Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0C595
(Dual specificity phosphatase 29) with a FATCAT P-Value: 0.0 and RMSD of 1.25 angstrom. The sequence alignment identity is 46.1%.
Structural alignment shown in left. Query protein Q6B8I1 colored as red in alignment, homolog P0C595 colored as blue.
Query protein Q6B8I1 is also shown in right top, homolog P0C595 showed in right bottom. They are colored based on secondary structures.
Q6B8I1 MA----ETSL----P---EL------G-GEDKATPC-PSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLY-CQGG 80 P0C595 MASGDTKTSVKHAHPCAERLSLQQEEGEAEDY---CTPGAFELERLFWKGSPQYTHVNEVWPRLHVGDEATALDRYGLQKAGFTHVLNAAH-GRWNVDTG 96 Q6B8I1 PDFYGS-SVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLD 179 P0C595 PDYYRDMAIEYHGVEADDVPTFDLSIFFYSAAAFIDSALQDDHSKILVHCAMGRSRSATLVLAYLMIHKNMTLVDAIQQVAKNRCVLPNRGFLKQLRELD 196 Q6B8I1 QQL---R-----GAGQS-- 188 P0C595 KQLVKQRRQAGPGAGELGL 215
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0034051 | negative regulation of plant-type hypersensitive response |
| 1. PB | GO:1900424 | regulation of defense response to bacterium |
| 1. PB | GO:1990782 | protein tyrosine kinase binding |
| 1. PB | GO:0050860 | negative regulation of T cell receptor signaling pathway |
| 1. PB | GO:0001691 | pseudophosphatase activity |
| 1. PB | GO:0000196 | cell wall integrity MAPK cascade |
| 1. PB | GO:0016311 | dephosphorylation |
| 1. PB | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 1. PB | GO:0004725 | protein tyrosine phosphatase activity |
| 1. PB | GO:0042692 | muscle cell differentiation |
| 1. PB | GO:0004860 | protein kinase inhibitor activity |
| 1. PB | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 1. PB | GO:0043405 | regulation of MAP kinase activity |
| 1. PB | GO:0045785 | positive regulation of cell adhesion |
| 1. PB | GO:0051893 | regulation of focal adhesion assembly |
| 1. PB | GO:0004722 | protein serine/threonine phosphatase activity |
| 1. PB | GO:0030336 | negative regulation of cell migration |
| 1. PB | GO:0106307 | |
| 1. PB | GO:0008579 | JUN kinase phosphatase activity |
| 1. PB | GO:0043508 | negative regulation of JUN kinase activity |
| 1. PB | GO:0033549 | MAP kinase phosphatase activity |
| 1. PB | GO:1990444 | F-box domain binding |
| 1. PB | GO:0006470 | protein dephosphorylation |
| 1. PB | GO:0030295 | protein kinase activator activity |
| 1. PB | GO:0035335 | peptidyl-tyrosine dephosphorylation |
| 1. PB | GO:0006655 | phosphatidylglycerol biosynthetic process |
| 1. PB | GO:0002039 | p53 binding |
| 1. PB | GO:0008138 | protein tyrosine/serine/threonine phosphatase activity |
| 1. PB | GO:0004439 | phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity |
| 1. PB | GO:1902310 | positive regulation of peptidyl-serine dephosphorylation |
| 1. PB | GO:0120183 | positive regulation of focal adhesion disassembly |
| 1. PB | GO:0016791 | phosphatase activity |
| 1. PB | GO:0043409 | negative regulation of MAPK cascade |
| 1. PB | GO:0046838 | phosphorylated carbohydrate dephosphorylation |
| 1. PB | GO:0006626 | protein targeting to mitochondrion |
| 1. PB | GO:0046330 | positive regulation of JNK cascade |
| 1. PB | GO:0005078 | MAP-kinase scaffold activity |
| 1. PB | GO:2001242 | regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:0031304 | intrinsic component of mitochondrial inner membrane |
| 1. PB | GO:0062026 | negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process |
| 1. PB | GO:0033365 | protein localization to organelle |
| 1. PB | GO:0017017 | MAP kinase tyrosine/serine/threonine phosphatase activity |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0046329 | negative regulation of JNK cascade |
| 1. PB | GO:0008092 | cytoskeletal protein binding |
| 1. PB | GO:1990264 | peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity |
| 1. PB | GO:0004721 | phosphoprotein phosphatase activity |
| 1. PB | GO:0008962 | phosphatidylglycerophosphatase activity |
| 1. PB | GO:0071364 | cellular response to epidermal growth factor stimulus |
| 1. PB | GO:0042593 | glucose homeostasis |
| 1. PB | GO:0001772 | immunological synapse |
| 1. PB | GO:0031435 | mitogen-activated protein kinase kinase kinase binding |
| 1. PB | GO:1903138 | negative regulation of cell wall integrity MAPK cascade |
| 1. PB | GO:0051019 | mitogen-activated protein kinase binding |
| 1. PB | GO:0042059 | negative regulation of epidermal growth factor receptor signaling pathway |
| 1. PB | GO:0050868 | negative regulation of T cell activation |
| 1. PB | GO:0070373 | negative regulation of ERK1 and ERK2 cascade |
| 1. PB | GO:0039563 | suppression by virus of host JAK-STAT cascade via inhibition of STAT1 activity |
| 1. PB | GO:0030971 | receptor tyrosine kinase binding |
| 1. PB | GO:0005983 | starch catabolic process |
| 1. PB | GO:0031314 | extrinsic component of mitochondrial inner membrane |
| 1. PB | GO:0000188 | obsolete inactivation of MAPK activity |
| 1. PB | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 1. PB | GO:0033550 | MAP kinase tyrosine phosphatase activity |
| 1. PB | GO:0045204 | MAPK export from nucleus |
| 1. PB | GO:0045931 | positive regulation of mitotic cell cycle |
| 1. PB | GO:0050308 | sugar-phosphatase activity |
| 1. PB | GO:0039502 | suppression by virus of host type I interferon-mediated signaling pathway |
| 1. PB | GO:0019203 | carbohydrate phosphatase activity |
| 1. PB | GO:0004647 | |
| 1. PB | GO:0043507 | positive regulation of JUN kinase activity |
| 1. PB | GO:0044387 | negative regulation of protein kinase activity by regulation of protein phosphorylation |
| 1. PB | GO:0051726 | regulation of cell cycle |
| 1. PB | GO:0106306 | |
| 1. PB | GO:0050922 | negative regulation of chemotaxis |
| 1. PB | GO:0035970 | peptidyl-threonine dephosphorylation |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:1990830 | cellular response to leukemia inhibitory factor |
| 2. P | GO:0010193 | response to ozone |
| 2. P | GO:0009898 | cytoplasmic side of plasma membrane |
| 2. P | GO:0043542 | endothelial cell migration |
| 2. P | GO:0030430 | host cell cytoplasm |
| 2. P | GO:0052845 | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| 2. P | GO:0005769 | early endosome |
| 2. P | GO:0005819 | spindle |
| 2. P | GO:0005743 | mitochondrial inner membrane |
| 2. P | GO:0005758 | mitochondrial intermembrane space |
| 2. P | GO:0007219 | Notch signaling pathway |
| 2. P | GO:0035002 | liquid clearance, open tracheal system |
| 2. P | GO:0000323 | lytic vacuole |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0004727 | prenylated protein tyrosine phosphatase activity |
| 2. P | GO:0020016 | ciliary pocket |
| 2. P | GO:0031910 | cytostome |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:0043117 | positive regulation of vascular permeability |
| 2. P | GO:0052847 | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| 2. P | GO:0032991 | protein-containing complex |
| 2. P | GO:1900746 | regulation of vascular endothelial growth factor signaling pathway |
| 2. P | GO:0008486 | diphosphoinositol-polyphosphate diphosphatase activity |
| 2. P | GO:1904951 | positive regulation of establishment of protein localization |
| 2. P | GO:0071244 | cellular response to carbon dioxide |
| 2. P | GO:0006612 | protein targeting to membrane |
| 2. P | GO:0020023 | kinetoplast |
| 2. P | GO:0106211 | inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity |
| 2. P | GO:0031305 | integral component of mitochondrial inner membrane |
| 2. P | GO:0046855 | inositol phosphate dephosphorylation |
| 2. P | GO:0006469 | negative regulation of protein kinase activity |
| 2. P | GO:0007049 | cell cycle |
| 2. P | GO:0034599 | cellular response to oxidative stress |
| 2. P | GO:0032049 | cardiolipin biosynthetic process |
| 2. P | GO:0061179 | negative regulation of insulin secretion involved in cellular response to glucose stimulus |
| 2. P | GO:0030335 | positive regulation of cell migration |
| 2. P | GO:0071543 | diphosphoinositol polyphosphate metabolic process |
| 2. P | GO:1900150 | regulation of defense response to fungus |
| 2. P | GO:0031434 | mitogen-activated protein kinase kinase binding |
| 2. P | GO:0050355 | triphosphatase activity |
| 2. P | GO:0045860 | positive regulation of protein kinase activity |
| 2. P | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0048364 | root development |
| 3. B | GO:1903753 | negative regulation of p38MAPK cascade |
| 3. B | GO:0050680 | negative regulation of epithelial cell proliferation |
| 3. B | GO:1905042 | negative regulation of epithelium regeneration |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0070848 | response to growth factor |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0045591 | positive regulation of regulatory T cell differentiation |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0061388 | regulation of rate of cell growth |
| 3. B | GO:0010942 | positive regulation of cell death |
| 3. B | GO:0033260 | nuclear DNA replication |
| 3. B | GO:0007254 | JNK cascade |
| 3. B | GO:0008432 | JUN kinase binding |
| 3. B | GO:1903996 | negative regulation of non-membrane spanning protein tyrosine kinase activity |
| 3. B | GO:2001070 | starch binding |
| 3. B | GO:2001066 | amylopectin binding |
| 3. B | GO:0002710 | negative regulation of T cell mediated immunity |
| 3. B | GO:0051321 | meiotic cell cycle |
| 3. B | GO:0048692 | negative regulation of axon extension involved in regeneration |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0031915 | positive regulation of synaptic plasticity |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0048713 | regulation of oligodendrocyte differentiation |
| 3. B | GO:0061851 | leading edge of lamellipodium |
| 3. B | GO:0090266 | regulation of mitotic cell cycle spindle assembly checkpoint |
| 3. B | GO:1904668 | positive regulation of ubiquitin protein ligase activity |
| 3. B | GO:0051270 | regulation of cellular component movement |
| 3. B | GO:0060420 | regulation of heart growth |
| 3. B | GO:0033133 | positive regulation of glucokinase activity |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0005982 | starch metabolic process |
| 3. B | GO:0035160 | maintenance of epithelial integrity, open tracheal system |
| 3. B | GO:0002819 | regulation of adaptive immune response |
| 3. B | GO:0060266 | negative regulation of respiratory burst involved in inflammatory response |
| 3. B | GO:0072327 | vulval cell fate specification |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0000922 | spindle pole |
| 3. B | GO:0072718 | response to cisplatin |
| 3. B | GO:0045209 | MAPK phosphatase export from nucleus, leptomycin B sensitive |
| 3. B | GO:1990275 | preribosome binding |
| 3. B | GO:0062030 | negative regulation of stress granule assembly |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:1990869 | cellular response to chemokine |
| 3. B | GO:0090335 | regulation of brown fat cell differentiation |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0000165 | MAPK cascade |
| 3. B | GO:0032870 | cellular response to hormone stimulus |
| 3. B | GO:0007095 | mitotic G2 DNA damage checkpoint signaling |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0051895 | negative regulation of focal adhesion assembly |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0032154 | cleavage furrow |
| 3. B | GO:0009416 | response to light stimulus |
| 3. B | GO:0070262 | peptidyl-serine dephosphorylation |
| 3. B | GO:0033574 | response to testosterone |
| 3. B | GO:0071318 | cellular response to ATP |
| 3. B | GO:1903854 | negative regulation of stress response to copper ion |
| 3. B | GO:0060258 | negative regulation of filamentous growth |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0051591 | response to cAMP |
| 3. B | GO:0007179 | transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0120277 | positive regulation of cerebral blood circulation |
| 3. B | GO:0000187 | obsolete activation of MAPK activity |
| 3. B | GO:0051384 | response to glucocorticoid |
| 3. B | GO:0072686 | mitotic spindle |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0051447 | negative regulation of meiotic cell cycle |
| 3. B | GO:0014866 | skeletal myofibril assembly |
| 3. B | GO:1901216 | positive regulation of neuron death |
| 3. B | GO:0032467 | positive regulation of cytokinesis |
| 3. B | GO:0051592 | response to calcium ion |
| 3. B | GO:0001706 | endoderm formation |
| 3. B | GO:1904719 | positive regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0000754 | adaptation of signaling pathway by response to pheromone involved in conjugation with cellular fusion |
| 3. B | GO:0032355 | response to estradiol |
| 3. B | GO:0000226 | microtubule cytoskeleton organization |
| 3. B | GO:0071701 | regulation of MAPK export from nucleus |
| 3. B | GO:0048273 | mitogen-activated protein kinase p38 binding |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0007096 | regulation of exit from mitosis |
| 3. B | GO:0043407 | negative regulation of MAP kinase activity |
| 3. B | GO:0032526 | response to retinoic acid |
| 3. B | GO:0098976 | excitatory chemical synaptic transmission |
| 3. B | GO:1904754 | positive regulation of vascular associated smooth muscle cell migration |
| 3. B | GO:0007428 | primary branching, open tracheal system |
| 3. B | GO:0090027 | negative regulation of monocyte chemotaxis |
| 3. B | GO:0000278 | mitotic cell cycle |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:1902636 | kinociliary basal body |
| 3. B | GO:0019900 | kinase binding |
| 3. B | GO:0007162 | negative regulation of cell adhesion |
| 3. B | GO:0004726 | non-membrane spanning protein tyrosine phosphatase activity |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0042542 | response to hydrogen peroxide |
| 3. B | GO:0010633 | negative regulation of epithelial cell migration |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:1990439 | MAP kinase serine/threonine phosphatase activity |
| 3. B | GO:0001933 | negative regulation of protein phosphorylation |
| 3. B | GO:0032268 | regulation of cellular protein metabolic process |
| 3. B | GO:0019838 | growth factor binding |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:0051409 | response to nitrosative stress |
| 3. B | GO:0031941 | filamentous actin |
| 3. B | GO:0030017 | sarcomere |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5UR74 | Putative tyrosine-protein phosphatase R622 | NA | 4.26e-13 | 1.45e-04 |
| 1. PB | Q85297 | Probable dual specificity protein phosphatase H1 homolog | NA | 5.96e-24 | 4.01e-04 |
| 1. PB | Q55E39 | Probable dual specificity protein phosphatase DDB_G0269404 | 7.18e-11 | 1.42e-03 | 1.28e-11 |
| 1. PB | P0C593 | Dual specificity phosphatase 29 | 0.00e+00 | 4.17e-46 | 7.29e-53 |
| 1. PB | Q5U593 | Serine/threonine/tyrosine-interacting protein B | 2.31e-10 | 3.93e-06 | 3.80e-15 |
| 1. PB | Q54R42 | Probable dual specificity protein phosphatase DDB_G0283417 | 1.49e-09 | 6.48e-22 | 2.82e-13 |
| 1. PB | P0C599 | Dual specificity phosphatase 29 | 0.00e+00 | 1.51e-53 | 4.88e-43 |
| 1. PB | A4IHU7 | Dual specificity phosphatase 29 | 0.00e+00 | 3.44e-41 | 8.78e-52 |
| 1. PB | Q4RQD3 | Dual specificity phosphatase 29 | 0.00e+00 | 2.25e-53 | 2.53e-41 |
| 1. PB | Q9QYJ7 | Dual specificity protein phosphatase 13 isoform B | 0.00e+00 | 2.05e-62 | 3.98e-46 |
| 1. PB | Q8K4T5 | Dual specificity protein phosphatase 19 | 1.11e-16 | 6.08e-33 | 1.16e-14 |
| 1. PB | P0C598 | Dual specificity phosphatase 29 | 0.00e+00 | 1.82e-35 | 6.00e-52 |
| 1. PB | P0DOQ5 | Dual specificity protein phosphatase H1 | NA | 1.61e-33 | 3.85e-06 |
| 1. PB | Q9D700 | Dual specificity protein phosphatase 26 | 0.00e+00 | 4.73e-33 | 3.05e-63 |
| 1. PB | Q5R8X2 | Dual specificity protein phosphatase 18 | 9.18e-14 | 3.42e-13 | 1.52e-17 |
| 1. PB | Q29RA3 | Dual specificity phosphatase 29 | 0.00e+00 | 4.72e-59 | 1.59e-45 |
| 1. PB | Q9SRK5 | Phosphoglucan phosphatase LSF2, chloroplastic | 8.85e-06 | 3.52e-05 | 0.018 |
| 1. PB | O95147 | Dual specificity protein phosphatase 14 | 8.62e-14 | 4.39e-13 | 1.17e-20 |
| 1. PB | Q5R6H6 | Dual specificity protein phosphatase 26 | 0.00e+00 | 4.56e-31 | 4.93e-64 |
| 1. PB | P07239 | Dual specificity protein phosphatase H1 | NA | 1.95e-35 | 5.72e-06 |
| 1. PB | Q8WTR2 | Dual specificity protein phosphatase 19 | 7.83e-12 | 2.39e-31 | 1.96e-16 |
| 1. PB | Q9M8K7 | Dual specificity protein phosphatase 1B | 1.42e-14 | 2.59e-43 | 2.46e-21 |
| 1. PB | Q6AXW7 | Dual specificity protein phosphatase 18 | 4.24e-14 | 4.75e-03 | 2.18e-17 |
| 1. PB | Q9D7X3 | Dual specificity protein phosphatase 3 | 0.00e+00 | 1.14e-48 | 2.69e-43 |
| 1. PB | O10273 | Tyrosine-protein phosphatase 2 | NA | 2.33e-19 | 0.002 |
| 1. PB | P40479 | Dual-specificity protein phosphatase SDP1 | 1.15e-10 | 2.07e-27 | 2.75e-06 |
| 1. PB | Q9JLY7 | Dual specificity protein phosphatase 14 | 2.46e-13 | 1.61e-13 | 1.40e-20 |
| 1. PB | P80994 | Probable dual specificity protein phosphatase H1 homolog | NA | 1.16e-35 | 4.83e-06 |
| 1. PB | O55737 | Putative tyrosine phosphatase 123R | NA | 4.19e-11 | 1.80e-13 |
| 1. PB | Q4G0W2 | Dual specificity phosphatase 28 | 2.82e-10 | 4.30e-19 | 1.32e-15 |
| 1. PB | Q17QM8 | Dual specificity protein phosphatase 14 | 9.03e-14 | 1.23e-13 | 1.14e-20 |
| 1. PB | Q4KL92 | Dual specificity phosphatase 29 | 0.00e+00 | 2.46e-43 | 5.90e-53 |
| 1. PB | Q39491 | Dual specificity protein phosphatase | 6.92e-09 | 3.17e-11 | 5.91e-15 |
| 1. PB | P0C5A1 | Dual specificity phosphatase 29 | 0.00e+00 | 1.66e-48 | 5.37e-45 |
| 1. PB | P0C596 | Dual specificity phosphatase 29 | 0.00e+00 | 9.59e-43 | 1.52e-51 |
| 1. PB | Q6B8I0 | Dual specificity protein phosphatase 13 isoform A | 0.00e+00 | 1.79e-111 | 4.28e-122 |
| 1. PB | P0C592 | Dual specificity phosphatase 29 | 0.00e+00 | 1.55e-49 | 5.22e-55 |
| 1. PB | P0C5A2 | Dual specificity phosphatase 29 | 0.00e+00 | 3.51e-37 | 2.05e-46 |
| 1. PB | Q60969 | Serine/threonine/tyrosine-interacting protein | 4.00e-10 | 3.95e-08 | 1.12e-12 |
| 1. PB | Q8WUJ0 | Serine/threonine/tyrosine-interacting protein | 4.80e-10 | 5.27e-08 | 1.03e-12 |
| 1. PB | Q17QJ3 | Dual specificity protein phosphatase 26 | 0.00e+00 | 1.93e-41 | 1.25e-63 |
| 1. PB | Q5BIP9 | Dual specificity protein phosphatase 18 | 3.89e-10 | 8.18e-14 | 2.44e-15 |
| 1. PB | Q9EMX1 | Putative tyrosine-protein phosphatase AMV078 | NA | 9.37e-13 | 4.35e-10 |
| 1. PB | Q8VE01 | Dual specificity protein phosphatase 18 | 3.95e-12 | 1.45e-13 | 2.00e-17 |
| 1. PB | P0DOQ6 | Dual specificity protein phosphatase H1 | NA | 1.61e-33 | 3.85e-06 |
| 1. PB | Q9H596 | Dual specificity protein phosphatase 21 | 4.72e-09 | 1.11e-12 | 1.11e-14 |
| 1. PB | Q8BK84 | Dual specificity phosphatase 29 | 0.00e+00 | 4.63e-49 | 6.80e-52 |
| 1. PB | P0C595 | Dual specificity phosphatase 29 | 0.00e+00 | 1.06e-52 | 3.25e-52 |
| 1. PB | O13453 | Tyrosine-protein phosphatase pmp1 | 1.31e-06 | 2.58e-07 | 6.92e-05 |
| 1. PB | P0C597 | Dual specificity phosphatase 29 | 0.00e+00 | 3.45e-34 | 3.57e-50 |
| 1. PB | P0C5A0 | Dual specificity phosphatase 29 | 0.00e+00 | 1.53e-48 | 1.07e-39 |
| 1. PB | P0C594 | Dual specificity phosphatase 29 | 0.00e+00 | 2.10e-44 | 9.14e-54 |
| 1. PB | Q5RD73 | Dual specificity protein phosphatase 3 | 0.00e+00 | 2.15e-52 | 2.60e-43 |
| 1. PB | P51452 | Dual specificity protein phosphatase 3 | 0.00e+00 | 2.15e-52 | 2.60e-43 |
| 1. PB | Q68J44 | Dual specificity phosphatase 29 | 0.00e+00 | 6.30e-45 | 6.17e-54 |
| 1. PB | Q8NEJ0 | Dual specificity protein phosphatase 18 | 2.89e-14 | 6.57e-13 | 2.44e-16 |
| 1. PB | Q9ZR37 | Dual specificity protein phosphatase 1 | 1.30e-11 | 2.95e-42 | 1.27e-18 |
| 1. PB | Q5FVI9 | Dual specificity protein phosphatase 26 | 0.00e+00 | 3.14e-33 | 1.85e-63 |
| 1. PB | Q5RDP3 | Serine/threonine/tyrosine-interacting protein | 4.68e-10 | 5.20e-08 | 1.25e-12 |
| 1. PB | Q8BTR5 | Dual specificity phosphatase 28 | 1.55e-15 | 2.96e-16 | 4.93e-13 |
| 1. PB | Q9D9D8 | Dual specificity phosphatase 21 | 2.79e-10 | 1.14e-14 | 7.71e-16 |
| 1. PB | Q4V7N3 | Serine/threonine/tyrosine-interacting protein A | 2.80e-10 | 4.44e-07 | 1.92e-14 |
| 1. PB | P20495 | Dual specificity protein phosphatase H1 | NA | 5.74e-35 | 2.01e-05 |
| 1. PB | Q9UII6 | Dual specificity protein phosphatase 13 isoform B | 0.00e+00 | 7.58e-61 | 7.38e-47 |
| 1. PB | Q9BV47 | Dual specificity protein phosphatase 26 | 0.00e+00 | 9.89e-31 | 4.99e-64 |
| 1. PB | Q6NKR2 | Phosphatidylglycerophosphate phosphatase PTPMT2 | 3.15e-08 | 2.35e-27 | 0.013 |
| 1. PB | Q6B8I1 | Dual specificity protein phosphatase 13 isoform A | 0 | 2.29e-156 | 7.61e-140 |
| 1. PB | P0C591 | Dual specificity phosphatase 29 | 0.00e+00 | 1.79e-41 | 4.35e-52 |
| 2. P | Q5I128 | Probable tyrosine phosphatase protein N1 | NA | 1.78e-02 | NA |
| 2. P | Q86IL4 | Probable protein tyrosine phosphatase type IVA B | 2.70e-09 | 1.99e-08 | NA |
| 2. P | Q0DX67 | Probable tyrosine-protein phosphatase DSP2 | 2.15e-06 | 2.72e-14 | NA |
| 2. P | Q60280 | Uncharacterized protein MJECL20 | 7.02e-09 | 2.15e-09 | NA |
| 2. P | Q6CTE4 | Putative tyrosine-protein phosphatase OCA1 | 2.54e-05 | 5.86e-14 | NA |
| 2. P | O10274 | Putative tyrosine-protein phosphatase 1 | NA | 3.20e-09 | NA |
| 2. P | Q6BLZ8 | Putative tyrosine-protein phosphatase OCA1 | 1.13e-04 | 1.84e-15 | NA |
| 2. P | Q6P9X4 | Protein tyrosine phosphatase type IVA 2 | 1.36e-09 | 4.00e-08 | NA |
| 2. P | Q57668 | Uncharacterized protein MJ0215 | 6.60e-07 | 2.03e-14 | NA |
| 2. P | Q6C4X9 | Putative tyrosine-protein phosphatase OCA1 | 4.07e-05 | 6.82e-05 | NA |
| 2. P | Q9BVJ7 | Dual specificity protein phosphatase 23 | 6.02e-12 | 2.50e-09 | NA |
| 2. P | Q6NT99 | Dual specificity protein phosphatase 23 | 6.15e-12 | 1.21e-10 | NA |
| 2. P | Q9J592 | Probable dual specificity protein phosphatase H1 homolog | NA | 3.50e-27 | NA |
| 2. P | Q810P3 | Cyclin-dependent kinase inhibitor 3 | 1.96e-06 | 1.35e-19 | NA |
| 2. P | Q54DU9 | Probable protein tyrosine phosphatase type IVA A | 1.33e-06 | 1.25e-13 | NA |
| 2. P | B2RZ50 | Cyclin-dependent kinase inhibitor 3 | 1.11e-06 | 3.40e-19 | NA |
| 2. P | Q78EG7 | Protein tyrosine phosphatase type IVA 1 | 2.71e-09 | 1.74e-08 | NA |
| 2. P | Q5I137 | Probable tyrosine phosphatase protein J4 | NA | 1.83e-04 | NA |
| 2. P | Q5I139 | Probable tyrosine phosphatase protein J2 | NA | 1.65e-04 | NA |
| 2. P | Q9UUF3 | Probable tyrosine-protein phosphatase C17A3.03c | 7.69e-05 | 4.37e-10 | NA |
| 2. P | Q4P7L6 | Putative tyrosine-protein phosphatase OCA1 | 3.74e-08 | 4.87e-08 | NA |
| 2. P | Q1ZXG8 | Probable tyrosine-protein phosphatase DG1060 | 9.02e-08 | 4.28e-07 | NA |
| 2. P | Q5I141 | Tyrosine phosphatase-like protein J1 | NA | 6.43e-03 | NA |
| 2. P | Q681Z2 | Tyrosine-protein phosphatase DSP3 | 2.60e-05 | 1.12e-04 | NA |
| 2. P | Q63739 | Protein tyrosine phosphatase type IVA 1 | 2.62e-09 | 1.74e-08 | NA |
| 2. P | Q9D658 | Protein tyrosine phosphatase type IVA 3 | 4.14e-09 | 1.99e-08 | NA |
| 2. P | Q8WUK0 | Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 | 4.16e-10 | 3.09e-28 | NA |
| 2. P | Q6FSZ8 | Putative tyrosine-protein phosphatase OCA1 | 9.84e-07 | 9.66e-13 | NA |
| 2. P | P24656 | Tyrosine-protein phosphatase | NA | 2.30e-16 | NA |
| 2. P | A2VDT1 | Protein tyrosine phosphatase type IVA 3 | 2.97e-09 | 1.47e-07 | NA |
| 2. P | Q93096 | Protein tyrosine phosphatase type IVA 1 | 2.63e-09 | 1.74e-08 | NA |
| 2. P | A3LW52 | Putative tyrosine-protein phosphatase OCA1 | 3.30e-05 | 6.96e-15 | NA |
| 2. P | P53965 | Inositol phosphatase SIW14 | 4.71e-05 | 4.99e-03 | NA |
| 2. P | Q84MD6 | Tyrosine-protein phosphatase DSP2 | 3.92e-04 | 5.78e-08 | NA |
| 2. P | Q9FFD7 | Tyrosine-protein phosphatase DSP5 | 5.84e-06 | 2.54e-03 | NA |
| 2. P | P32587 | Tyrosine-protein phosphatase 3 | 4.31e-05 | 1.53e-03 | NA |
| 2. P | Q9ZVN4 | Tyrosine-protein phosphatase DSP1 | 8.85e-05 | 1.64e-13 | NA |
| 2. P | Q66GT5 | Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 | 3.17e-10 | 2.55e-34 | NA |
| 2. P | Q86BN8 | Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 | 5.63e-10 | 1.45e-27 | NA |
| 2. P | P50946 | Putative tyrosine-protein phosphatase OCA1 | 6.75e-05 | 1.85e-09 | NA |
| 2. P | O61722 | PRL-1 phosphatase | 4.77e-09 | 1.11e-12 | NA |
| 2. P | Q940L5 | Probable tyrosine-protein phosphatase DSP4 | 6.24e-05 | 2.78e-12 | NA |
| 2. P | Q22707 | RNA/RNP complex-1-interacting phosphatase homolog | 1.21e-06 | 1.49e-12 | NA |
| 2. P | Q12974 | Protein tyrosine phosphatase type IVA 2 | 1.38e-09 | 4.00e-08 | NA |
| 2. P | O75365 | Protein tyrosine phosphatase type IVA 3 | 4.87e-09 | 2.96e-08 | NA |
| 2. P | A6ZRY1 | Putative tyrosine-protein phosphatase OCA1 | 7.57e-05 | 1.85e-09 | NA |
| 2. P | Q16667 | Cyclin-dependent kinase inhibitor 3 | 1.86e-06 | 4.83e-21 | NA |
| 2. P | O70274 | Protein tyrosine phosphatase type IVA 2 | 1.33e-09 | 4.00e-08 | NA |
| 2. P | Q75B37 | Putative tyrosine-protein phosphatase OCA1 | 6.10e-05 | 2.80e-08 | NA |
| 2. P | Q4CUJ8 | Protein tyrosine phosphatase PRL-1 | 8.34e-09 | 2.99e-11 | NA |
| 2. P | Q9MYN5 | Cyclin-dependent kinase inhibitor 3 | 1.73e-06 | 2.03e-21 | NA |
| 2. P | A5DE24 | Putative tyrosine-protein phosphatase OCA1 | 2.39e-07 | 1.13e-08 | NA |
| 2. P | Q4QEZ7 | Protein tyrosine phosphatase PRL-1 | 1.47e-09 | 1.12e-09 | NA |
| 2. P | P0C089 | Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 | 3.76e-10 | 2.71e-35 | NA |
| 2. P | Q5R7J8 | Protein tyrosine phosphatase type IVA 1 | 2.72e-09 | 7.26e-09 | NA |
| 2. P | Q86IG3 | Phospholipid-inositol phosphatase | NA | 1.81e-11 | NA |
| 2. P | Q9TSM6 | Protein tyrosine phosphatase type IVA 1 | 2.66e-09 | 1.74e-08 | NA |
| 3. B | Q13202 | Dual specificity protein phosphatase 8 | 2.83e-06 | NA | 6.04e-12 |
| 3. B | Q6PFY9 | Dual specificity protein phosphatase CDC14B | 8.71e-05 | NA | 0.017 |
| 3. B | Q63340 | Dual specificity protein phosphatase 7 | 3.22e-06 | NA | 2.73e-13 |
| 3. B | Q9ZQP1 | Phosphatidylglycerophosphate phosphatase PTPMT1 | 3.24e-07 | NA | 0.023 |
| 3. B | Q16828 | Dual specificity protein phosphatase 6 | 1.17e-06 | NA | 3.03e-12 |
| 3. B | Q84JU4 | Protein-tyrosine-phosphatase IBR5 | 1.12e-11 | NA | 3.75e-06 |
| 3. B | Q6NZK8 | Protein tyrosine phosphatase domain-containing protein 1 | 2.82e-03 | NA | 0.032 |
| 3. B | Q8TE77 | Protein phosphatase Slingshot homolog 3 | 5.93e-07 | NA | 1.27e-14 |
| 3. B | Q5VZP5 | Serine/threonine/tyrosine-interacting-like protein 2 | 1.68e-08 | NA | 3.19e-40 |
| 3. B | Q2KJ36 | Dual specificity protein phosphatase 6 | 1.10e-06 | NA | 2.89e-12 |
| 3. B | Q8K330 | Protein phosphatase Slingshot homolog 3 | 3.10e-06 | NA | 1.75e-15 |
| 3. B | P34680 | Uncharacterized protein ZK757.2 | 4.27e-13 | NA | 5.01e-08 |
| 3. B | Q02256 | Tyrosine-protein phosphatase YVH1 | 3.51e-09 | NA | 2.05e-05 |
| 3. B | A7E379 | Protein tyrosine phosphatase domain-containing protein 1 | 2.80e-03 | NA | 0.050 |
| 3. B | Q9UNH5 | Dual specificity protein phosphatase CDC14A | 3.65e-04 | NA | 0.040 |
| 3. B | Q54T76 | Probable dual specificity protein phosphatase DDB_G0281963 | 8.60e-14 | NA | 1.29e-13 |
| 3. B | Q9JIM4 | Dual specificity protein phosphatase 12 | 1.42e-09 | NA | 1.43e-10 |
| 3. B | V6CIV8 | Dual specificity protein phosphatase lip-1 | 8.24e-07 | NA | 4.42e-13 |
| 3. B | Q9D0T2 | Dual specificity protein phosphatase 12 | 4.22e-07 | NA | 2.35e-11 |
| 3. B | Q55CS7 | MAP kinase phosphatase with leucine-rich repeats protein 1 | 1.42e-05 | NA | 9.04e-16 |
| 3. B | Q55BI8 | Probable dual specificity protein phosphatase DDB_G0271350 | 4.00e-15 | NA | 3.12e-13 |
| 3. B | Q0IID7 | Dual specificity protein phosphatase 10 | 1.59e-06 | NA | 1.13e-11 |
| 3. B | Q556Y8 | Probable rhodanese domain-containing dual specificity protein phosphatase | 5.99e-08 | NA | 1.73e-15 |
| 3. B | A2A3K4 | Protein tyrosine phosphatase domain-containing protein 1 | 2.84e-03 | NA | 0.047 |
| 3. B | P38148 | Dual specificity protein phosphatase PPS1 | 2.47e-04 | NA | 1.51e-05 |
| 3. B | A0A0R4IVA4 | Dual specificity protein phosphatase CDC14AB | 4.16e-04 | NA | 0.007 |
| 3. B | Q90W58 | Dual specificity protein phosphatase 1-B | 3.90e-09 | NA | 3.15e-21 |
| 3. B | O54838 | Dual specificity protein phosphatase 5 | 4.29e-09 | NA | 2.16e-17 |
| 3. B | Q64346 | Dual specificity protein phosphatase 6 | 1.04e-06 | NA | 3.27e-12 |
| 3. B | Q5APU2 | Dual specificity protein tyrosine phosphatase CCP1 | 2.67e-04 | NA | 0.030 |
| 3. B | Q9FEB5 | Phosphoglucan phosphatase DSP4, chloroplastic | 2.57e-05 | NA | 0.003 |
| 3. B | Q566R7 | Dual specificity protein phosphatase 22-B | 2.60e-14 | NA | 2.45e-16 |
| 3. B | Q13115 | Dual specificity protein phosphatase 4 | 2.79e-09 | NA | 4.16e-20 |
| 3. B | Q9H1R2 | Dual specificity protein phosphatase 15 | 2.89e-15 | NA | 2.24e-14 |
| 3. B | Q9Y6W6 | Dual specificity protein phosphatase 10 | 3.30e-07 | NA | 1.31e-11 |
| 3. B | Q5XHB2 | Dual specificity protein phosphatase 22 | 1.23e-13 | NA | 1.23e-15 |
| 3. B | P28563 | Dual specificity protein phosphatase 1 | 9.72e-10 | NA | 2.67e-19 |
| 3. B | Q9PW71 | Dual specificity protein phosphatase 4 | 1.11e-09 | NA | 1.02e-19 |
| 3. B | Q99956 | Dual specificity protein phosphatase 9 | 6.09e-09 | NA | 6.04e-17 |
| 3. B | Q75QN6 | Dual specificity protein phosphatase PHS1 | 1.68e-05 | NA | 1.18e-20 |
| 3. B | Q55CS8 | MAP kinase phosphatase with leucine-rich repeats protein 2 | 5.26e-06 | NA | 6.95e-13 |
| 3. B | Q99N11 | Dual specificity protein phosphatase 22 | 8.55e-15 | NA | 2.05e-16 |
| 3. B | Q9ESS0 | Dual specificity protein phosphatase 10 | 7.21e-07 | NA | 1.39e-11 |
| 3. B | Q148W8 | Serine/threonine/tyrosine-interacting-like protein 2 | 7.02e-08 | NA | 2.94e-40 |
| 3. B | B4F7B7 | Dual specificity protein phosphatase 15 | 2.48e-12 | NA | 2.14e-13 |
| 3. B | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 2.66e-05 | NA | 1.35e-20 |
| 3. B | P28562 | Dual specificity protein phosphatase 1 | 9.04e-10 | NA | 1.50e-20 |
| 3. B | Q8BFV3 | Dual specificity protein phosphatase 4 | 4.51e-09 | NA | 2.87e-20 |
| 3. B | O09112 | Dual specificity protein phosphatase 8 | 5.23e-06 | NA | 8.71e-12 |
| 3. B | Q6GQJ8 | Dual specificity protein phosphatase 22 | 1.37e-13 | NA | 1.72e-13 |
| 3. B | O60729 | Dual specificity protein phosphatase CDC14B | 8.02e-05 | NA | 0.049 |
| 3. B | P38590 | Tyrosine-protein phosphatase MSG5 | 3.60e-05 | NA | 3.53e-06 |
| 3. B | Q9UNI6 | Dual specificity protein phosphatase 12 | 5.32e-06 | NA | 2.59e-10 |
| 3. B | Q550K8 | Probable serine/threonine-protein kinase DDB_G0277071 | 6.28e-02 | NA | 2.30e-16 |
| 3. B | O13632 | Tyrosine-protein phosphatase yvh1 | 2.31e-07 | NA | 7.76e-12 |
| 3. B | G4LTX4 | Phosphoglucan phosphatase DSP4, amyloplastic | 6.29e-05 | NA | 0.001 |
| 3. B | Q6NN85 | Protein phosphatase Slingshot | 8.13e-05 | NA | 3.52e-16 |
| 3. B | Q05923 | Dual specificity protein phosphatase 2 | 2.55e-09 | NA | 2.46e-19 |
| 3. B | Q9C5S1 | Protein-tyrosine-phosphatase MKP1 | 3.80e-04 | NA | 2.19e-14 |
| 3. B | Q6IVY4 | Protein phosphatase Slingshot homolog | 1.47e-06 | NA | 2.53e-15 |
| 3. B | Q76I79 | Protein phosphatase Slingshot homolog 1 | 1.45e-04 | NA | 1.13e-12 |
| 3. B | Q10038 | Tyrosine-protein phosphatase vhp-1 | 8.90e-05 | NA | 2.36e-08 |
| 3. B | Q9VVW5 | Dual specificity protein phosphatase Mpk3 | 3.42e-06 | NA | 2.87e-15 |
| 3. B | Q16829 | Dual specificity protein phosphatase 7 | 5.07e-08 | NA | 2.98e-13 |
| 3. B | Q9NRW4 | Dual specificity protein phosphatase 22 | 1.17e-14 | NA | 1.30e-16 |
| 3. B | Q1LWL2 | Dual specificity protein phosphatase 22-A | 8.98e-14 | NA | 2.61e-14 |
| 3. B | Q8WYL5 | Protein phosphatase Slingshot homolog 1 | 7.67e-05 | NA | 1.23e-12 |
| 3. B | Q91790 | Dual specificity protein phosphatase 1-A | 3.41e-08 | NA | 5.12e-21 |
| 3. B | Q76I76 | Protein phosphatase Slingshot homolog 2 | 7.32e-04 | NA | 2.73e-12 |
| 3. B | Q5XIS1 | Protein phosphatase Slingshot homolog 3 | 6.74e-07 | NA | 1.63e-14 |
| 3. B | Q91Z46 | Dual specificity protein phosphatase 7 | 1.79e-08 | NA | 2.67e-13 |
| 3. B | Q05922 | Dual specificity protein phosphatase 2 | 1.04e-10 | NA | 9.30e-19 |
| 3. B | Q9DBB1 | Dual specificity protein phosphatase 6 | 1.28e-06 | NA | 3.18e-12 |
| 3. B | Q64623 | Dual specificity protein phosphatase 1 | 9.16e-10 | NA | 3.47e-19 |
| 3. B | Q5SW75 | Protein phosphatase Slingshot homolog 2 | 1.15e-03 | NA | 1.96e-12 |
| 3. B | Q62767 | Dual specificity protein phosphatase 4 | 3.80e-09 | NA | 2.86e-20 |
| 3. B | Q9BY84 | Dual specificity protein phosphatase 16 | 4.43e-06 | NA | 4.92e-16 |
| 3. B | P43078 | Probable tyrosine-protein phosphatase | 4.19e-05 | NA | 0.030 |
| 3. B | F1QWM2 | Serine/threonine/tyrosine-interacting-like protein 2 | 3.96e-10 | NA | 2.23e-39 |
| 3. B | Q8R4V2 | Dual specificity protein phosphatase 15 | 1.34e-12 | NA | 1.29e-13 |
| 3. B | Q9Y6J8 | Serine/threonine/tyrosine-interacting-like protein 1 | 3.97e-08 | NA | 3.75e-05 |
| 3. B | Q16690 | Dual specificity protein phosphatase 5 | 3.22e-08 | NA | 2.32e-17 |
| 3. B | Q9VWF4 | Dual specificity protein phosphatase MPK-4 | 5.27e-07 | NA | 3.60e-13 |