Summary

Q6IC83

Homolog: Q7M3V1.
Function: 33kDa venom protein.

Statistics

Total GO Annotation: 22
Unique PROST Go: 22
Unique BLAST Go: 0

Total Homologs: 39
Unique PROST Homologs: 37
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q7M3V1 (33kDa venom protein) with a FATCAT P-Value: 0.00586 and RMSD of 2.49 angstrom. The sequence alignment identity is 18.8%.
Structural alignment shown in left. Query protein Q6IC83 colored as red in alignment, homolog Q7M3V1 colored as blue. Query protein Q6IC83 is also shown in right top, homolog Q7M3V1 showed in right bottom. They are colored based on secondary structures. 

  Q6IC83 ---------------------MG-SKLTCCLGPS-GGL--N-----C----DCCRPDVGPCHECE----IPETVAATAPASTTAKPAKLD---------- 52
  Q7M3V1 MAGKEVIFIMALFIAVESSPIFSFDDLVC---PSVTSLRVNVEKNECSTKKDCGR-NL--C--CENQNKINVCVGGIMP---LPKP-NLDVNNIGGAVSE 88

  Q6IC83 -LKAKKAQLMQYL--SLPK---TPKMLKMS----K-GLDARSKRWLKIIWRRHGIWPLE-NIGPTEDVQASAH---GGVE------ENMTSDIEIPEAKH 131
  Q7M3V1 SVKQKR-ETAESLSGSFDKEKASAENLSGSFDQQKSSVDEKSGS----VGQQKG--AVEGQSGSGEQRRETAESQSGSVDQEKASAENLSGSID----K- 176

  Q6IC83 DHRPT-EDVQVSAHG--G-VE------ENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKE 221
  Q7M3V1 -QKVTVEEKSEPAQGQSGSVKQKRKTTENVSGSLD--QEKAS---AESLSGSF-----DQQKSSVDEK-SGSV------GNDDDISVQ------------ 246

  Q6IC83 RYEDYLCWVKMARSRLNEPISSQVLGLLRL 251
  Q7M3V1 ------------------------------ 246

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0043014 alpha-tubulin binding
2. P GO:0045735 nutrient reservoir activity
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0018149 peptide cross-linking
2. P GO:0005815 microtubule organizing center
2. P GO:0099002 viral genome ejection through host cell envelope, short tail mechanism
2. P GO:0007420 brain development
2. P GO:0005576 extracellular region
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0030430 host cell cytoplasm
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:0030238 male sex determination
2. P GO:0000922 spindle pole
2. P GO:0043662 peribacteroid fluid
2. P GO:0031424 keratinization
2. P GO:0098026 virus tail, tube
2. P GO:0007548 sex differentiation
2. P GO:0005730 nucleolus
2. P GO:0042255 ribosome assembly
2. P GO:0009877 nodulation
2. P GO:0060491 regulation of cell projection assembly
2. P GO:0001533 cornified envelope

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6PGQ1 Aspartate-rich protein 1 3.34e-01 1.76e-09 3.63e-05
1. PB Q6IC83 Uncharacterized protein C22orf42 0 9.69e-146 0.0
2. P P06674 Zein-alpha 19A2 (Fragment) 2.77e-02 9.71e-03 NA
2. P Q4ZJZ1 Protease inhibitor Egf1.5b NA 3.63e-03 NA
2. P Q86X53 Glutamate-rich protein 1 4.41e-02 2.79e-04 NA
2. P Q80X32 UPF0461 protein C5orf24 homolog 7.66e-01 1.57e-03 NA
2. P P10322 Nodulin-25 7.49e-02 5.48e-06 NA
2. P P0DJ88 Secreted effector protein EspF(U) 2.38e-01 3.48e-03 NA
2. P Q6BXL9 Mediator of RNA polymerase II transcription subunit 18 5.23e-01 1.02e-02 NA
2. P P24449 Zein-alpha PMS1 9.74e-03 2.87e-02 NA
2. P F8W0I5 Nuclear pore complex-interacting protein family member B12 8.23e-01 3.52e-03 NA
2. P Q9H321 Variable charge X-linked protein 3B 2.58e-01 4.52e-03 NA
2. P Q7M3V1 33kDa venom protein 5.86e-03 2.33e-02 NA
2. P Q9H320 Variable charge X-linked protein 1 3.53e-01 1.03e-02 NA
2. P P35323 Cornifin 2.16e-01 4.68e-02 NA
2. P Q9SJM4 GLABROUS1 enhancer-binding protein-like 3 3.74e-01 1.86e-04 NA
2. P Q28658 Small proline-rich protein 3 9.15e-01 1.59e-02 NA
2. P A0A0J9YWL9 Putative testis-expressed protein 13C 2.99e-01 2.29e-02 NA
2. P Q4ZJZ3 Protease inhibitor Egf1.5a NA 2.55e-04 NA
2. P A6NFR6 Uncharacterized protein C5orf60 1.47e-01 7.29e-03 NA
2. P P04705 Zein-alpha PZ19.1 (Fragment) 3.77e-02 1.26e-03 NA
2. P Q62565 Sex-determining region Y protein 3.88e-02 3.13e-03 NA
2. P P0DJ89 Secreted effector protein EspF(U) 1.92e-01 3.48e-03 NA
2. P P0C2X8 Cell division cycle-associated protein 3 2.02e-01 1.58e-06 NA
2. P Q0II29 UPF0461 protein C5orf24 homolog 7.24e-01 2.68e-02 NA
2. P Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 3.76e-02 4.43e-03 NA
2. P Q8VE94 Protein FAM110C 2.16e-01 6.92e-03 NA
2. P Q09239 Uncharacterized protein C28F5.1 8.63e-01 3.26e-05 NA
2. P Q1ELU4 M-zodatoxin-Lt4b 5.62e-02 2.11e-02 NA
2. P C6UYI3 Secreted effector protein EspF(U) 3.82e-01 3.48e-03 NA
2. P P21733 Uncharacterized 29.1 kDa protein in cryB1 5'region 9.84e-01 5.18e-03 NA
2. P Q37892 Proximal tail tube connector protein NA 5.63e-04 NA
2. P P48997 Involucrin 9.76e-02 3.89e-02 NA
2. P Q9JJL0 Testis-specific gene A8 protein 5.64e-01 3.36e-02 NA
2. P Q8N402 Putative uncharacterized protein LOC388882 8.53e-02 1.28e-08 NA
2. P Q6SJ82 Sperm protein associated with the nucleus on the X chromosome N2 1.42e-01 1.71e-02 NA
2. P Q08DY0 Glutamate-rich protein 5 5.15e-01 8.95e-03 NA
2. P P84707 Conotoxin flf14c 2.47e-01 3.29e-02 NA
2. P Q6GZS6 Uncharacterized protein 050L NA 1.41e-04 NA