin domain family member H	6.95e-02	NA	2.09e-04
3. B	Q1RK13	Putative ankyrin repeat protein RBE_0220	4.10e-02	NA	2.38e-08
3. B	Q5UPF8	Putative ankyrin repeat protein L88	NA	NA	2.58e-11
3. B	Q96KQ7	Histone-lysine N-methyltransferase EHMT2	6.96e-01	NA	2.47e-05
3. B	Q2QLF8	Cortactin-binding protein 2	5.11e-01	NA	3.20e-06
3. B	Q2IBF7	Cortactin-binding protein 2	6.09e-01	NA	4.35e-06
3. B	Q71S22	Inversin-A	6.71e-02	NA	1.69e-05
3. B	Q92882	Osteoclast-stimulating factor 1	4.59e-06	NA	8.88e-04
3. B	Q9JLU4	SH3 and multiple ankyrin repeat domains protein 3	7.73e-02	NA	5.75e-05
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	5.91e-06	NA	2.04e-04
3. B	Q5UPV1	Putative ankyrin repeat protein L271	NA	NA	1.40e-06
3. B	A0M8T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.20e-05	NA	7.44e-10
3. B	A2A2Z9	Ankyrin repeat domain-containing protein 18B	2.65e-03	NA	1.06e-04
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	5.07e-02	NA	1.64e-08
3. B	P53355	Death-associated protein kinase 1	1.66e-01	NA	0.002
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	8.29e-02	NA	0.004
3. B	Q9J5H7	Putative ankyrin repeat protein FPV024	NA	NA	3.41e-04
3. B	Q09701	Palmitoyltransferase akr1	9.84e-05	NA	0.006
3. B	Q8WXI3	Ankyrin repeat and SOCS box protein 10	2.99e-05	NA	0.028
3. B	Q01705	Neurogenic locus notch homolog protein 1	5.92e-01	NA	3.85e-04
3. B	Q9Z2G1	Protein fem-1 homolog A-A	5.05e-03	NA	0.035
3. B	P0C550	Potassium channel AKT1	5.31e-02	NA	6.66e-04
3. B	X1WE18	KN motif and ankyrin repeat domain-containing protein 2	4.96e-01	NA	9.00e-06
3. B	G5EGA3	Ankyrin repeat and LEM domain-containing protein 1 homolog	1.79e-02	NA	5.07e-04
3. B	Q8TF27	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11	3.67e-01	NA	0.027
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	8.05e-02	NA	7.66e-04
3. B	Q875S9	Palmitoyltransferase AKR1	9.14e-03	NA	0.009
3. B	P0CS66	Palmitoyltransferase AKR1	8.41e-04	NA	0.011
3. B	Q6B858	Fibronectin type 3 and ankyrin repeat domains protein 1	1.27e-05	NA	6.02e-07
3. B	Q8WXK1	Ankyrin repeat and SOCS box protein 15	4.47e-03	NA	0.005
3. B	Q2IBF8	Cortactin-binding protein 2	8.88e-01	NA	2.49e-06
3. B	Q2T9K6	Protein fem-1 homolog C	1.47e-04	NA	3.13e-08
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	3.33e-02	NA	3.83e-09
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.62e-01	NA	4.16e-04
3. B	Q0VCS9	Ankyrin repeat and MYND domain-containing protein 2	8.53e-05	NA	0.035
3. B	P0C927	Ankyrin repeat and SOCS box protein 14	3.72e-03	NA	0.013
3. B	Q5REW9	Ankyrin repeat domain-containing protein 27	1.53e-02	NA	9.33e-06
3. B	Q07DX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.55e-05	NA	9.50e-08
3. B	G3V8T1	M-phase phosphoprotein 8	3.57e-01	NA	5.12e-08
3. B	Q9Y6X6	Unconventional myosin-XVI	8.15e-01	NA	5.65e-04
3. B	Q6JAN1	Inversin	5.91e-02	NA	8.34e-08
3. B	F4IS56	Integrin-linked protein kinase 1	2.62e-02	NA	0.017
3. B	Q5RJK8	Acyl-CoA-binding domain-containing protein 6	1.15e-05	NA	0.004
3. B	P46531	Neurogenic locus notch homolog protein 1	3.71e-01	NA	8.39e-04
3. B	Q2IBE6	Cortactin-binding protein 2	3.74e-01	NA	3.51e-06
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	1.02e-01	NA	4.49e-04
3. B	Q4V869	Acyl-CoA-binding domain-containing protein 6	2.51e-05	NA	0.001
3. B	Q09YG9	Cortactin-binding protein 2	8.80e-01	NA	4.70e-06
3. B	Q8HXA6	Ankyrin repeat and SOCS box protein 15	4.76e-03	NA	0.046
3. B	Q2QLA4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.21e-05	NA	1.01e-09
3. B	Q91ZU1	Ankyrin repeat and SOCS box protein 6	1.95e-05	NA	0.025
3. B	P39010	Palmitoyltransferase AKR1	1.16e-02	NA	0.009
3. B	Q52T38	Protein S-acyltransferase 24	2.42e-04	NA	5.07e-05
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	5.08e-04	NA	6.71e-04
3. B	Q9C6C3	ADP-ribosylation factor GTPase-activating protein AGD2	2.99e-01	NA	4.73e-06
3. B	Q96JP0	Protein fem-1 homolog C	9.48e-04	NA	1.52e-07
3. B	Q9FY48	E3 ubiquitin-protein ligase KEG	8.57e-02	NA	6.01e-06
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	4.41e-01	NA	7.03e-04
3. B	Q8WZ74	Cortactin-binding protein 2	8.70e-01	NA	4.47e-06
3. B	Q3EC11	Probable protein S-acyltransferase 23	8.29e-05	NA	0.049
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	3.11e-03	NA	0.013
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	3.51e-04	NA	0.023
3. B	Q8BLD6	Ankyrin repeat domain-containing protein 55	1.12e-02	NA	0.002
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	2.17e-01	NA	1.89e-04
3. B	Q9VBP3	Poly [ADP-ribose] polymerase tankyrase	1.34e-02	NA	1.26e-04
3. B	Q9SMX5	ADP-ribosylation factor GTPase-activating protein AGD4	3.03e-01	NA	9.36e-06
3. B	Q6DCL5	E3 ubiquitin-protein ligase HACE1	8.11e-02	NA	0.007
3. B	Q1LZH7	KN motif and ankyrin repeat domain-containing protein 2	3.18e-01	NA	3.54e-07
3. B	Q9BR61	Acyl-CoA-binding domain-containing protein 6	1.10e-05	NA	0.001
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	8.00e-02	NA	1.76e-05
3. B	A7E2S9	Putative ankyrin repeat domain-containing protein 30B-like	1.13e-04	NA	1.98e-07