Summary

Q6ICC9

Homolog: Q505G4.
Function: Retrotransposon Gag-like protein 6.

Statistics

Total GO Annotation: 50
Unique PROST Go: 35
Unique BLAST Go: 9

Total Homologs: 36
Unique PROST Homologs: 13
Unique BLAST Homologs: 16

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q505G4 (Retrotransposon Gag-like protein 6) with a FATCAT P-Value: 6.01e-14 and RMSD of 2.38 angstrom. The sequence alignment identity is 91.8%.
Structural alignment shown in left. Query protein Q6ICC9 colored as red in alignment, homolog Q505G4 colored as blue. Query protein Q6ICC9 is also shown in right top, homolog Q505G4 showed in right bottom. They are colored based on secondary structures. 

  Q6ICC9 MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTS 100
  Q505G4 MVQPRTSKTESPASAPGASAQMDDVVDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTRARIPGALQITPPISAITSNGTRPMTTPPTS 100

  Q6ICC9 LPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAV- 199
  Q505G4 LPEPFSGDPGQLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHSRRAQIRKTSASNRAVR 200

  Q6ICC9 ---RERQMLCRQLASAGTGPCPVHPASNGTSPAPALPARARNL 239
  Q505G4 ERERERQMLCRQLAAAGTGSCPVHPASNGTNPAPALPSRGRNL 243

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:1903547 regulation of growth hormone activity
1. PB GO:0071225 cellular response to muramyl dipeptide
1. PB GO:0071222 cellular response to lipopolysaccharide
1. PB GO:0001893 maternal placenta development
1. PB GO:0005730 nucleolus
1. PB GO:0060137 maternal process involved in parturition
2. P GO:0098978 glutamatergic synapse
2. P GO:0060291 long-term synaptic potentiation
2. P GO:1903561 extracellular vesicle
2. P GO:0051260 protein homooligomerization
2. P GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
2. P GO:0051028 mRNA transport
2. P GO:0007612 learning
2. P GO:0016477 cell migration
2. P GO:0050804 modulation of chemical synaptic transmission
2. P GO:0015629 actin cytoskeleton
2. P GO:1900452 regulation of long-term synaptic depression
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:0022604 regulation of cell morphogenesis
2. P GO:0043197 dendritic spine
2. P GO:0045121 membrane raft
2. P GO:0000943 retrotransposon nucleocapsid
2. P GO:0007492 endoderm development
2. P GO:0003729 mRNA binding
2. P GO:0006897 endocytosis
2. P GO:0030425 dendrite
2. P GO:2000969 positive regulation of AMPA receptor activity
2. P GO:0098845 postsynaptic endosome
2. P GO:0007616 long-term memory
2. P GO:0032197 transposition, RNA-mediated
2. P GO:0098839 postsynaptic density membrane
2. P GO:0071598 neuronal ribonucleoprotein granule
2. P GO:0031901 early endosome membrane
2. P GO:0001669 acrosomal vesicle
2. P GO:0061001 regulation of dendritic spine morphogenesis
2. P GO:0007010 cytoskeleton organization
2. P GO:0009952 anterior/posterior pattern specification
2. P GO:0110077 vesicle-mediated intercellular transport
2. P GO:0048168 regulation of neuronal synaptic plasticity
2. P GO:0005938 cell cortex
2. P GO:1900271 regulation of long-term synaptic potentiation
3. B GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
3. B GO:0006915 apoptotic process
3. B GO:0097345 mitochondrial outer membrane permeabilization
3. B GO:0001890 placenta development
3. B GO:0008270 zinc ion binding
3. B GO:0030154 cell differentiation
3. B GO:0051881 regulation of mitochondrial membrane potential
3. B GO:0005654 nucleoplasm
3. B GO:0003676 nucleic acid binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q505G4 Retrotransposon Gag-like protein 6 6.01e-14 6.33e-93 4.60e-158
1. PB Q17QF6 Protein LDOC1 2.26e-11 2.91e-11 4.61e-18
1. PB Q6SEH5 Protein LDOC1 1.80e-06 2.57e-09 9.80e-19
1. PB Q6ICC9 Retrotransposon Gag-like protein 6 0 1.81e-153 4.72e-174
1. PB Q6SEH4 Protein LDOC1 1.85e-11 9.83e-10 1.00e-18
1. PB Q7TPY9 Protein LDOC1 1.05e-08 7.99e-09 1.73e-15
1. PB O95751 Protein LDOC1 2.12e-11 9.13e-09 1.00e-18
2. P Q8BHK0 Paraneoplastic antigen Ma2 homolog 1.17e-02 1.49e-02 NA
2. P Q5R486 Paraneoplastic antigen Ma2 homolog 2.21e-02 4.40e-03 NA
2. P Q8AWC3 Activity-regulated cytoskeleton-associated protein 4.17e-04 1.05e-05 NA
2. P Q7LC44 Activity-regulated cytoskeleton-associated protein 4.71e-04 2.03e-05 NA
2. P Q9GMU3 Paraneoplastic antigen Ma2 homolog 4.43e-02 1.74e-03 NA
2. P Q9UL42 Paraneoplastic antigen Ma2 3.46e-02 1.19e-02 NA
2. P Q2KIT6 Paraneoplastic antigen Ma2 homolog 1.32e-02 4.77e-03 NA
2. P P27536 Posterior protein 9.75e-03 4.98e-04 NA
2. P Q6Q5P6 Transposon Ty4-H Gag polyprotein 1.42e-03 8.87e-07 NA
2. P Q12134 Protein HUA2 1.03e-02 3.79e-02 NA
2. P Q63053 Activity-regulated cytoskeleton-associated protein 7.92e-04 1.84e-04 NA
2. P Q9WV31 Activity-regulated cytoskeleton-associated protein 3.78e-04 3.06e-03 NA
2. P P47023 Transposon Ty4-J Gag polyprotein 1.02e-02 1.47e-03 NA
3. B Q7TN75 Retrotransposon-derived protein PEG10 8.45e-02 NA 2.36e-09
3. B Q5R6M8 Protein Bop 2.16e-03 NA 3.05e-09
3. B A6NKG5 Retrotransposon-like protein 1 1.66e-01 NA 0.030
3. B Q1JQ94 Retrotransposon Gag-like protein 8 6.70e-04 NA 3.65e-18
3. B Q5HYW3 Retrotransposon Gag-like protein 5 4.40e-04 NA 5.21e-19
3. B A6ZKI3 Retrotransposon Gag-like protein 8C 5.23e-04 NA 5.64e-19
3. B Q8N8U3 Retrotransposon Gag-like protein 3 3.50e-04 NA 1.46e-04
3. B Q8NET4 Retrotransposon Gag-like protein 9 6.45e-01 NA 0.003
3. B Q5DTT4 Retrotransposon Gag-like protein 5 1.26e-04 NA 2.75e-19
3. B Q6P1Y1 Retrotransposon Gag-like protein 3 8.52e-03 NA 0.003
3. B Q17RB0 Retrotransposon Gag-like protein 8B 5.73e-05 NA 3.81e-18
3. B Q86TG7 Retrotransposon-derived protein PEG10 5.05e-04 NA 1.81e-09
3. B Q7M732 Retrotransposon-like protein 1 1.20e-01 NA 0.011
3. B Q9BWD3 Retrotransposon Gag-like protein 8A 5.41e-04 NA 9.37e-19
3. B Q32KG4 Retrotransposon Gag-like protein 9 7.44e-01 NA 0.003
3. B Q7L3V2 Protein Bop 1.98e-04 NA 1.16e-09