Results | PROST

Summary

Q6PIY5

Homolog: A7MBF6.
Function: Armadillo-like helical domain containing protein 1.

Statistics

Total GO Annotation: 424
Unique PROST Go: 424
Unique BLAST Go: 0

Total Homologs: 327
Unique PROST Homologs: 325
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A7MBF6 (Armadillo-like helical domain containing protein 1) with a FATCAT P-Value: 0.0 and RMSD of 1.98 angstrom. The sequence alignment identity is 83.1%.
Structural alignment shown in left. Query protein Q6PIY5 colored as red in alignment, homolog A7MBF6 colored as blue. Query protein Q6PIY5 is also shown in right top, homolog A7MBF6 showed in right bottom. They are colored based on secondary structures.

  Q6PIY5 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFL 100
  A7MBF6 MTSIKEQAAISRLLSFLQDWDNAGKVARSNILNNFIEANQGKTAPELEQEFSQGASLFLVRLTTWLRLTYMTGSPLDKLLRSIGVFLSAVSSNRYLIEFL 100

  Q6PIY5 EVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPK 200
  A7MBF6 EVGGVLTLLEILALNKIKEEDKKESIKLLQVIANSGRKYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLIHGNPKYQNQVYKGLIALLPCASPK 200

  Q6PIY5 AQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMFLQQA 300
  A7MBF6 AQQLALQTLRTAQSIIGTTHPSIVDCVLKVLCTMHLEVQYEAIELIKDLVNYDVCPALLKGLVALLIPSFKETSKLQSQIVSDSSVLELTAHLPLFLQQA 300

  Q6PIY5 AAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLECFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVN 400
  A7MBF6 AAAKAIGVLARHNTTLAEEMLHLRVIHSLMAAMGNTDHSNSQRQASLTLEYFVQLFPVVEEHVRKTMGEELYKLFLSNAENLYMNIDSIQADILAANKVN 400

  Q6PIY5 VTKALCLHGSSYS-MNTLYG--SRDSAQMAYLTHF-EEDVESKE 440
  A7MBF6 VTRVLHLSGLSYSNMSFYFGHPNED--QVAYVTHFRKEDVEEKE 442

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:1990791	dorsal root ganglion development
2. P	GO:0001708	cell fate specification
2. P	GO:0071711	basement membrane organization
2. P	GO:0001570	vasculogenesis
2. P	GO:0030014	CCR4-NOT complex
2. P	GO:0060232	delamination
2. P	GO:0009556	microsporogenesis
2. P	GO:0008277	regulation of G protein-coupled receptor signaling pathway
2. P	GO:0042074	cell migration involved in gastrulation
2. P	GO:0097066	response to thyroid hormone
2. P	GO:0000425	pexophagy
2. P	GO:0043296	apical junction complex
2. P	GO:0050730	regulation of peptidyl-tyrosine phosphorylation
2. P	GO:0008283	cell population proliferation
2. P	GO:0009554	megasporogenesis
2. P	GO:0016939	kinesin II complex
2. P	GO:0045186	zonula adherens assembly
2. P	GO:0000159	protein phosphatase type 2A complex
2. P	GO:0030539	male genitalia development
2. P	GO:0001701	in utero embryonic development
2. P	GO:0019221	cytokine-mediated signaling pathway
2. P	GO:0003266	regulation of secondary heart field cardioblast proliferation
2. P	GO:0043537	negative regulation of blood vessel endothelial cell migration
2. P	GO:1903044	protein localization to membrane raft
2. P	GO:0007301	female germline ring canal formation
2. P	GO:0019894	kinesin binding
2. P	GO:0001824	blastocyst development
2. P	GO:0070986	left/right axis specification
2. P	GO:0000791	euchromatin
2. P	GO:0030448	hyphal growth
2. P	GO:0005576	extracellular region
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0072542	protein phosphatase activator activity
2. P	GO:0001164	RNA polymerase I core promoter sequence-specific DNA binding
2. P	GO:0042127	regulation of cell population proliferation
2. P	GO:0043403	skeletal muscle tissue regeneration
2. P	GO:0060484	lung-associated mesenchyme development
2. P	GO:0030018	Z disc
2. P	GO:0030858	positive regulation of epithelial cell differentiation
2. P	GO:0051177	meiotic sister chromatid cohesion
2. P	GO:0030902	hindbrain development
2. P	GO:0070411	I-SMAD binding
2. P	GO:0035112	genitalia morphogenesis
2. P	GO:0060441	epithelial tube branching involved in lung morphogenesis
2. P	GO:0007163	establishment or maintenance of cell polarity
2. P	GO:0001569	branching involved in blood vessel morphogenesis
2. P	GO:0045722	positive regulation of gluconeogenesis
2. P	GO:0014823	response to activity
2. P	GO:0106006	cytoskeletal protein-membrane anchor activity
2. P	GO:0050808	synapse organization
2. P	GO:0045669	positive regulation of osteoblast differentiation
2. P	GO:0005154	epidermal growth factor receptor binding
2. P	GO:0008356	asymmetric cell division
2. P	GO:0030054	cell junction
2. P	GO:0007028	cytoplasm organization
2. P	GO:0048489	synaptic vesicle transport
2. P	GO:0002089	lens morphogenesis in camera-type eye
2. P	GO:0022405	hair cycle process
2. P	GO:0070602	regulation of centromeric sister chromatid cohesion
2. P	GO:0071944	cell periphery
2. P	GO:0001181	RNA polymerase I general transcription initiation factor activity
2. P	GO:0060916	mesenchymal cell proliferation involved in lung development
2. P	GO:0033138	positive regulation of peptidyl-serine phosphorylation
2. P	GO:0042144	vacuole fusion, non-autophagic
2. P	GO:0060492	lung induction
2. P	GO:0008542	visual learning
2. P	GO:0031069	hair follicle morphogenesis
2. P	GO:0072659	protein localization to plasma membrane
2. P	GO:0043657	host cell
2. P	GO:2000114	regulation of establishment of cell polarity
2. P	GO:0001042	RNA polymerase I core binding
2. P	GO:0045296	cadherin binding
2. P	GO:0040035	hermaphrodite genitalia development
2. P	GO:0120170	intraciliary transport particle B binding
2. P	GO:0060348	bone development
2. P	GO:0000407	phagophore assembly site
2. P	GO:0040001	establishment of mitotic spindle localization
2. P	GO:0016328	lateral plasma membrane
2. P	GO:0008104	protein localization
2. P	GO:0030295	protein kinase activator activity
2. P	GO:0042564	NLS-dependent protein nuclear import complex
2. P	GO:0002052	positive regulation of neuroblast proliferation
2. P	GO:0001965	G-protein alpha-subunit binding
2. P	GO:0048660	regulation of smooth muscle cell proliferation
2. P	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
2. P	GO:0072054	renal outer medulla development
2. P	GO:0030479	actin cortical patch
2. P	GO:0060070	canonical Wnt signaling pathway
2. P	GO:0042734	presynaptic membrane
2. P	GO:0043495	protein-membrane adaptor activity
2. P	GO:0051571	positive regulation of histone H3-K4 methylation
2. P	GO:0048477	oogenesis
2. P	GO:0072132	mesenchyme morphogenesis
2. P	GO:0005730	nucleolus
2. P	GO:0031462	Cul2-RING ubiquitin ligase complex
2. P	GO:0048715	negative regulation of oligodendrocyte differentiation
2. P	GO:0030122	AP-2 adaptor complex
2. P	GO:0072383	plus-end-directed vesicle transport along microtubule
2. P	GO:0043058	regulation of backward locomotion
2. P	GO:0051388	positive regulation of neurotrophin TRK receptor signaling pathway
2. P	GO:0043547	positive regulation of GTPase activity
2. P	GO:0055057	neuroblast division
2. P	GO:0007160	cell-matrix adhesion
2. P	GO:0034750	Scrib-APC-beta-catenin complex
2. P	GO:0042307	positive regulation of protein import into nucleus
2. P	GO:0030316	osteoclast differentiation
2. P	GO:0016477	cell migration
2. P	GO:0044379	protein localization to actin cortical patch
2. P	GO:1903902	positive regulation of viral life cycle
2. P	GO:0032331	negative regulation of chondrocyte differentiation
2. P	GO:0071665	gamma-catenin-TCF7L2 complex
2. P	GO:0030331	estrogen receptor binding
2. P	GO:1905557	regulation of mitotic nuclear envelope disassembly
2. P	GO:0008022	protein C-terminus binding
2. P	GO:0071958	new mitotic spindle pole body
2. P	GO:0000774	adenyl-nucleotide exchange factor activity
2. P	GO:0046961	proton-transporting ATPase activity, rotational mechanism
2. P	GO:0055105	ubiquitin-protein transferase inhibitor activity
2. P	GO:0001709	cell fate determination
2. P	GO:0035116	embryonic hindlimb morphogenesis
2. P	GO:0090038	negative regulation of protein kinase C signaling
2. P	GO:1902466	positive regulation of histone H3-K27 trimethylation
2. P	GO:0051666	actin cortical patch localization
2. P	GO:0010909	positive regulation of heparan sulfate proteoglycan biosynthetic process
2. P	GO:0044325	transmembrane transporter binding
2. P	GO:0006897	endocytosis
2. P	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0001840	neural plate development
2. P	GO:0005634	nucleus
2. P	GO:0120249	lateral wall of outer hair cell
2. P	GO:0001706	endoderm formation
2. P	GO:0030877	beta-catenin destruction complex
2. P	GO:0048617	embryonic foregut morphogenesis
2. P	GO:0043248	proteasome assembly
2. P	GO:0032355	response to estradiol
2. P	GO:0045976	negative regulation of mitotic cell cycle, embryonic
2. P	GO:0010629	negative regulation of gene expression
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0017148	negative regulation of translation
2. P	GO:0000221	vacuolar proton-transporting V-type ATPase, V1 domain
2. P	GO:0005930	axoneme
2. P	GO:0072697	protein localization to cell cortex
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0035839	non-growing cell tip
2. P	GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0071629	cytoplasm protein quality control by the ubiquitin-proteasome system
2. P	GO:0016922	nuclear receptor binding
2. P	GO:0009987	cellular process
2. P	GO:0001221	transcription coregulator binding
2. P	GO:0045603	positive regulation of endothelial cell differentiation
2. P	GO:0030581	symbiont intracellular protein transport in host
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0001764	neuron migration
2. P	GO:0044334	canonical Wnt signaling pathway involved in positive regulation of epithelial to mesenchymal transition
2. P	GO:2000002	negative regulation of DNA damage checkpoint
2. P	GO:1990314	cellular response to insulin-like growth factor stimulus
2. P	GO:0000775	chromosome, centromeric region
2. P	GO:0051973	positive regulation of telomerase activity
2. P	GO:1900017	positive regulation of cytokine production involved in inflammatory response
2. P	GO:0002053	positive regulation of mesenchymal cell proliferation
2. P	GO:0061047	positive regulation of branching involved in lung morphogenesis
2. P	GO:0045875	negative regulation of sister chromatid cohesion
2. P	GO:0014829	vascular associated smooth muscle contraction
2. P	GO:0005818	aster
2. P	GO:0050839	cell adhesion molecule binding
2. P	GO:0031016	pancreas development
2. P	GO:0031028	septation initiation signaling
2. P	GO:0060439	trachea morphogenesis
2. P	GO:0051598	meiotic recombination checkpoint signaling
2. P	GO:2000017	positive regulation of determination of dorsal identity
2. P	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
2. P	GO:0071574	protein localization to medial cortex
2. P	GO:0000794	condensed nuclear chromosome
2. P	GO:0009950	dorsal/ventral axis specification
2. P	GO:0070682	proteasome regulatory particle assembly
2. P	GO:0071681	cellular response to indole-3-methanol
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0046332	SMAD binding
2. P	GO:0042475	odontogenesis of dentin-containing tooth
2. P	GO:2000008	regulation of protein localization to cell surface
2. P	GO:0060742	epithelial cell differentiation involved in prostate gland development
2. P	GO:0019900	kinase binding
2. P	GO:0001711	endodermal cell fate commitment
2. P	GO:0040024	dauer larval development
2. P	GO:1903077	negative regulation of protein localization to plasma membrane
2. P	GO:0097228	sperm principal piece
2. P	GO:0005923	bicellular tight junction
2. P	GO:0035115	embryonic forelimb morphogenesis
2. P	GO:0006606	protein import into nucleus
2. P	GO:0098609	cell-cell adhesion
2. P	GO:0006364	rRNA processing
2. P	GO:0070586	cell-cell adhesion involved in gastrulation
2. P	GO:0001954	positive regulation of cell-matrix adhesion
2. P	GO:0032993	protein-DNA complex
2. P	GO:0060259	regulation of feeding behavior
2. P	GO:0000974	Prp19 complex
2. P	GO:0005171	hepatocyte growth factor receptor binding
2. P	GO:0045944	positive regulation of transcription by RNA polymerase II
2. P	GO:0005916	fascia adherens
2. P	GO:0060828	regulation of canonical Wnt signaling pathway
2. P	GO:0044782	cilium organization
2. P	GO:0099092	postsynaptic density, intracellular component
2. P	GO:0045453	bone resorption
2. P	GO:0035869	ciliary transition zone
2. P	GO:0022624	proteasome accessory complex
2. P	GO:1904954	canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation
2. P	GO:1901647	positive regulation of synoviocyte proliferation
2. P	GO:0043588	skin development
2. P	GO:0030682	mitigation of host defenses by symbiont
2. P	GO:0010976	positive regulation of neuron projection development
2. P	GO:0005635	nuclear envelope
2. P	GO:0008013	beta-catenin binding
2. P	GO:0090279	regulation of calcium ion import
2. P	GO:0051091	positive regulation of DNA-binding transcription factor activity
2. P	GO:1990907	beta-catenin-TCF complex
2. P	GO:0044093	positive regulation of molecular function
2. P	GO:0060947	cardiac vascular smooth muscle cell differentiation
2. P	GO:0021819	layer formation in cerebral cortex
2. P	GO:0060789	hair follicle placode formation
2. P	GO:0098831	presynaptic active zone cytoplasmic component
2. P	GO:0008134	transcription factor binding
2. P	GO:0010718	positive regulation of epithelial to mesenchymal transition
2. P	GO:0030374	nuclear receptor coactivator activity
2. P	GO:1904796	regulation of core promoter binding
2. P	GO:0034333	adherens junction assembly
2. P	GO:0045177	apical part of cell
2. P	GO:0042733	embryonic digit morphogenesis
2. P	GO:0048469	cell maturation
2. P	GO:0005643	nuclear pore
2. P	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
2. P	GO:0086091	regulation of heart rate by cardiac conduction
2. P	GO:0060440	trachea formation
2. P	GO:0005933	cellular bud
2. P	GO:0042129	regulation of T cell proliferation
2. P	GO:0000056	ribosomal small subunit export from nucleus
2. P	GO:0001179	RNA polymerase I general transcription initiation factor binding
2. P	GO:0030688	preribosome, small subunit precursor
2. P	GO:0061608	nuclear import signal receptor activity
2. P	GO:0006931	substrate-dependent cell migration, cell attachment to substrate
2. P	GO:0061154	endothelial tube morphogenesis
2. P	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
2. P	GO:2000142	regulation of DNA-templated transcription, initiation
2. P	GO:2000179	positive regulation of neural precursor cell proliferation
2. P	GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:2001234	negative regulation of apoptotic signaling pathway
2. P	GO:1990716	axonemal central apparatus
2. P	GO:2001034	positive regulation of double-strand break repair via nonhomologous end joining
2. P	GO:1902254	negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P	GO:0048513	animal organ development
2. P	GO:0045667	regulation of osteoblast differentiation
2. P	GO:0086073	bundle of His cell-Purkinje myocyte adhesion involved in cell communication
2. P	GO:0051561	positive regulation of mitochondrial calcium ion concentration
2. P	GO:0014010	Schwann cell proliferation
2. P	GO:0014901	satellite cell activation involved in skeletal muscle regeneration
2. P	GO:0005911	cell-cell junction
2. P	GO:0031430	M band
2. P	GO:0097091	synaptic vesicle clustering
2. P	GO:0071562	nucleus-vacuole junction assembly
2. P	GO:0048262	determination of dorsal/ventral asymmetry
2. P	GO:0031253	cell projection membrane
2. P	GO:0042692	muscle cell differentiation
2. P	GO:0070369	beta-catenin-TCF7L2 complex
2. P	GO:0000329	fungal-type vacuole membrane
2. P	GO:0007030	Golgi organization
2. P	GO:0034517	ribophagy
2. P	GO:0036023	embryonic skeletal limb joint morphogenesis
2. P	GO:2000055	positive regulation of Wnt signaling pathway involved in dorsal/ventral axis specification
2. P	GO:0099527	postsynapse to nucleus signaling pathway
2. P	GO:0006402	mRNA catabolic process
2. P	GO:0140297	DNA-binding transcription factor binding
2. P	GO:1903204	negative regulation of oxidative stress-induced neuron death
2. P	GO:0061324	canonical Wnt signaling pathway involved in positive regulation of cardiac outflow tract cell proliferation
2. P	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:1990075	periciliary membrane compartment
2. P	GO:0007165	signal transduction
2. P	GO:2000100	regulation of establishment or maintenance of bipolar cell polarity regulating cell shape
2. P	GO:0002244	hematopoietic progenitor cell differentiation
2. P	GO:0075506	entry of viral genome into host nucleus through nuclear pore complex via importin
2. P	GO:0006417	regulation of translation
2. P	GO:0070285	pigment cell development
2. P	GO:0009898	cytoplasmic side of plasma membrane
2. P	GO:0016342	catenin complex
2. P	GO:0035153	epithelial cell type specification, open tracheal system
2. P	GO:0014704	intercalated disc
2. P	GO:0031528	microvillus membrane
2. P	GO:0010004	gastrulation involving germ band extension
2. P	GO:0019901	protein kinase binding
2. P	GO:0051884	regulation of timing of anagen
2. P	GO:0048643	positive regulation of skeletal muscle tissue development
2. P	GO:0000922	spindle pole
2. P	GO:0001658	branching involved in ureteric bud morphogenesis
2. P	GO:0098911	regulation of ventricular cardiac muscle cell action potential
2. P	GO:0030057	desmosome
2. P	GO:0045671	negative regulation of osteoclast differentiation
2. P	GO:0060066	oviduct development
2. P	GO:0006470	protein dephosphorylation
2. P	GO:0097718	disordered domain specific binding
2. P	GO:0000932	P-body
2. P	GO:0032212	positive regulation of telomere maintenance via telomerase
2. P	GO:0031034	myosin filament assembly
2. P	GO:0072079	nephron tubule formation
2. P	GO:0061550	cranial ganglion development
2. P	GO:0030856	regulation of epithelial cell differentiation
2. P	GO:1902660	negative regulation of glucose mediated signaling pathway
2. P	GO:0001894	tissue homeostasis
2. P	GO:0031047	gene silencing by RNA
2. P	GO:0050998	nitric-oxide synthase binding
2. P	GO:0045670	regulation of osteoclast differentiation
2. P	GO:0030015	CCR4-NOT core complex
2. P	GO:0005912	adherens junction
2. P	GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P	GO:1904888	cranial skeletal system development
2. P	GO:1990909	Wnt signalosome
2. P	GO:0060983	epicardium-derived cardiac vascular smooth muscle cell differentiation
2. P	GO:0090219	negative regulation of lipid kinase activity
2. P	GO:0030997	regulation of centriole-centriole cohesion
2. P	GO:0090254	cell elongation involved in imaginal disc-derived wing morphogenesis
2. P	GO:0014017	neuroblast fate commitment
2. P	GO:0005096	GTPase activator activity
2. P	GO:0009953	dorsal/ventral pattern formation
2. P	GO:0010469	regulation of signaling receptor activity
2. P	GO:0001944	vasculature development
2. P	GO:0000904	cell morphogenesis involved in differentiation
2. P	GO:0007398	ectoderm development
2. P	GO:1990403	embryonic brain development
2. P	GO:1990138	neuron projection extension
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0044336	canonical Wnt signaling pathway involved in negative regulation of apoptotic process
2. P	GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
2. P	GO:0000578	embryonic axis specification
2. P	GO:0072033	renal vesicle formation
2. P	GO:0005085	guanyl-nucleotide exchange factor activity
2. P	GO:0046587	positive regulation of calcium-dependent cell-cell adhesion
2. P	GO:0003713	transcription coactivator activity
2. P	GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration
2. P	GO:1990226	histone methyltransferase binding
2. P	GO:0009948	anterior/posterior axis specification
2. P	GO:0062200	RAM/MOR signaling pathway
2. P	GO:0008285	negative regulation of cell population proliferation
2. P	GO:0031461	cullin-RING ubiquitin ligase complex
2. P	GO:0005915	zonula adherens
2. P	GO:0140516	mitotic nuclear pore complex disassembly
2. P	GO:0031641	regulation of myelination
2. P	GO:0060479	lung cell differentiation
2. P	GO:0043065	positive regulation of apoptotic process
2. P	GO:0008139	nuclear localization sequence binding
2. P	GO:0043539	protein serine/threonine kinase activator activity
2. P	GO:0051145	smooth muscle cell differentiation
2. P	GO:0036520	astrocyte-dopaminergic neuron signaling
2. P	GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway
2. P	GO:0071603	endothelial cell-cell adhesion
2. P	GO:0048526	imaginal disc-derived wing expansion
2. P	GO:0009954	proximal/distal pattern formation
2. P	GO:0061549	sympathetic ganglion development
2. P	GO:0044338	canonical Wnt signaling pathway involved in mesenchymal stem cell differentiation
2. P	GO:0046667	compound eye retinal cell programmed cell death
2. P	GO:0071255	Cvt vesicle assembly
2. P	GO:0000147	actin cortical patch assembly
2. P	GO:0034394	protein localization to cell surface
2. P	GO:0030686	90S preribosome
2. P	GO:0060769	positive regulation of epithelial cell proliferation involved in prostate gland development
2. P	GO:1904948	midbrain dopaminergic neuron differentiation
2. P	GO:0043525	positive regulation of neuron apoptotic process
2. P	GO:0016600	flotillin complex
2. P	GO:0007403	glial cell fate determination
2. P	GO:0003338	metanephros morphogenesis
2. P	GO:0010800	positive regulation of peptidyl-threonine phosphorylation
2. P	GO:0000045	autophagosome assembly
2. P	GO:0007155	cell adhesion
2. P	GO:0044732	mitotic spindle pole body
2. P	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
2. P	GO:0071363	cellular response to growth factor stimulus
2. P	GO:0007367	segment polarity determination
2. P	GO:0019899	enzyme binding
2. P	GO:1902554	serine/threonine protein kinase complex
2. P	GO:0061198	fungiform papilla formation
2. P	GO:0080034	host response to induction by symbiont of tumor, nodule or growth in host
2. P	GO:1903863	P granule assembly
2. P	GO:0005828	kinetochore microtubule
2. P	GO:0002159	desmosome assembly
2. P	GO:1904798	positive regulation of core promoter binding
2. P	GO:0016327	apicolateral plasma membrane
2. P	GO:0070209	ASTRA complex
2. P	GO:0033234	negative regulation of protein sumoylation
2. P	GO:0014841	skeletal muscle satellite cell proliferation
2. P	GO:0060135	maternal process involved in female pregnancy
2. P	GO:0048599	oocyte development
2. P	GO:0000011	vacuole inheritance
2. P	GO:0048538	thymus development
2. P	GO:0031334	positive regulation of protein-containing complex assembly
2. P	GO:0001702	gastrulation with mouth forming second
2. P	GO:0016331	morphogenesis of embryonic epithelium
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0016021	integral component of membrane
2. P	GO:0031952	regulation of protein autophosphorylation
2. P	GO:0071561	nucleus-vacuole junction
2. P	GO:0086083	cell adhesive protein binding involved in bundle of His cell-Purkinje myocyte communication
2. P	GO:0050982	detection of mechanical stimulus
2. P	GO:0003340	negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
2. P	GO:0040029	regulation of gene expression, epigenetic
2. P	GO:0005813	centrosome
2. P	GO:0016525	negative regulation of angiogenesis
2. P	GO:0007186	G protein-coupled receptor signaling pathway
2. P	GO:0005829	cytosol
2. P	GO:0070317	negative regulation of G0 to G1 transition
2. P	GO:0072053	renal inner medulla development
2. P	GO:0022009	central nervous system vasculogenesis
2. P	GO:0072182	regulation of nephron tubule epithelial cell differentiation
2. P	GO:0035050	embryonic heart tube development
2. P	GO:0033077	T cell differentiation in thymus
2. P	GO:0017022	myosin binding
2. P	GO:0030289	protein phosphatase 4 complex
2. P	GO:0005882	intermediate filament
2. P	GO:0071933	Arp2/3 complex binding
2. P	GO:0034332	adherens junction organization
2. P	GO:0035556	intracellular signal transduction
2. P	GO:0006607	NLS-bearing protein import into nucleus
2. P	GO:0006361	transcription initiation from RNA polymerase I promoter
2. P	GO:0043666	regulation of phosphoprotein phosphatase activity
2. P	GO:0007291	sperm individualization
2. P	GO:0016445	somatic diversification of immunoglobulins
2. P	GO:0071563	Myo2p-Vac17p-Vac8p transport complex
2. P	GO:0005938	cell cortex
2. P	GO:0005654	nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q6PIY5	Armadillo-like helical domain containing protein 1	0	8.01e-152	0.0
1. PB	A7MBF6	Armadillo-like helical domain containing protein 1	0.00e+00	1.88e-82	0.0
2. P	Q8BVE3	V-type proton ATPase subunit H	2.35e-07	7.44e-03	NA
2. P	Q8BGV4	TELO2-interacting protein 2	1.10e-06	8.62e-04	NA
2. P	A3LUY1	Hsp70 nucleotide exchange factor FES1	3.72e-06	2.40e-03	NA
2. P	Q9VM21	Armadillo repeat-containing protein gudu	8.00e-07	2.59e-02	NA
2. P	Q9JLI7	Sperm-associated antigen 6	8.30e-07	7.16e-06	NA
2. P	Q9D2C2	Protein SAAL1	4.89e-07	4.57e-10	NA
2. P	P14923	Junction plakoglobin	2.84e-05	3.84e-09	NA
2. P	Q801Q7	Serine/threonine-protein phosphatase 4 regulatory subunit 3-B	2.94e-03	3.21e-03	NA
2. P	Q5ZML1	Importin subunit alpha-5	8.48e-07	6.58e-04	NA
2. P	Q8C3I8	Protein HGH1 homolog	6.30e-06	1.29e-05	NA
2. P	Q80X86	Armadillo repeat-containing protein 12	2.25e-05	6.79e-04	NA
2. P	O35343	Importin subunit alpha-3	1.27e-06	7.85e-06	NA
2. P	P36070	RNA polymerase I-specific transcription initiation factor RRN3	1.45e-03	3.62e-02	NA
2. P	A2RTY3	Protein HEATR9	4.04e-04	7.00e-04	NA
2. P	P32464	Protein HYM1	2.42e-05	1.08e-09	NA
2. P	Q9UUK1	Beta-catenin-like protein 1 homolog	3.12e-05	8.72e-09	NA
2. P	A8XDF8	Probable V-type proton ATPase subunit H 1	8.00e-08	4.28e-03	NA
2. P	Q5R909	Importin subunit alpha-5	1.65e-06	6.44e-04	NA
2. P	P35222	Catenin beta-1	9.29e-07	3.02e-10	NA
2. P	Q2U5T5	Vacuolar protein 8	4.15e-08	1.01e-08	NA
2. P	C5JK19	Nucleolar protein 9	1.72e-03	2.07e-04	NA
2. P	Q2TBW0	Ataxin-10	9.39e-08	7.51e-03	NA
2. P	Q9WU82	Catenin beta-1	5.34e-06	2.13e-10	NA
2. P	O18178	Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1	1.15e-05	2.92e-05	NA
2. P	A4FV68	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform	3.85e-06	4.81e-06	NA
2. P	O94374	Importin subunit alpha-2	9.65e-08	4.04e-03	NA
2. P	B1WBW4	Armadillo repeat-containing protein 10	3.28e-06	4.73e-05	NA
2. P	P47168	TEL2-interacting protein 2	6.72e-06	7.15e-03	NA
2. P	Q5FVB0	Ataxin-10	2.97e-07	4.57e-05	NA
2. P	Q5K6N0	Transmembrane protein 232	1.42e-03	1.14e-02	NA
2. P	D4AMF9	Nucleolar protein 9	2.35e-03	1.33e-03	NA
2. P	P52295	Importin subunit alpha	5.83e-07	1.72e-05	NA
2. P	A7MB47	CCR4-NOT transcription complex subunit 9	6.81e-07	1.96e-09	NA
2. P	P83953	Importin subunit alpha-5	1.31e-06	7.61e-04	NA
2. P	O74771	Protein dip1	1.01e-04	2.38e-11	NA
2. P	P36589	Cell division control protein 14	5.94e-06	1.82e-03	NA
2. P	Q0P5A6	26S proteasome non-ATPase regulatory subunit 5	2.13e-06	8.62e-12	NA
2. P	Q7RXW1	Vacuolar protein 8	2.04e-08	5.85e-08	NA
2. P	Q17GS9	Armadillo segment polarity protein	2.83e-06	1.67e-07	NA
2. P	Q22494	Probable V-type proton ATPase subunit H 2	3.94e-07	3.14e-04	NA
2. P	A9QM74	Importin subunit alpha-8	1.60e-06	5.65e-03	NA
2. P	Q75E32	Serine/threonine-protein phosphatase 4 regulatory subunit 3	2.01e-03	1.86e-03	NA
2. P	Q6FR44	Serine/threonine-protein phosphatase 4 regulatory subunit 3	6.06e-04	4.87e-06	NA
2. P	Q18825	Beta-catenin/armadillo-related protein 1	1.06e-05	4.00e-03	NA
2. P	Q80W83	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform	6.83e-06	1.97e-02	NA
2. P	Q0V7M0	Importin subunit alpha-7	1.36e-06	1.07e-03	NA
2. P	Q60996	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	1.54e-05	5.46e-10	NA
2. P	Q75B89	Hsp70 nucleotide exchange factor FES1	1.44e-05	4.18e-06	NA
2. P	Q8WYA6	Beta-catenin-like protein 1	1.62e-05	3.74e-09	NA
2. P	Q5SP90	Serine/threonine-protein phosphatase 4 regulatory subunit 3	7.30e-04	6.88e-03	NA
2. P	Q6I621	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	2.43e-06	7.00e-04	NA
2. P	Q6C239	Hsp70 nucleotide exchange factor FES1	4.06e-06	1.40e-05	NA
2. P	O43028	Vacuolar protein 8	8.00e-09	2.22e-09	NA
2. P	Q80XE1	Synembryn-B	1.42e-06	2.01e-06	NA
2. P	Q5R6Z6	CCR4-NOT transcription complex subunit 9	8.57e-07	1.86e-09	NA
2. P	Q6DRJ9	Synembryn-B	1.05e-06	7.13e-07	NA
2. P	Q196Z9	Uncharacterized protein 061R	NA	2.45e-03	NA
2. P	P27351	AP-2 complex subunit beta	2.49e-04	3.18e-02	NA
2. P	O00505	Importin subunit alpha-4	8.82e-07	2.21e-06	NA
2. P	E5QZZ6	Nucleolar protein 9	2.28e-03	9.86e-03	NA
2. P	Q9GSX9	Synembryn	1.06e-06	1.94e-03	NA
2. P	Q02248	Catenin beta-1	3.18e-06	2.74e-10	NA
2. P	Q4V8D9	Leucine-rich repeat-containing protein 34	2.91e-02	7.77e-04	NA
2. P	E5A2Z3	Nucleolar protein 9	1.18e-03	2.38e-04	NA
2. P	Q8BQX5	Transmembrane and coiled-coil domain-containing protein 6	1.24e-07	2.19e-03	NA
2. P	P53036	SIT4-associating protein SAP4	7.24e-04	8.27e-04	NA
2. P	Q28BM0	Dymeclin	9.51e-05	5.52e-07	NA
2. P	A8HNV0	Radial spoke protein 14	2.67e-08	7.75e-09	NA
2. P	Q2GW27	Vacuolar protein 8	2.20e-08	1.28e-07	NA
2. P	C5G8V2	Nucleolar protein 9	1.24e-03	4.37e-04	NA
2. P	A8XBZ8	Beta-catenin/armadillo-related protein 1	4.00e-05	1.14e-04	NA
2. P	Q9CWL8	Beta-catenin-like protein 1	2.47e-05	1.86e-08	NA
2. P	P52306	Rap1 GTPase-GDP dissociation stimulator 1	6.14e-06	1.36e-02	NA
2. P	O44169	Pumilio domain-containing protein 7	7.91e-04	1.98e-02	NA
2. P	Q9ZQ77	MO25-like protein At2g03410	4.39e-06	1.67e-09	NA
2. P	Q7ZX60	Serine/threonine-protein phosphatase 4 regulatory subunit 3-A	1.43e-03	5.22e-03	NA
2. P	Q96DC7	Transmembrane and coiled-coil domain-containing protein 6	7.46e-07	9.37e-04	NA
2. P	Q4R744	Protein HEATR9	3.16e-05	1.14e-02	NA
2. P	C6K7I2	Importin subunit alpha-8	5.00e-08	4.46e-04	NA
2. P	Q75A44	Protein LDB17	3.47e-05	7.89e-03	NA
2. P	Q5R8F5	Synembryn-A	8.31e-07	2.98e-04	NA
2. P	Q28651	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	8.68e-06	3.55e-08	NA
2. P	Q02453	Armadillo segment polarity protein	3.07e-06	7.49e-10	NA
2. P	Q9FJ92	Importin subunit alpha-8	4.26e-08	1.59e-08	NA
2. P	Q06138	Calcium-binding protein 39	5.17e-05	6.55e-11	NA
2. P	Q19969	Importin subunit alpha-3	5.82e-07	1.06e-06	NA
2. P	Q4V8K2	Beta-catenin-like protein 1	2.61e-06	9.09e-07	NA
2. P	Q9XFY6	Degreening-related gene dee76 protein	1.60e-05	3.96e-13	NA
2. P	Q7QHW5	Armadillo segment polarity protein	3.06e-06	1.51e-07	NA
2. P	Q619W9	Probable V-type proton ATPase subunit H 2	4.11e-07	6.31e-05	NA
2. P	O42972	UPF0588 membrane protein C20F10.02c	2.27e-04	3.77e-03	NA
2. P	Q6PD03	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform	6.95e-06	2.11e-06	NA
2. P	Q8C3R1	BRCA1-associated ATM activator 1	1.30e-04	1.75e-02	NA
2. P	Q6IP65	CCR4-NOT transcription complex subunit 9	4.96e-07	2.94e-09	NA
2. P	P25355	Copper transport protein 86	6.58e-05	4.12e-02	NA
2. P	Q8CHY3	Dymeclin	6.96e-05	9.46e-04	NA
2. P	O46563	V-type proton ATPase subunit H	2.08e-06	1.52e-02	NA
2. P	Q5ZLW3	Dymeclin	8.50e-05	2.44e-05	NA
2. P	Q6P0K8	Junction plakoglobin	4.75e-06	1.09e-08	NA
2. P	Q7RTS9	Dymeclin	2.33e-04	3.41e-03	NA
2. P	B9DHT4	ARM REPEAT PROTEIN INTERACTING WITH ABF2	4.85e-08	3.30e-02	NA
2. P	Q93YV6	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	7.74e-06	2.81e-02	NA
2. P	P40164	Serine/threonine-protein phosphatase 4 regulatory subunit 3	6.28e-03	2.64e-05	NA
2. P	C1FYU3	Nucleolar protein 9	1.69e-03	1.73e-03	NA
2. P	Q4I1B1	Vacuolar protein 8	9.62e-09	1.41e-11	NA
2. P	Q9FGK3	Putative MO25-like protein At5g47540	2.22e-05	9.32e-11	NA
2. P	Q9TVC1	V-type proton ATPase subunit H	2.41e-06	2.00e-03	NA
2. P	O93614	Rap1 GTPase-GDP dissociation stimulator 1-A	7.78e-06	3.08e-03	NA
2. P	Q5E9J8	Synembryn-A	8.37e-07	1.39e-06	NA
2. P	Q92990	Glomulin	6.17e-05	3.87e-07	NA
2. P	Q4S6U8	Serine/threonine-protein phosphatase 4 regulatory subunit 3	6.58e-04	1.51e-02	NA
2. P	Q6CX49	Vacuolar protein 8	4.00e-07	5.32e-10	NA
2. P	Q16537	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform	1.18e-05	4.81e-06	NA
2. P	Q8BZM1	Glomulin	7.46e-05	1.41e-05	NA
2. P	O14265	V-type proton ATPase subunit H	8.25e-07	7.73e-03	NA
2. P	E9Q912	Rap1 GTPase-GDP dissociation stimulator 1	7.59e-06	3.14e-04	NA
2. P	P35791	Bilin biosynthesis protein PecE	7.33e-04	4.20e-03	NA
2. P	Q59NN8	Hsp70 nucleotide exchange factor FES1	1.89e-06	2.92e-05	NA
2. P	O60684	Importin subunit alpha-7	4.31e-07	4.83e-03	NA
2. P	O60077	Armadillo repeat-containing zfs1 target protein 1	1.41e-06	1.21e-03	NA
2. P	Q9UHP6	Radial spoke head 14 homolog	6.15e-10	3.90e-06	NA
2. P	Q5RD03	Armadillo repeat-containing protein 6	2.88e-08	2.13e-06	NA
2. P	Q92600	CCR4-NOT transcription complex subunit 9	8.57e-07	1.86e-09	NA
2. P	P0CN69	Hsp70 nucleotide exchange factor FES1	1.69e-04	3.84e-03	NA
2. P	O43005	AP-2 complex subunit beta	1.15e-04	2.49e-02	NA
2. P	P30998	Junction plakoglobin	4.45e-06	4.70e-10	NA
2. P	O01322	Pumilio domain-containing protein 6	1.19e-03	2.66e-02	NA
2. P	Q5PQL2	CCR4-NOT transcription complex subunit 9	6.99e-07	1.96e-09	NA
2. P	Q02257	Junction plakoglobin	4.75e-06	2.90e-09	NA
2. P	Q6DGR4	Protein HGH1 homolog	5.28e-06	1.10e-05	NA
2. P	P35223	Catenin beta	1.85e-05	1.23e-07	NA
2. P	Q66H54	FHF complex subunit HOOK interacting protein 1B	2.23e-03	1.40e-05	NA
2. P	Q9M9X7	Importin subunit alpha-7	5.14e-07	7.20e-05	NA
2. P	Q6DCP5	Protein saal1	1.06e-06	2.75e-09	NA
2. P	Q9M0M4	Putative MO25-like protein At4g17270	4.79e-05	1.04e-10	NA
2. P	Q9V3J1	V-type proton ATPase subunit H	1.87e-07	7.05e-07	NA
2. P	Q6NXE6	Armadillo repeat-containing protein 6	2.58e-08	1.92e-05	NA
2. P	Q6FM01	Hsp70 nucleotide exchange factor FES1	1.04e-05	5.94e-07	NA
2. P	O35345	Importin subunit alpha-7	3.01e-07	2.00e-03	NA
2. P	Q16401	26S proteasome non-ATPase regulatory subunit 5	2.02e-06	2.02e-09	NA
2. P	Q13362	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	1.87e-05	1.67e-09	NA
2. P	Q9H9S4	Calcium-binding protein 39-like	4.05e-05	3.63e-12	NA
2. P	O76187	Darlin	2.69e-05	1.93e-02	NA
2. P	Q9BTY7	Protein HGH1 homolog	7.63e-05	2.14e-07	NA
2. P	Q8BJY1	26S proteasome non-ATPase regulatory subunit 5	7.59e-06	5.07e-07	NA
2. P	P43612	SIT4-associating protein SAP155	2.77e-03	2.14e-02	NA
2. P	Q66H56	TELO2-interacting protein 2	4.45e-06	1.05e-04	NA
2. P	D4D9R6	Nucleolar protein 9	2.57e-03	2.98e-04	NA
2. P	Q76NW7	Protein HGH1 homolog	2.57e-06	8.69e-03	NA
2. P	Q9DAM1	Leucine-rich repeat-containing protein 34	1.96e-02	1.58e-04	NA
2. P	Q96321	Importin subunit alpha-1	1.05e-06	1.19e-05	NA
2. P	O04375	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' alpha isoform	1.14e-06	3.76e-02	NA
2. P	Q03124	Chromatin structure-remodeling complex subunit RSC9	6.40e-04	1.72e-02	NA
2. P	A6S374	Nucleolar protein 9	6.08e-03	1.84e-02	NA
2. P	P70188	Kinesin-associated protein 3	5.00e-05	1.61e-08	NA
2. P	Q9FJ09	Importin subunit alpha-5	2.43e-09	1.26e-05	NA
2. P	Q96ER3	Protein SAAL1	1.01e-05	3.26e-07	NA
2. P	Q9Y7J8	Uncharacterized protein C216.01c	1.10e-04	2.00e-02	NA
2. P	B6HJ92	Importin subunit alpha	6.62e-07	1.18e-02	NA
2. P	O74447	Uncharacterized protein C16C4.02c	7.41e-05	9.80e-05	NA
2. P	B2W8X8	Nucleolar protein 9	1.04e-03	1.09e-04	NA
2. P	Q9JLV2	Short transient receptor potential channel 4-associated protein	9.31e-04	3.52e-02	NA
2. P	F4JL11	Importin subunit alpha-2	1.27e-06	6.31e-05	NA
2. P	Q60960	Importin subunit alpha-5	1.28e-06	2.15e-03	NA
2. P	Q28647	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform	8.73e-06	2.50e-03	NA
2. P	Q6CLP9	DNA mismatch repair protein HSM3	1.73e-05	6.10e-05	NA
2. P	Q4WVW4	Vacuolar protein 8	3.70e-07	1.31e-08	NA
2. P	Q92347	Nucleolar protein 9	9.81e-04	1.67e-02	NA
2. P	Q9VBG6	Protein HGH1 homolog	2.02e-05	7.15e-04	NA
2. P	C4R8S9	Nucleolar protein 9	1.38e-03	1.94e-03	NA
2. P	Q5ZL77	Synembryn-A	8.78e-07	5.05e-05	NA
2. P	Q8SPJ1	Junction plakoglobin	4.63e-06	1.15e-08	NA
2. P	O80480	Importin subunit alpha-4	1.75e-06	8.52e-03	NA
2. P	B4F766	Dymeclin	9.30e-05	6.18e-04	NA
2. P	Q6IN85	Serine/threonine-protein phosphatase 4 regulatory subunit 3A	4.24e-03	3.55e-03	NA
2. P	Q3KQ45	Protein HGH1 homolog	3.91e-05	1.51e-05	NA
2. P	Q9W358	Synembryn	1.39e-05	2.77e-06	NA
2. P	Q297A7	Protein HGH1 homolog	2.94e-05	1.53e-04	NA
2. P	P73638	Phycocyanobilin lyase subunit alpha	2.22e-04	2.29e-02	NA
2. P	Q29IC2	Synembryn	6.01e-06	5.48e-06	NA
2. P	O13986	Uncharacterized protein C26H5.04	5.01e-06	4.20e-03	NA
2. P	P91891	Protein Mo25	2.55e-05	1.70e-12	NA
2. P	O75602	Sperm-associated antigen 6	6.77e-07	5.94e-06	NA
2. P	C1JZ66	Importin subunit alpha-8	3.59e-07	8.52e-03	NA
2. P	P0CM60	Vacuolar protein 8	4.20e-08	1.72e-09	NA
2. P	Q9UBB4	Ataxin-10	9.53e-08	6.44e-04	NA
2. P	O15131	Importin subunit alpha-6	1.36e-07	7.81e-03	NA
2. P	Q5RBV0	Importin subunit alpha-7	6.43e-07	4.83e-03	NA
2. P	O00629	Importin subunit alpha-3	7.02e-08	1.20e-05	NA
2. P	Q803M5	Protein saal1	4.40e-06	1.84e-12	NA
2. P	Q15172	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform	7.05e-06	7.76e-06	NA
2. P	Q59PP0	DNA mismatch repair protein HSM3	1.51e-05	6.88e-09	NA
2. P	P0CM61	Vacuolar protein 8	3.72e-08	1.72e-09	NA
2. P	Q26626	Kinesin-associated protein 3	3.59e-05	1.92e-05	NA
2. P	Q9TZM2	MO25-like protein 3	5.25e-04	4.32e-05	NA
2. P	Q7S5H0	Nucleolar protein 9	4.62e-03	3.55e-02	NA
2. P	Q92845	Kinesin-associated protein 3	1.95e-05	1.99e-08	NA
2. P	Q9NVN3	Synembryn-B	1.54e-06	2.01e-06	NA
2. P	Q6P819	CCR4-NOT transcription complex subunit 9	6.39e-06	2.94e-09	NA
2. P	Q9NYV6	RNA polymerase I-specific transcription initiation factor RRN3	1.81e-03	1.53e-02	NA
2. P	Q7K486	Armadillo repeat-containing protein 6 homolog	4.20e-08	3.27e-12	NA
2. P	O35344	Importin subunit alpha-4	1.04e-06	1.23e-06	NA
2. P	P38348	DNA mismatch repair protein HSM3	1.30e-05	5.45e-04	NA
2. P	Q84ZC0	Probable V-type proton ATPase subunit H	4.89e-09	1.06e-03	NA
2. P	C0S4C4	Nucleolar protein 9	1.76e-03	3.57e-04	NA
2. P	Q10498	Protein HGH1 homolog	8.39e-06	2.95e-02	NA
2. P	Q9D0L7	Armadillo repeat-containing protein 10	2.81e-06	1.25e-05	NA
2. P	O43030	Hsp70 nucleotide exchange factor fes1	3.29e-05	8.27e-04	NA
2. P	A3LY92	DNA mismatch repair protein HSM3	3.66e-05	1.49e-07	NA
2. P	Q4R4Y2	Ataxin-10	7.68e-08	1.98e-03	NA
2. P	Q9JKY0	CCR4-NOT transcription complex subunit 9	6.71e-07	1.96e-09	NA
2. P	Q6PD28	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform	9.08e-06	3.39e-02	NA
2. P	Q922R5	Serine/threonine-protein phosphatase 4 regulatory subunit 3B	2.23e-03	2.42e-03	NA
2. P	Q1RLU1	BRCA1-associated ATM activator 1	1.90e-04	2.68e-02	NA
2. P	P41843	Uncharacterized protein T20B12.3	4.57e-04	1.34e-02	NA
2. P	C1H8W8	Nucleolar protein 9	5.03e-03	4.20e-03	NA
2. P	Q61151	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform	4.89e-06	5.54e-06	NA
2. P	Q9FWY7	Importin subunit alpha-6	1.56e-06	6.86e-04	NA
2. P	P35224	Catenin beta	2.13e-06	1.55e-07	NA
2. P	Q6CTY9	Copper transport protein 86	3.67e-05	2.86e-04	NA
2. P	E3RP32	Nucleolar protein 9	9.45e-04	6.65e-04	NA
2. P	Q4P7F2	Hsp70 nucleotide exchange factor FES1	5.14e-05	6.74e-05	NA
2. P	Q6DCP6	Dymeclin	1.37e-04	5.23e-06	NA
2. P	O74867	Uncharacterized protein C18.17c	3.82e-05	4.16e-03	NA
2. P	B6K1Y8	Nucleolar protein 9	1.30e-03	1.03e-03	NA
2. P	Q757R0	Vacuolar protein 8	1.95e-06	2.29e-06	NA
2. P	P52171	Importin subunit alpha-1	1.27e-06	1.82e-03	NA
2. P	Q02821	Importin subunit alpha	1.23e-06	2.95e-04	NA
2. P	B1WBT0	Transmembrane protein 232	5.87e-04	7.45e-04	NA
2. P	Q9DB16	Calcium-binding protein 39-like	4.03e-05	5.97e-13	NA
2. P	Q9ZQY6	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B' delta isoform	3.27e-06	2.44e-02	NA
2. P	P50038	Phycocyanobilin lyase subunit beta	8.97e-07	3.00e-02	NA
2. P	P52294	Importin subunit alpha-5	7.86e-07	6.11e-04	NA
2. P	Q04173	Rap1 GTPase-GDP dissociation stimulator 1	1.34e-06	5.00e-05	NA
2. P	P38260	Hsp70 nucleotide exchange factor FES1	3.55e-06	9.07e-05	NA
2. P	Q61A92	Synembryn	1.76e-06	2.96e-03	NA
2. P	Q9Y376	Calcium-binding protein 39	4.58e-05	3.60e-11	NA
2. P	P0CN68	Hsp70 nucleotide exchange factor FES1	1.42e-04	3.84e-03	NA
2. P	P39968	Vacuolar protein 8	3.14e-07	1.33e-07	NA
2. P	Q6P4W7	Synembryn-A	5.61e-07	4.60e-04	NA
2. P	O42973	Uncharacterized protein C20F10.03	1.33e-04	3.97e-07	NA
2. P	Q6BU68	DNA mismatch repair protein HSM3	3.51e-05	4.81e-09	NA
2. P	Q9SLX0	Importin subunit alpha-1b	1.11e-06	1.60e-04	NA
2. P	D1ZSG5	Nucleolar protein 9	3.37e-03	3.30e-02	NA
2. P	O60032	Conidiophore development protein hymA	7.84e-05	2.76e-05	NA
2. P	A8X6J7	MO25-like protein 3	2.34e-05	2.23e-03	NA
2. P	Q5QNV8	Protein HEATR9	2.04e-05	2.55e-05	NA
2. P	Q3TIR3	Synembryn-A	9.66e-07	5.28e-05	NA
2. P	O04376	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform	2.16e-05	2.38e-02	NA
2. P	Q75EM1	Copper transport protein 86	1.11e-04	4.28e-02	NA
2. P	Q6P2K6	Serine/threonine-protein phosphatase 4 regulatory subunit 3A	3.42e-03	2.06e-02	NA
2. P	O14063	Importin subunit alpha-1	6.43e-07	7.30e-04	NA
2. P	Q6INN7	Serine/threonine-protein phosphatase 4 regulatory subunit 3	3.50e-03	4.96e-02	NA
2. P	Q6FJV1	Vacuolar protein 8	2.01e-08	5.77e-08	NA
2. P	Q8MML6	V-type proton ATPase subunit H	3.08e-06	2.38e-05	NA
2. P	Q4R720	Synembryn-A	9.54e-07	5.52e-05	NA
2. P	A4RBW8	Pre-rRNA-processing protein IPI1	1.32e-03	3.69e-02	NA
2. P	C5P9D1	Nucleolar protein 9	1.81e-03	3.42e-04	NA
2. P	A2VE08	Importin subunit alpha-5	5.51e-07	4.85e-04	NA
2. P	Q9H6L4	Armadillo repeat-containing protein 7	1.17e-06	1.64e-02	NA
2. P	O04294	Importin subunit alpha-3	2.01e-06	4.76e-06	NA
2. P	Q66KK3	Protein HGH1 homolog	4.10e-05	1.04e-05	NA
2. P	Q9D3W1	Radial spoke head 14 homolog	2.46e-11	1.02e-04	NA
2. P	A2R3A7	Nucleolar protein 9	1.95e-03	1.17e-02	NA
2. P	Q7KNA0	Dymeclin	4.15e-04	1.98e-03	NA
2. P	Q6BTZ4	Vacuolar protein 8	1.89e-07	2.78e-08	NA
2. P	B6V8E6	Catenin beta-1	2.99e-06	2.13e-10	NA
2. P	O62703	Beta-catenin-like protein 1	2.68e-06	3.04e-08	NA
2. P	G5EB89	Importin subunit alpha	1.41e-06	7.73e-03	NA
2. P	Q8WNW3	Junction plakoglobin	4.72e-06	6.44e-09	NA
2. P	O18211	MO25-like protein 2	3.47e-05	2.70e-11	NA
2. P	Q59MN0	Vacuolar protein 8	1.94e-08	1.79e-03	NA
2. P	Q5RE06	Ataxin-10	1.58e-07	1.74e-04	NA
2. P	Q6BKV2	Copper transport protein 86	5.90e-06	3.62e-02	NA
2. P	Q6DFT3	Serine/threonine-protein phosphatase 4 regulatory subunit 3	1.11e-03	3.02e-03	NA
2. P	F1QGH7	Catenin beta-1	1.44e-05	1.99e-10	NA
2. P	Q6BLA1	Hsp70 nucleotide exchange factor FES1	6.27e-06	1.60e-04	NA
2. P	Q503E9	Importin subunit alpha-6	1.39e-07	3.08e-03	NA
2. P	Q15173	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform	8.99e-06	1.22e-02	NA
2. P	Q71VM4	Importin subunit alpha-1a	1.83e-06	9.38e-05	NA
2. P	Q9VYG1	26S proteasome non-ATPase regulatory subunit 5	2.55e-05	9.58e-08	NA
2. P	Q29RI6	Calcium-binding protein 39	4.57e-05	3.60e-11	NA
2. P	Q6CNM7	Hsp70 nucleotide exchange factor FES1	1.52e-05	3.73e-07	NA
2. P	Q20666	Probable V-type proton ATPase subunit H 1	5.73e-07	2.05e-04	NA
2. P	Q6C5Y8	Vacuolar protein 8	3.85e-08	6.32e-07	NA
2. P	P52170	Importin subunit alpha-5	1.06e-06	5.39e-04	NA
2. P	Q80ZG0	Synembryn-B	1.46e-06	1.56e-07	NA
2. P	Q0VCX4	Catenin beta-1	1.19e-05	2.13e-10	NA
2. P	Q29I35	Armadillo segment polarity protein	3.70e-06	2.38e-08	NA
2. P	B2RS91	RNA polymerase I-specific transcription initiation factor RRN3	1.40e-03	9.46e-04	NA
2. P	Q22560	Importin subunit alpha-1	4.16e-06	3.15e-06	NA
2. P	Q76P29	Importin subunit alpha-B	5.22e-07	2.36e-05	NA
2. P	Q92368	Cell differentiation protein rcd1	1.46e-05	3.16e-08	NA
2. P	Q6AY79	Protein HGH1 homolog	2.21e-05	2.16e-07	NA
2. P	O22478	Importin subunit alpha	4.80e-07	3.24e-03	NA
2. P	A1CKL4	Nucleolar protein 9	1.23e-03	3.33e-02	NA
2. P	Q12342	Protein LDB17	6.86e-04	4.89e-05	NA
2. P	Q3UJZ3	Armadillo repeat-containing protein 7	1.42e-06	1.55e-03	NA
2. P	Q45TX8	Synembryn-A	4.38e-06	1.67e-04	NA
2. P	C9JQI7	Transmembrane protein 232	5.68e-04	2.68e-03	NA
2. P	Q9LX65	V-type proton ATPase subunit H	3.08e-06	1.75e-02	NA
2. P	Q9UI12	V-type proton ATPase subunit H	7.40e-07	1.72e-03	NA
2. P	O44326	Beta-catenin-like protein hmp-2	2.06e-06	1.62e-05	NA
2. P	Q6NWL4	CCR4-NOT transcription complex subunit 9	5.63e-07	2.20e-08	NA
2. P	Q6NXR4	TELO2-interacting protein 2	2.99e-06	1.53e-07	NA
2. P	P26233	Catenin beta-1	2.11e-06	3.42e-10	NA
2. P	Q80ZG1	Synembryn-A	2.40e-07	1.75e-07	NA
2. P	Q56R16	Importin subunit alpha-6	6.06e-07	1.96e-03	NA
2. P	Q4R347	CCR4-NOT transcription complex subunit 9	6.72e-07	1.96e-09	NA
2. P	Q5T9G4	Armadillo repeat-containing protein 12	2.85e-06	7.36e-03	NA
2. P	Q5IFJ8	26S proteasome non-ATPase regulatory subunit 5	9.57e-06	7.16e-09	NA
2. P	C0LLJ0	Importin subunit alpha-8	2.23e-06	2.23e-04	NA
2. P	Q0U154	Nucleolar protein 9	4.73e-03	5.88e-03	NA
2. P	Q0P4Q0	FHF complex subunit HOOK interacting protein 2B	1.32e-04	5.76e-03	NA
2. P	P18824	Armadillo segment polarity protein	3.07e-06	2.42e-07	NA
2. P	Q5RAW5	Dymeclin	2.69e-04	2.68e-03	NA
2. P	Q8BNU0	Armadillo repeat-containing protein 6	1.44e-08	1.38e-10	NA
2. P	Q5MIZ7	Serine/threonine-protein phosphatase 4 regulatory subunit 3B	1.30e-03	1.01e-02	NA
2. P	Q84VX3	Aberrant root formation protein 4	5.14e-05	2.38e-02	NA
2. P	Q293C2	Dymeclin	4.52e-04	1.63e-04	NA
2. P	Q5EFZ4	Vacuolar protein 8	6.67e-08	1.48e-09	NA
2. P	Q9U5N0	V-type proton ATPase subunit H	1.52e-07	2.24e-06	NA
2. P	Q6NVK9	Protein saal1	1.09e-06	3.65e-11	NA
2. P	Q9NPQ8	Synembryn-A	9.26e-07	4.32e-05	NA
2. P	Q9P7Q8	Mo25-like protein	1.99e-05	1.16e-14	NA