Summary

Q6NT46

Homolog: Q4V321.
Function: G antigen 13.

Statistics

Total GO Annotation: 2
Unique PROST Go: 0
Unique BLAST Go: 2

Total Homologs: 24
Unique PROST Homologs: 1
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4V321 (G antigen 13) with a FATCAT P-Value: 1.09e-12 and RMSD of 3.47 angstrom. The sequence alignment identity is 96.6%.
Structural alignment shown in left. Query protein Q6NT46 colored as red in alignment, homolog Q4V321 colored as blue. Query protein Q6NT46 is also shown in right top, homolog Q4V321 showed in right bottom. They are colored based on secondary structures. 

  Q6NT46 MSWRGRST-YRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGQDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 99
  Q4V321 MSWRGRSTYYWPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPP 100

  Q6NT46 NPEEVKTPEEGEKQSQC 116
  Q4V321 NPEEVKTPEEGEKQSQC 117

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
3. B GO:0004222 metalloendopeptidase activity
3. B GO:0005618 cell wall

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8WWM1 X antigen family member 5 4.33e-03 1.77e-08 4.21e-06
1. PB A6NGK3 G antigen 10 1.42e-07 6.08e-59 1.15e-67
1. PB A6NDE8 G antigen 12H 6.36e-09 4.13e-52 9.14e-72
1. PB P0CL82 G antigen 12I 1.88e-09 2.05e-66 1.12e-73
1. PB Q13069 G antigen 5 1.14e-08 2.42e-65 7.84e-72
1. PB Q4V326 G antigen 2E 1.02e-08 1.57e-52 2.15e-68
1. PB Q8WTP9 X antigen family member 3 1.01e-03 4.54e-15 2.19e-14
1. PB Q13070 G antigen 6 2.50e-09 3.64e-66 3.56e-71
1. PB P0CL80 G antigen 12F 2.76e-08 2.05e-66 1.12e-73
1. PB O76087 G antigen 7 4.19e-09 2.05e-66 1.12e-73
1. PB A6NER3 G antigen 12J 2.29e-08 3.66e-45 1.60e-70
1. PB P0DSO3 G antigen 4 3.06e-12 3.33e-62 1.99e-72
1. PB Q6NT46 G antigen 2A 0 2.21e-157 1.25e-77
1. PB P0DTW1 G antigen 1 2.61e-08 1.51e-65 3.72e-71
1. PB Q4V321 G antigen 13 1.09e-12 4.05e-67 9.53e-73
1. PB P0CL81 G antigen 12G 6.75e-09 2.05e-66 1.12e-73
1. PB Q9UEU5 G antigen 2D 1.28e-11 3.64e-99 1.00e-75
1. PB A1L429 G antigen 12B/C/D/E 4.02e-09 5.60e-55 3.33e-72
1. PB Q13066 G antigen 2B/2C 1.47e-11 4.10e-120 4.78e-77
2. P Q96U48 Uncharacterized protein B2A19.060 2.80e-01 1.08e-02 NA
3. B Q9L7Q2 Zinc metalloprotease ZmpB 9.97e-01 NA 0.004
3. B Q8DQN5 Zinc metalloprotease ZmpB 9.97e-01 NA 0.019
3. B Q96GT9 X antigen family member 2 2.07e-03 NA 5.58e-19
3. B O75459 P antigen family member 1 2.27e-04 NA 2.59e-16