Summary

Q6P2I7

Homolog: P0CF75.
Function: Endogenous Bornavirus-like nucleoprotein 1.

Statistics

Total GO Annotation: 31
Unique PROST Go: 22
Unique BLAST Go: 9

Total Homologs: 24
Unique PROST Homologs: 20
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was P0CF75 (Endogenous Bornavirus-like nucleoprotein 1) with a FATCAT P-Value: 1.76e-12 and RMSD of 1.87 angstrom. The sequence alignment identity is 39.5%.
Structural alignment shown in left. Query protein Q6P2I7 colored as red in alignment, homolog P0CF75 colored as blue. Query protein Q6P2I7 is also shown in right top, homolog P0CF75 showed in right bottom. They are colored based on secondary structures. 

  Q6P2I7 MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAMDRSGLPDLQGRFELSGKNRQYPLDALEPQPSIGDI 100
  P0CF75 -----------------------------------------------MSRPRNNPQTSSPQDSTKDGSSFHYFQGRFELSGKSRQYPADALEPQPGIGDV 53

  Q6P2I7 KDIKKAAKSMLDPAHKSHFHPVTPSLVFLCFIFDGLHQALLSVGVSKRSNTVVGNENEERGTPYASRFKD-MPNFIALEKSSVLRHCCDLLIGIAAGSSD 199
  P0CF75 KVIEKATKSMLDPAQRSHFYLVTPSLVFLCFIFDGLHKALLSVGVSKRSNIVIGNENKETGTLYASKFEDVLPTFTALEMSSILRHCCD-LIGIAAGSSD 152

  Q6P2I7 KICTSSLQVQRRFKAMMASIGR-LSHGESADLLISCNAESAIGWISSRPWVGELMFTLLFGDFESP----LHKLR----KSS------------------ 272
  P0CF75 PICTNSLQVQRQFKAMMISIGRPL-HSESADLLISYNAGPAIDWINSRPWVGGLMFTFLFGEFESPACELLDQVKVVASKAQMMTYYTVRMFLDQCVDGS 251

  Q6P2I7 ---------------------------------------------------------------------------------------------------- 272
  P0CF75 TALPAVVLEIPVFEQKKPLAKKVLGDFFEFGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEALDIIPGSTITFPVLQMASAQKISRGSDMDP 351

  Q6P2I7 --------------- 272
  P0CF75 YTLNILRGYGISGFE 366

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0009792 embryo development ending in birth or egg hatching
2. P GO:0005131 growth hormone receptor binding
2. P GO:0015031 protein transport
2. P GO:0005504 fatty acid binding
2. P GO:0007019 microtubule depolymerization
2. P GO:0000212 meiotic spindle organization
2. P GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system
2. P GO:0005634 nucleus
2. P GO:0008352 katanin complex
2. P GO:0030276 clathrin binding
2. P GO:0003997 acyl-CoA oxidase activity
2. P GO:0031144 proteasome localization
2. P GO:0032588 trans-Golgi network membrane
2. P GO:0034080 CENP-A containing chromatin assembly
2. P GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase
2. P GO:0046907 intracellular transport
2. P GO:0055088 lipid homeostasis
2. P GO:0000922 spindle pole
2. P GO:0000794 condensed nuclear chromosome
2. P GO:0051013 microtubule severing
2. P GO:0030121 AP-1 adaptor complex
2. P GO:0001940 male pronucleus
3. B GO:0042025 host cell nucleus
3. B GO:0019055 modification by virus of host cell cycle regulation
3. B GO:0019029 helical viral capsid
3. B GO:0046718 viral entry into host cell
3. B GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
3. B GO:0039644 suppression by virus of host NF-kappaB cascade
3. B GO:0030430 host cell cytoplasm
3. B GO:0019013 viral nucleocapsid
3. B GO:0075732 viral penetration into host nucleus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6P2I7 Endogenous Bornavirus-like nucleoprotein 2 0 2.24e-137 0.0
2. P Q9DAQ9 Spermatogenesis-associated protein 19, mitochondrial 8.56e-02 2.36e-02 NA
2. P Q2UGF7 Tethering factor for nuclear proteasome sts1 7.79e-02 3.82e-02 NA
2. P A6R7I3 Tethering factor for nuclear proteasome STS1 1.05e-01 1.14e-02 NA
2. P P34006 Somatotropin 3.46e-02 4.00e-02 NA
2. P Q1T763 Centromere protein R 1.85e-01 1.27e-03 NA
2. P Q6CH63 Tethering factor for nuclear proteasome STS1 1.28e-01 1.70e-02 NA
2. P C0SIQ6 Tethering factor for nuclear proteasome STS1 8.47e-02 9.07e-03 NA
2. P Q0CLE0 Tethering factor for nuclear proteasome sts1 1.45e-01 2.76e-02 NA
2. P P69614 Protein I NA 5.23e-03 NA
2. P B8N9X2 Tethering factor for nuclear proteasome sts1 1.01e-01 3.82e-02 NA
2. P C5GE44 Tethering factor for nuclear proteasome STS1 9.45e-02 1.42e-02 NA
2. P C5JJ91 Tethering factor for nuclear proteasome STS1 9.30e-02 1.42e-02 NA
2. P Q96F83 Uncharacterized protein CLBA1 5.33e-01 1.04e-02 NA
2. P C5P8M7 Tethering factor for nuclear proteasome STS1 1.29e-01 1.38e-02 NA
2. P C1GLQ3 Tethering factor for nuclear proteasome STS1 8.54e-02 9.07e-03 NA
2. P C4YCB9 Tethering factor for nuclear proteasome STS1 1.15e-01 2.87e-03 NA
2. P E9D0S5 Tethering factor for nuclear proteasome STS1 7.45e-02 1.38e-02 NA
2. P O44740 Meiotic spindle formation protein 2 8.54e-02 3.20e-03 NA
2. P P0CZ24 Putative acyl-coenzyme A oxidase At3g06690 7.03e-02 2.96e-03 NA
2. P A0A182BSR9 Secreted RxLR effector protein 16 8.20e-02 1.86e-02 NA
3. B P0CF75 Endogenous Bornavirus-like nucleoprotein 1 1.76e-12 NA 1.69e-108
3. B P0C797 Nucleoprotein NA NA 2.90e-45
3. B P0C796 Nucleoprotein NA NA 2.55e-45