Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q9Z2X2
(26S proteasome non-ATPase regulatory subunit 10) with a FATCAT P-Value: 0.0 and RMSD of 2.19 angstrom. The sequence alignment identity is 13.3%.
Structural alignment shown in left. Query protein Q6S8J7 colored as red in alignment, homolog Q9Z2X2 colored as blue.
Query protein Q6S8J7 is also shown in right top, homolog Q9Z2X2 showed in right bottom. They are colored based on secondary structures.
Q6S8J7 MVAEVSPKLAASPMKKPFGFRGKM-GKWCCCCFPCCR--GSGKNNMGAWRDH---DDSAFTEPRYHVRREDLGKLHRAAWWGEVPRADLIVMLRG-PGIN 93 Q9Z2X2 -----------------------MEG--CVSNIMICNLAYSGK--LDELKERILADKSLAT--RTD--QDSRTALHWACSAGHTEIVEFLLQL-GVP-VN 67 Q6S8J7 KRDKKKRTALHLACANGNSEVVSLLLDRQCQLHVFDSKKRTALIKAVQCQEDECALMLLQHGTDPNLPDMYGNTALHYAVYNEDKL-MAKTLLLYGADIE 192 Q9Z2X2 DKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYDATAMHRAA-AKGNLKMVHILLFYKASTN 166 Q6S8J7 SKNKGGLTPLLLAVHGQKQRMVKFLIKKKANL---NALDRFGRTALILAVRCGSASIVSLLLQQNIDVFSQDV-FGQTAEDYAVSSHHSIICQLLSDYKE 288 Q9Z2X2 IQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEE---KTPLQVA-KGG----LGLILKRLAE--SEEASM------------------------- 231 Q6S8J7 NQMPNNSSGNSNPEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLTDGAAAGNGDGGLVPQRKSRKHENQQFPN 388 Q9Z2X2 ---------------------------------------------------------------------------------------------------- 231 Q6S8J7 TEIEEYHRPEKKSNEKNKVKSQIHSVDNLDDITWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQ 488 Q9Z2X2 ---------------------------------------------------------------------------------------------------- 231 Q6S8J7 MENMVHVLQK 498 Q9Z2X2 ---------- 231
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source | GO | Description |
---|---|---|
1. PB | GO:1904058 | positive regulation of sensory perception of pain |
1. PB | GO:0048471 | perinuclear region of cytoplasm |
1. PB | GO:0034142 | toll-like receptor 4 signaling pathway |
1. PB | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
1. PB | GO:0005096 | GTPase activator activity |
1. PB | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
1. PB | GO:1901222 | regulation of NIK/NF-kappaB signaling |
1. PB | GO:0051289 | protein homotetramerization |
1. PB | GO:0000151 | ubiquitin ligase complex |
1. PB | GO:0050955 | thermoception |
1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
1. PB | GO:0097604 | temperature-gated cation channel activity |
1. PB | GO:0034587 | piRNA metabolic process |
1. PB | GO:0030154 | cell differentiation |
1. PB | GO:0032695 | negative regulation of interleukin-12 production |
1. PB | GO:0046822 | regulation of nucleocytoplasmic transport |
1. PB | GO:1904385 | cellular response to angiotensin |
1. PB | GO:0004857 | enzyme inhibitor activity |
1. PB | GO:0070588 | calcium ion transmembrane transport |
1. PB | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
1. PB | GO:0035304 | regulation of protein dephosphorylation |
1. PB | GO:0071359 | cellular response to dsRNA |
1. PB | GO:0071546 | pi-body |
1. PB | GO:0071316 | cellular response to nicotine |
1. PB | GO:0019208 | phosphatase regulator activity |
1. PB | GO:0007283 | spermatogenesis |
1. PB | GO:0005216 | ion channel activity |
1. PB | GO:0006816 | calcium ion transport |
1. PB | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
1. PB | GO:0035994 | response to muscle stretch |
1. PB | GO:0045638 | negative regulation of myeloid cell differentiation |
1. PB | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
1. PB | GO:1904632 | cellular response to glucoside |
1. PB | GO:0016567 | protein ubiquitination |
1. PB | GO:0051059 | NF-kappaB binding |
1. PB | GO:0032421 | stereocilium bundle |
1. PB | GO:0033256 | I-kappaB/NF-kappaB complex |
1. PB | GO:0071322 | cellular response to carbohydrate stimulus |
1. PB | GO:0010888 | negative regulation of lipid storage |
1. PB | GO:0032495 | response to muramyl dipeptide |
1. PB | GO:1903522 | regulation of blood circulation |
1. PB | GO:0071244 | cellular response to carbon dioxide |
1. PB | GO:0043046 | DNA methylation involved in gamete generation |
1. PB | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
1. PB | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
1. PB | GO:0005262 | calcium channel activity |
1. PB | GO:1904630 | cellular response to diterpene |
1. PB | GO:0014832 | urinary bladder smooth muscle contraction |
1. PB | GO:0097553 | calcium ion transmembrane import into cytosol |
1. PB | GO:0017020 | myosin phosphatase regulator activity |
1. PB | GO:0098908 | regulation of neuronal action potential |
1. PB | GO:2000630 | positive regulation of miRNA metabolic process |
1. PB | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
1. PB | GO:1990760 | osmolarity-sensing cation channel activity |
1. PB | GO:0005856 | cytoskeleton |
1. PB | GO:0031047 | gene silencing by RNA |
1. PB | GO:0060236 | regulation of mitotic spindle organization |
1. PB | GO:0046826 | negative regulation of protein export from nucleus |
1. PB | GO:0015278 | calcium-release channel activity |
1. PB | GO:0007140 | male meiotic nuclear division |
1. PB | GO:0071354 | cellular response to interleukin-6 |
1. PB | GO:0035914 | skeletal muscle cell differentiation |
1. PB | GO:1903793 | positive regulation of anion transport |
1. PB | GO:0048265 | response to pain |
1. PB | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
1. PB | GO:0014070 | response to organic cyclic compound |
1. PB | GO:1902412 | regulation of mitotic cytokinesis |
1. PB | GO:0007165 | signal transduction |
1. PB | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
1. PB | GO:0032270 | positive regulation of cellular protein metabolic process |
2. P | GO:0051489 | regulation of filopodium assembly |
2. P | GO:0045132 | meiotic chromosome segregation |
2. P | GO:0001938 | positive regulation of endothelial cell proliferation |
2. P | GO:0031116 | positive regulation of microtubule polymerization |
2. P | GO:0010033 | response to organic substance |
2. P | GO:0007080 | mitotic metaphase plate congression |
2. P | GO:1990723 | cytoplasmic periphery of the nuclear pore complex |
2. P | GO:0042995 | cell projection |
2. P | GO:0009409 | response to cold |
2. P | GO:0039517 | modulation by virus of host protein serine/threonine phosphatase activity |
2. P | GO:0061408 | positive regulation of transcription from RNA polymerase II promoter in response to heat stress |
2. P | GO:0005819 | spindle |
2. P | GO:0005245 | voltage-gated calcium channel activity |
2. P | GO:0007084 | mitotic nuclear membrane reassembly |
2. P | GO:0030907 | MBF transcription complex |
2. P | GO:0000922 | spindle pole |
2. P | GO:0042493 | |
2. P | GO:2000637 | positive regulation of gene silencing by miRNA |
2. P | GO:2000678 | negative regulation of transcription regulatory region DNA binding |
2. P | GO:0019233 | sensory perception of pain |
2. P | GO:0061028 | establishment of endothelial barrier |
2. P | GO:0035307 | positive regulation of protein dephosphorylation |
2. P | GO:0030539 | male genitalia development |
2. P | GO:0051721 | protein phosphatase 2A binding |
2. P | GO:0071313 | cellular response to caffeine |
2. P | GO:0031965 | nuclear membrane |
2. P | GO:0071931 | positive regulation of transcription involved in G1/S transition of mitotic cell cycle |
2. P | GO:0015267 | channel activity |
2. P | GO:1903670 | regulation of sprouting angiogenesis |
2. P | GO:0044614 | nuclear pore cytoplasmic filaments |
2. P | GO:0042542 | response to hydrogen peroxide |
2. P | GO:0035308 | negative regulation of protein dephosphorylation |
2. P | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
2. P | GO:0039513 | suppression by virus of host catalytic activity |
2. P | GO:0033391 | chromatoid body |
2. P | GO:0007166 | cell surface receptor signaling pathway |
2. P | GO:0001818 | negative regulation of cytokine production |
2. P | GO:0019888 | protein phosphatase regulator activity |
2. P | GO:0031154 | culmination involved in sorocarp development |
2. P | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
2. P | GO:0008157 | protein phosphatase 1 binding |
2. P | GO:0042326 | negative regulation of phosphorylation |
2. P | GO:0033309 | SBF transcription complex |
2. P | GO:1901653 | cellular response to peptide |
2. P | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
2. P | GO:0070417 | cellular response to cold |
2. P | GO:1904117 | cellular response to vasopressin |
2. P | GO:0010845 | positive regulation of reciprocal meiotic recombination |
2. P | GO:0005635 | nuclear envelope |
2. P | GO:0002523 | leukocyte migration involved in inflammatory response |
2. P | GO:0000083 | regulation of transcription involved in G1/S transition of mitotic cell cycle |
3. B | GO:0005770 | late endosome |
3. B | GO:0034765 | regulation of ion transmembrane transport |
3. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
3. B | GO:0071625 | vocalization behavior |
3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
3. B | GO:0050729 | positive regulation of inflammatory response |
3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
3. B | GO:0090037 | positive regulation of protein kinase C signaling |
3. B | GO:0051835 | positive regulation of synapse structural plasticity |
3. B | GO:0003215 | cardiac right ventricle morphogenesis |
3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
3. B | GO:0043011 | myeloid dendritic cell differentiation |
3. B | GO:0035148 | tube formation |
3. B | GO:0032456 | endocytic recycling |
3. B | GO:0007507 | heart development |
3. B | GO:0001701 | in utero embryonic development |
3. B | GO:0072104 | glomerular capillary formation |
3. B | GO:1903779 | regulation of cardiac conduction |
3. B | GO:0042088 | T-helper 1 type immune response |
3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
3. B | GO:0030334 | regulation of cell migration |
3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
3. B | GO:0001756 | somitogenesis |
3. B | GO:2001259 | positive regulation of cation channel activity |
3. B | GO:0051247 | positive regulation of protein metabolic process |
3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
3. B | GO:0060412 | ventricular septum morphogenesis |
3. B | GO:0014044 | Schwann cell development |
3. B | GO:0006306 | DNA methylation |
3. B | GO:0097190 | apoptotic signaling pathway |
3. B | GO:0019903 | protein phosphatase binding |
3. B | GO:0106310 | protein serine kinase activity |
3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
3. B | GO:0085020 | protein K6-linked ubiquitination |
3. B | GO:0006959 | humoral immune response |
3. B | GO:0004842 | ubiquitin-protein transferase activity |
3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
3. B | GO:0043403 | skeletal muscle tissue regeneration |
3. B | GO:0090543 | Flemming body |
3. B | GO:0001837 | epithelial to mesenchymal transition |
3. B | GO:0051494 | negative regulation of cytoskeleton organization |
3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
3. B | GO:0045070 | positive regulation of viral genome replication |
3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
3. B | GO:0035264 | multicellular organism growth |
3. B | GO:0021519 | spinal cord association neuron specification |
3. B | GO:0050885 | neuromuscular process controlling balance |
3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
3. B | GO:0045611 | negative regulation of hemocyte differentiation |
3. B | GO:0035622 | intrahepatic bile duct development |
3. B | GO:2000822 | regulation of behavioral fear response |
3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
3. B | GO:0045036 | protein targeting to chloroplast |
3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
3. B | GO:0016571 | histone methylation |
3. B | GO:0043254 | regulation of protein-containing complex assembly |
3. B | GO:0010765 | positive regulation of sodium ion transport |
3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
3. B | GO:1902367 | negative regulation of Notch signaling pathway involved in somitogenesis |
3. B | GO:0003162 | atrioventricular node development |
3. B | GO:0035690 | |
3. B | GO:0007492 | endoderm development |
3. B | GO:0048549 | positive regulation of pinocytosis |
3. B | GO:2001214 | positive regulation of vasculogenesis |
3. B | GO:0030534 | adult behavior |
3. B | GO:0031069 | hair follicle morphogenesis |
3. B | GO:0086015 | SA node cell action potential |
3. B | GO:0032466 | negative regulation of cytokinesis |
3. B | GO:1990404 | protein ADP-ribosylase activity |
3. B | GO:0097107 | postsynaptic density assembly |
3. B | GO:0061073 | ciliary body morphogenesis |
3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
3. B | GO:0003151 | outflow tract morphogenesis |
3. B | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
3. B | GO:0007520 | myoblast fusion |
3. B | GO:0006913 | nucleocytoplasmic transport |
3. B | GO:0072014 | proximal tubule development |
3. B | GO:0002437 | inflammatory response to antigenic stimulus |
3. B | GO:0002039 | p53 binding |
3. B | GO:0002052 | positive regulation of neuroblast proliferation |
3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
3. B | GO:0005123 | death receptor binding |
3. B | GO:0032426 | stereocilium tip |
3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
3. B | GO:0043409 | negative regulation of MAPK cascade |
3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
3. B | GO:0043008 | ATP-dependent protein binding |
3. B | GO:1900119 | positive regulation of execution phase of apoptosis |
3. B | GO:0048056 | R3/R4 cell differentiation |
3. B | GO:0003160 | endocardium morphogenesis |
3. B | GO:0043086 | negative regulation of catalytic activity |
3. B | GO:0022011 | myelination in peripheral nervous system |
3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
3. B | GO:0033601 | positive regulation of mammary gland epithelial cell proliferation |
3. B | GO:0010313 | phytochrome binding |
3. B | GO:0050894 | determination of affect |
3. B | GO:0001709 | cell fate determination |
3. B | GO:0000209 | protein polyubiquitination |
3. B | GO:0097546 | ciliary base |
3. B | GO:0001947 | heart looping |
3. B | GO:0016197 | endosomal transport |
3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
3. B | GO:0002027 | regulation of heart rate |
3. B | GO:0035116 | embryonic hindlimb morphogenesis |
3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
3. B | GO:0044325 | transmembrane transporter binding |
3. B | GO:0008593 | regulation of Notch signaling pathway |
3. B | GO:0030496 | midbody |
3. B | GO:0005634 | nucleus |
3. B | GO:0072116 | pronephros formation |
3. B | GO:0072574 | hepatocyte proliferation |
3. B | GO:0010629 | negative regulation of gene expression |
3. B | GO:0046875 | ephrin receptor binding |
3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
3. B | GO:0001763 | morphogenesis of a branching structure |
3. B | GO:0030660 | Golgi-associated vesicle membrane |
3. B | GO:0002789 | negative regulation of antifungal peptide production |
3. B | GO:0072044 | collecting duct development |
3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
3. B | GO:1904901 | positive regulation of myosin II filament organization |
3. B | GO:0070528 | protein kinase C signaling |
3. B | GO:0097129 | cyclin D2-CDK4 complex |
3. B | GO:0060999 | positive regulation of dendritic spine development |
3. B | GO:0005516 | calmodulin binding |
3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
3. B | GO:0010875 | positive regulation of cholesterol efflux |
3. B | GO:0045746 | negative regulation of Notch signaling pathway |
3. B | GO:0070213 | protein auto-ADP-ribosylation |
3. B | GO:0004672 | protein kinase activity |
3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
3. B | GO:0043330 | response to exogenous dsRNA |
3. B | GO:0055016 | hypochord development |
3. B | GO:0031877 | somatostatin receptor binding |
3. B | GO:0048812 | neuron projection morphogenesis |
3. B | GO:0033292 | T-tubule organization |
3. B | GO:0006967 | positive regulation of antifungal peptide biosynthetic process |
3. B | GO:0005769 | early endosome |
3. B | GO:0071356 | cellular response to tumor necrosis factor |
3. B | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
3. B | GO:0055074 | calcium ion homeostasis |
3. B | GO:0045665 | negative regulation of neuron differentiation |
3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
3. B | GO:1904108 | protein localization to ciliary inversin compartment |
3. B | GO:0009950 | dorsal/ventral axis specification |
3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
3. B | GO:0006915 | apoptotic process |
3. B | GO:0045747 | positive regulation of Notch signaling pathway |
3. B | GO:0035898 | parathyroid hormone secretion |
3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
3. B | GO:0097114 | NMDA glutamate receptor clustering |
3. B | GO:0046475 | glycerophospholipid catabolic process |
3. B | GO:0106311 | |
3. B | GO:0071889 | 14-3-3 protein binding |
3. B | GO:0006606 | protein import into nucleus |
3. B | GO:0090521 | glomerular visceral epithelial cell migration |
3. B | GO:0031436 | BRCA1-BARD1 complex |
3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
3. B | GO:0050768 | negative regulation of neurogenesis |
3. B | GO:0030307 | positive regulation of cell growth |
3. B | GO:0099092 | postsynaptic density, intracellular component |
3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
3. B | GO:0005249 | voltage-gated potassium channel activity |
3. B | GO:0045211 | postsynaptic membrane |
3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
3. B | GO:0010976 | positive regulation of neuron projection development |
3. B | GO:0030017 | sarcomere |
3. B | GO:0045581 | negative regulation of T cell differentiation |
3. B | GO:0043491 | protein kinase B signaling |
3. B | GO:0036336 | dendritic cell migration |
3. B | GO:0016055 | Wnt signaling pathway |
3. B | GO:0048873 | homeostasis of number of cells within a tissue |
3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
3. B | GO:0061195 | taste bud formation |
3. B | GO:0018345 | protein palmitoylation |
3. B | GO:0032288 | myelin assembly |
3. B | GO:0021515 | cell differentiation in spinal cord |
3. B | GO:0002011 | morphogenesis of an epithelial sheet |
3. B | GO:0071212 | subsynaptic reticulum |
3. B | GO:0014807 | regulation of somitogenesis |
3. B | GO:0031670 | cellular response to nutrient |
3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
3. B | GO:0030279 | negative regulation of ossification |
3. B | GO:0048663 | neuron fate commitment |
3. B | GO:0030016 | myofibril |
3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
3. B | GO:0006584 | catecholamine metabolic process |
3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
3. B | GO:0003182 | coronary sinus valve morphogenesis |
3. B | GO:0055117 | regulation of cardiac muscle contraction |
3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
3. B | GO:0044605 | phosphocholine transferase activity |
3. B | GO:0006929 | substrate-dependent cell migration |
3. B | GO:0071345 | cellular response to cytokine stimulus |
3. B | GO:0030424 | axon |
3. B | GO:0007409 | axonogenesis |
3. B | GO:0051146 | striated muscle cell differentiation |
3. B | GO:0045171 | intercellular bridge |
3. B | GO:0035255 | ionotropic glutamate receptor binding |
3. B | GO:0003714 | transcription corepressor activity |
3. B | GO:0043069 | negative regulation of programmed cell death |
3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
3. B | GO:0031013 | troponin I binding |
3. B | GO:0031430 | M band |
3. B | GO:0070198 | protein localization to chromosome, telomeric region |
3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
3. B | GO:0045751 | negative regulation of Toll signaling pathway |
3. B | GO:0072576 | liver morphogenesis |
3. B | GO:0007030 | Golgi organization |
3. B | GO:0045838 | positive regulation of membrane potential |
3. B | GO:0005929 | cilium |
3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
3. B | GO:0036371 | protein localization to T-tubule |
3. B | GO:0035172 | hemocyte proliferation |
3. B | GO:0003344 | pericardium morphogenesis |
3. B | GO:0044030 | regulation of DNA methylation |
3. B | GO:0060076 | excitatory synapse |
3. B | GO:0070742 | C2H2 zinc finger domain binding |
3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
3. B | GO:0003208 | cardiac ventricle morphogenesis |
3. B | GO:0003214 | cardiac left ventricle morphogenesis |
3. B | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator |
3. B | GO:2000812 | regulation of barbed-end actin filament capping |
3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
3. B | GO:0051101 | regulation of DNA binding |
3. B | GO:0007613 | memory |
3. B | GO:0014731 | spectrin-associated cytoskeleton |
3. B | GO:0044309 | neuron spine |
3. B | GO:0005737 | cytoplasm |
3. B | GO:0098978 | glutamatergic synapse |
3. B | GO:2000001 | regulation of DNA damage checkpoint |
3. B | GO:0055013 | cardiac muscle cell development |
3. B | GO:0072114 | pronephros morphogenesis |
3. B | GO:0061630 | ubiquitin protein ligase activity |
3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
3. B | GO:0043005 | neuron projection |
3. B | GO:0098871 | postsynaptic actin cytoskeleton |
3. B | GO:0097435 | supramolecular fiber organization |
3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
3. B | GO:0046331 | lateral inhibition |
3. B | GO:0014704 | intercalated disc |
3. B | GO:0097113 | AMPA glutamate receptor clustering |
3. B | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
3. B | GO:0019901 | protein kinase binding |
3. B | GO:0046959 | habituation |
3. B | GO:0001955 | blood vessel maturation |
3. B | GO:0010225 | response to UV-C |
3. B | GO:0099519 | dense core granule cytoskeletal transport |
3. B | GO:0007219 | Notch signaling pathway |
3. B | GO:0038023 | signaling receptor activity |
3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
3. B | GO:0034638 | phosphatidylcholine catabolic process |
3. B | GO:0021546 | rhombomere development |
3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
3. B | GO:0033280 | response to vitamin D |
3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
3. B | GO:0045794 | negative regulation of cell volume |
3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
3. B | GO:0042048 | olfactory behavior |
3. B | GO:0071222 | cellular response to lipopolysaccharide |
3. B | GO:0071447 | cellular response to hydroperoxide |
3. B | GO:0032580 | Golgi cisterna membrane |
3. B | GO:0000731 | DNA synthesis involved in DNA repair |
3. B | GO:0016529 | sarcoplasmic reticulum |
3. B | GO:0071800 | podosome assembly |
3. B | GO:0060288 | formation of a compartment boundary |
3. B | GO:0051497 | negative regulation of stress fiber assembly |
3. B | GO:0140374 | antiviral innate immune response |
3. B | GO:0030034 | microvillar actin bundle assembly |
3. B | GO:1904743 | negative regulation of telomeric DNA binding |
3. B | GO:0071347 | cellular response to interleukin-1 |
3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
3. B | GO:0003241 | growth involved in heart morphogenesis |
3. B | GO:0072660 | maintenance of protein location in plasma membrane |
3. B | GO:0015629 | actin cytoskeleton |
3. B | GO:0009967 | positive regulation of signal transduction |
3. B | GO:0055007 | cardiac muscle cell differentiation |
3. B | GO:0060289 | compartment boundary maintenance |
3. B | GO:0031674 | I band |
3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
3. B | GO:0043197 | dendritic spine |
3. B | GO:0005112 | Notch binding |
3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
3. B | GO:0008285 | negative regulation of cell population proliferation |
3. B | GO:0001889 | liver development |
3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
3. B | GO:0043054 | dauer exit |
3. B | GO:0060674 | placenta blood vessel development |
3. B | GO:0039529 | RIG-I signaling pathway |
3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
3. B | GO:0036309 | protein localization to M-band |
3. B | GO:0065001 | specification of axis polarity |
3. B | GO:0035809 | regulation of urine volume |
3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
3. B | GO:0097117 | guanylate kinase-associated protein clustering |
3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
3. B | GO:0045732 | positive regulation of protein catabolic process |
3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
3. B | GO:0098919 | structural constituent of postsynaptic density |
3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
3. B | GO:0002357 | defense response to tumor cell |
3. B | GO:0002070 | epithelial cell maturation |
3. B | GO:0031432 | titin binding |
3. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
3. B | GO:0022407 | regulation of cell-cell adhesion |
3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
3. B | GO:0006471 | protein ADP-ribosylation |
3. B | GO:0070531 | BRCA1-A complex |
3. B | GO:0060842 | arterial endothelial cell differentiation |
3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
3. B | GO:1900452 | regulation of long-term synaptic depression |
3. B | GO:0009411 | response to UV |
3. B | GO:0003229 | ventricular cardiac muscle tissue development |
3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
3. B | GO:0070972 | protein localization to endoplasmic reticulum |
3. B | GO:0090160 | Golgi to lysosome transport |
3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
3. B | GO:0043268 | positive regulation of potassium ion transport |
3. B | GO:0016021 | integral component of membrane |
3. B | GO:0031267 | small GTPase binding |
3. B | GO:0060035 | notochord cell development |
3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
3. B | GO:0045685 | regulation of glial cell differentiation |
3. B | GO:0030513 | positive regulation of BMP signaling pathway |
3. B | GO:2000737 | negative regulation of stem cell differentiation |
3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
3. B | GO:0010001 | glial cell differentiation |
3. B | GO:1902531 | regulation of intracellular signal transduction |
3. B | GO:0000062 | fatty-acyl-CoA binding |
3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
3. B | GO:0031960 | response to corticosteroid |
3. B | GO:0060074 | synapse maturation |
3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
3. B | GO:1901201 | regulation of extracellular matrix assembly |
3. B | GO:0048892 | lateral line nerve development |
3. B | GO:0032049 | cardiolipin biosynthetic process |
3. B | GO:0008093 | cytoskeletal anchor activity |
3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
3. B | GO:0038061 | NIK/NF-kappaB signaling |
3. B | GO:0019730 | antimicrobial humoral response |
3. B | GO:0005938 | cell cortex |
3. B | GO:0042802 | identical protein binding |
3. B | GO:0005654 | nucleoplasm |
3. B | GO:0048708 | astrocyte differentiation |
3. B | GO:0030674 | protein-macromolecule adaptor activity |
3. B | GO:0001708 | cell fate specification |
3. B | GO:0034058 | endosomal vesicle fusion |
3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
3. B | GO:0030326 | embryonic limb morphogenesis |
3. B | GO:0060740 | prostate gland epithelium morphogenesis |
3. B | GO:0030837 | negative regulation of actin filament polymerization |
3. B | GO:0071286 | cellular response to magnesium ion |
3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
3. B | GO:0060411 | cardiac septum morphogenesis |
3. B | GO:1905938 | positive regulation of germ cell proliferation |
3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
3. B | GO:0045967 | negative regulation of growth rate |
3. B | GO:0043034 | costamere |
3. B | GO:0021986 | habenula development |
3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
3. B | GO:0032791 | lead ion binding |
3. B | GO:0031297 | replication fork processing |
3. B | GO:0030046 | parallel actin filament bundle assembly |
3. B | GO:0046843 | dorsal appendage formation |
3. B | GO:0036166 | phenotypic switching |
3. B | GO:0046469 | platelet activating factor metabolic process |
3. B | GO:0007605 | sensory perception of sound |
3. B | GO:0044877 | protein-containing complex binding |
3. B | GO:0070986 | left/right axis specification |
3. B | GO:0005576 | extracellular region |
3. B | GO:0019887 | protein kinase regulator activity |
3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
3. B | GO:0010468 | regulation of gene expression |
3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
3. B | GO:0021915 | neural tube development |
3. B | GO:0030018 | Z disc |
3. B | GO:0042805 | actinin binding |
3. B | GO:0002467 | germinal center formation |
3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
3. B | GO:0036377 | arbuscular mycorrhizal association |
3. B | GO:0043063 | intercellular bridge organization |
3. B | GO:0046473 | phosphatidic acid metabolic process |
3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
3. B | GO:0099612 | protein localization to axon |
3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
3. B | GO:0005524 | ATP binding |
3. B | GO:0098703 | calcium ion import across plasma membrane |
3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
3. B | GO:0045669 | positive regulation of osteoblast differentiation |
3. B | GO:0042686 | regulation of cardioblast cell fate specification |
3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
3. B | GO:0071260 | cellular response to mechanical stimulus |
3. B | GO:0097422 | tubular endosome |
3. B | GO:0018027 | peptidyl-lysine dimethylation |
3. B | GO:0035176 | social behavior |
3. B | GO:0010960 | magnesium ion homeostasis |
3. B | GO:0080085 | signal recognition particle, chloroplast targeting |
3. B | GO:2001204 | regulation of osteoclast development |
3. B | GO:0001650 | fibrillar center |
3. B | GO:0048536 | spleen development |
3. B | GO:0042826 | histone deacetylase binding |
3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
3. B | GO:0140261 | BCOR complex |
3. B | GO:0035418 | protein localization to synapse |
3. B | GO:0005886 | plasma membrane |
3. B | GO:0042325 | regulation of phosphorylation |
3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
3. B | GO:0021675 | nerve development |
3. B | GO:0035646 | endosome to melanosome transport |
3. B | GO:0044232 | organelle membrane contact site |
3. B | GO:0048899 | anterior lateral line development |
3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
3. B | GO:0070208 | protein heterotrimerization |
3. B | GO:0001222 | transcription corepressor binding |
3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
3. B | GO:0007009 | plasma membrane organization |
3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
3. B | GO:0043292 | contractile fiber |
3. B | GO:0032996 | Bcl3-Bcl10 complex |
3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
3. B | GO:0019843 | rRNA binding |
3. B | GO:0070212 | protein poly-ADP-ribosylation |
3. B | GO:1900271 | regulation of long-term synaptic potentiation |
3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
3. B | GO:0007160 | cell-matrix adhesion |
3. B | GO:0009066 | aspartate family amino acid metabolic process |
3. B | GO:0030160 | synaptic receptor adaptor activity |
3. B | GO:0045662 | negative regulation of myoblast differentiation |
3. B | GO:0019228 | neuronal action potential |
3. B | GO:0072017 | distal tubule development |
3. B | GO:0007440 | foregut morphogenesis |
3. B | GO:0048711 | positive regulation of astrocyte differentiation |
3. B | GO:0072073 | kidney epithelium development |
3. B | GO:0045859 | regulation of protein kinase activity |
3. B | GO:0004622 | lysophospholipase activity |
3. B | GO:0035023 | regulation of Rho protein signal transduction |
3. B | GO:0072357 | PTW/PP1 phosphatase complex |
3. B | GO:0007386 | compartment pattern specification |
3. B | GO:0008022 | protein C-terminus binding |
3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
3. B | GO:0003181 | atrioventricular valve morphogenesis |
3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
3. B | GO:0021773 | striatal medium spiny neuron differentiation |
3. B | GO:0010638 | positive regulation of organelle organization |
3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
3. B | GO:0060998 | regulation of dendritic spine development |
3. B | GO:2000811 | negative regulation of anoikis |
3. B | GO:0048102 | autophagic cell death |
3. B | GO:1901216 | positive regulation of neuron death |
3. B | GO:0006897 | endocytosis |
3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
3. B | GO:1901339 | regulation of store-operated calcium channel activity |
3. B | GO:0006887 | exocytosis |
3. B | GO:0071314 | cellular response to cocaine |
3. B | GO:0000242 | pericentriolar material |
3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
3. B | GO:0003197 | endocardial cushion development |
3. B | GO:0016604 | nuclear body |
3. B | GO:0003723 | RNA binding |
3. B | GO:0042665 | regulation of ectodermal cell fate specification |
3. B | GO:0098907 | regulation of SA node cell action potential |
3. B | GO:0003203 | endocardial cushion morphogenesis |
3. B | GO:1905667 | negative regulation of protein localization to endosome |
3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
3. B | GO:0003677 | DNA binding |
3. B | GO:0030155 | regulation of cell adhesion |
3. B | GO:0086014 | atrial cardiac muscle cell action potential |
3. B | GO:0016409 | palmitoyltransferase activity |
3. B | GO:0008270 | zinc ion binding |
3. B | GO:0003184 | pulmonary valve morphogenesis |
3. B | GO:0030507 | spectrin binding |
3. B | GO:0003169 | coronary vein morphogenesis |
3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
3. B | GO:0002315 | marginal zone B cell differentiation |
3. B | GO:0010832 | negative regulation of myotube differentiation |
3. B | GO:0071532 | ankyrin repeat binding |
3. B | GO:0070682 | proteasome regulatory particle assembly |
3. B | GO:0070936 | protein K48-linked ubiquitination |
3. B | GO:0070412 | R-SMAD binding |
3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
3. B | GO:0031143 | pseudopodium |
3. B | GO:0051017 | actin filament bundle assembly |
3. B | GO:0007368 | determination of left/right symmetry |
3. B | GO:0060982 | coronary artery morphogenesis |
3. B | GO:0007616 | long-term memory |
3. B | GO:0014069 | postsynaptic density |
3. B | GO:0045687 | positive regulation of glial cell differentiation |
3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
3. B | GO:0051726 | regulation of cell cycle |
3. B | GO:0002268 | follicular dendritic cell differentiation |
3. B | GO:0032525 | somite rostral/caudal axis specification |
3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
3. B | GO:0031359 | integral component of chloroplast outer membrane |
3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
3. B | GO:0071407 | cellular response to organic cyclic compound |
3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
3. B | GO:1904107 | protein localization to microvillus membrane |
3. B | GO:0015248 | sterol transporter activity |
3. B | GO:0048103 | somatic stem cell division |
3. B | GO:0043266 | regulation of potassium ion transport |
3. B | GO:0060843 | venous endothelial cell differentiation |
3. B | GO:0001838 | embryonic epithelial tube formation |
3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
3. B | GO:0006528 | asparagine metabolic process |
3. B | GO:0032496 | response to lipopolysaccharide |
3. B | GO:0061399 | positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion |
3. B | GO:0140031 | phosphorylation-dependent protein binding |
3. B | GO:0051306 | mitotic sister chromatid separation |
3. B | GO:0003207 | cardiac chamber formation |
3. B | GO:0061384 | heart trabecula morphogenesis |
3. B | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
3. B | GO:0048060 | negative gravitaxis |
3. B | GO:0072015 | glomerular visceral epithelial cell development |
3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
3. B | GO:0070171 | negative regulation of tooth mineralization |
3. B | GO:0035014 | phosphatidylinositol 3-kinase regulator activity |
3. B | GO:0030315 | T-tubule |
3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
3. B | GO:0003209 | cardiac atrium morphogenesis |
3. B | GO:1905936 | regulation of germ cell proliferation |
3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
3. B | GO:0048052 | R1/R6 cell differentiation |
3. B | GO:0021531 | spinal cord radial glial cell differentiation |
3. B | GO:0010761 | fibroblast migration |
3. B | GO:2000969 | positive regulation of AMPA receptor activity |
3. B | GO:0008290 | F-actin capping protein complex |
3. B | GO:0102545 | phosphatidyl phospholipase B activity |
3. B | GO:0097062 | dendritic spine maintenance |
3. B | GO:0031901 | early endosome membrane |
3. B | GO:0031672 | A band |
3. B | GO:0003213 | cardiac right atrium morphogenesis |
3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
3. B | GO:0050793 | regulation of developmental process |
3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
3. B | GO:0043194 | axon initial segment |
3. B | GO:0090575 | RNA polymerase II transcription regulator complex |
3. B | GO:0009912 | auditory receptor cell fate commitment |
3. B | GO:0030941 | chloroplast targeting sequence binding |
3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
3. B | GO:0046849 | bone remodeling |
3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
3. B | GO:0043066 | negative regulation of apoptotic process |
3. B | GO:1904355 | positive regulation of telomere capping |
3. B | GO:0001895 | retina homeostasis |
3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
3. B | GO:0097543 | ciliary inversin compartment |
3. B | GO:0017124 | SH3 domain binding |
3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
3. B | GO:0048854 | brain morphogenesis |
3. B | GO:0003219 | cardiac right ventricle formation |
3. B | GO:0043235 | receptor complex |
3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
3. B | GO:0017171 | serine hydrolase activity |
3. B | GO:0072144 | glomerular mesangial cell development |
3. B | GO:2000031 | regulation of salicylic acid mediated signaling pathway |
3. B | GO:0016235 | aggresome |
3. B | GO:0060956 | endocardial cell differentiation |
3. B | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
3. B | GO:0042383 | sarcolemma |
3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
3. B | GO:0050931 | pigment cell differentiation |
3. B | GO:0034704 | calcium channel complex |
3. B | GO:0060038 | cardiac muscle cell proliferation |
3. B | GO:0030029 | actin filament-based process |
3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
3. B | GO:0042297 | vocal learning |
3. B | GO:0002040 | sprouting angiogenesis |
3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
3. B | GO:0045064 | T-helper 2 cell differentiation |
3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
3. B | GO:0045596 | negative regulation of cell differentiation |
3. B | GO:0061025 | membrane fusion |
3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
3. B | GO:0097110 | scaffold protein binding |
3. B | GO:1990393 | 3M complex |
3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
3. B | GO:0003180 | aortic valve morphogenesis |
3. B | GO:1990705 | cholangiocyte proliferation |
3. B | GO:0060013 | righting reflex |
3. B | GO:0007411 | axon guidance |
3. B | GO:0042246 | tissue regeneration |
3. B | GO:0003157 | endocardium development |
3. B | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
3. B | GO:0007229 | integrin-mediated signaling pathway |
3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
3. B | GO:0097150 | neuronal stem cell population maintenance |
3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
3. B | GO:0048013 | ephrin receptor signaling pathway |
3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
3. B | GO:0035171 | lamellocyte differentiation |
3. B | GO:0004067 | asparaginase activity |
3. B | GO:1903849 | positive regulation of aorta morphogenesis |
3. B | GO:0003713 | transcription coactivator activity |
3. B | GO:0045162 | clustering of voltage-gated sodium channels |
3. B | GO:0042633 | hair cycle |
3. B | GO:0060413 | atrial septum morphogenesis |
3. B | GO:0051865 | protein autoubiquitination |
3. B | GO:0050728 | negative regulation of inflammatory response |
3. B | GO:0003192 | mitral valve formation |
3. B | GO:0043065 | positive regulation of apoptotic process |
3. B | GO:0008139 | nuclear localization sequence binding |
3. B | GO:0030027 | lamellipodium |
3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
3. B | GO:0033268 | node of Ranvier |
3. B | GO:0048665 | neuron fate specification |
3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
3. B | GO:0050852 | T cell receptor signaling pathway |
3. B | GO:0003264 | regulation of cardioblast proliferation |
3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
3. B | GO:0043596 | nuclear replication fork |
3. B | GO:0001835 | blastocyst hatching |
3. B | GO:0050807 | regulation of synapse organization |
3. B | GO:0061314 | Notch signaling involved in heart development |
3. B | GO:0008361 | regulation of cell size |
3. B | GO:0071709 | membrane assembly |
3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
3. B | GO:0060992 | response to fungicide |
3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
3. B | GO:0014732 | skeletal muscle atrophy |
3. B | GO:0019899 | enzyme binding |
3. B | GO:1902647 | negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process |
3. B | GO:0099173 | postsynapse organization |
3. B | GO:0051570 | regulation of histone H3-K9 methylation |
3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
3. B | GO:0060997 | dendritic spine morphogenesis |
3. B | GO:0048845 | venous blood vessel morphogenesis |
3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
3. B | GO:0060135 | maternal process involved in female pregnancy |
3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
3. B | GO:2000311 | regulation of AMPA receptor activity |
3. B | GO:0043055 | maintenance of dauer |
3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
3. B | GO:0060253 | negative regulation of glial cell proliferation |
3. B | GO:0021707 | cerebellar granule cell differentiation |
3. B | GO:0014031 | mesenchymal cell development |
3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
3. B | GO:0032991 | protein-containing complex |
3. B | GO:0005829 | cytosol |
3. B | GO:0046872 | metal ion binding |
3. B | GO:0035544 | negative regulation of SNARE complex assembly |
3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
3. B | GO:0048871 | multicellular organismal homeostasis |
3. B | GO:2000821 | regulation of grooming behavior |
3. B | GO:0000139 | Golgi membrane |
3. B | GO:0035556 | intracellular signal transduction |
3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
3. B | GO:0030900 | forebrain development |
3. B | GO:0070168 | negative regulation of biomineral tissue development |
3. B | GO:0044354 | macropinosome |
3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
3. B | GO:0031076 | embryonic camera-type eye development |
3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
---|---|---|---|---|---|
1. PB | P14360 | Putative ankyrin repeat protein FPV240 | NA | 2.15e-04 | 9.38e-08 |
1. PB | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 1.69e-03 | 5.74e-08 | 7.20e-05 |
1. PB | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 1.73e-05 | 1.09e-03 | 0.007 |
1. PB | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.82e-07 | 6.39e-07 | 4.24e-05 |
1. PB | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.06e-06 | 2.16e-06 | 2.13e-05 |
1. PB | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 3.46e-04 | 4.44e-02 | 6.49e-24 |
1. PB | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 1.19e-05 | 6.45e-12 | 0.003 |
1. PB | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.99e-07 | 1.47e-06 | 3.96e-04 |
1. PB | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 3.18e-06 | 3.69e-04 | 6.36e-13 |
1. PB | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.87e-07 | 1.68e-06 | 2.51e-05 |
1. PB | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.14e-05 | 7.06e-07 | 4.58e-05 |
1. PB | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.98e-06 | 2.03e-05 | 0.043 |
1. PB | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.11e-06 | 1.16e-07 | 3.24e-05 |
1. PB | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.75e-06 | 1.11e-06 | 2.52e-04 |
1. PB | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 5.64e-07 | 6.45e-05 | 1.61e-07 |
1. PB | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 5.80e-05 | 4.79e-02 | 1.78e-04 |
1. PB | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 6.74e-08 | 1.73e-04 | 4.60e-04 |
1. PB | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.06e-05 | 9.36e-07 | 4.16e-05 |
1. PB | Q71S21 | Inversin-B | 3.10e-04 | 2.89e-05 | 3.09e-13 |
1. PB | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 2.38e-02 | 1.27e-02 | 0.004 |
1. PB | Q3V096 | Ankyrin repeat domain-containing protein 42 | 3.31e-07 | 6.20e-10 | 0.005 |
1. PB | B2RU33 | POTE ankyrin domain family member C | 1.22e-10 | 5.78e-17 | 0.0 |
1. PB | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.56e-06 | 8.10e-06 | 1.13e-04 |
1. PB | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 3.43e-06 | 2.37e-26 | 1.61e-75 |
1. PB | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.36e-07 | 2.11e-08 | 2.62e-05 |
1. PB | A0JP26 | POTE ankyrin domain family member B3 | 9.08e-09 | 1.09e-20 | 0.0 |
1. PB | Q86YR6 | POTE ankyrin domain family member D | 1.34e-08 | 6.37e-21 | 0.0 |
1. PB | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.40e-06 | 2.19e-06 | 1.19e-05 |
1. PB | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.22e-06 | 7.64e-06 | 4.12e-05 |
1. PB | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 4.60e-06 | 2.18e-15 | 2.92e-04 |
1. PB | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.05e-06 | 3.51e-08 | 1.43e-04 |
1. PB | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 2.74e-07 | 1.26e-04 | 9.59e-06 |
1. PB | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.94e-07 | 4.55e-05 | 3.17e-05 |
1. PB | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 2.39e-07 | 9.40e-03 | 2.77e-10 |
1. PB | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 1.39e-06 | 4.62e-04 | 6.94e-10 |
1. PB | H3BUK9 | POTE ankyrin domain family member B2 | 6.68e-09 | 2.83e-33 | 0.0 |
1. PB | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | 2.89e-03 | 3.68e-09 |
1. PB | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.63e-07 | 2.61e-07 | 3.71e-05 |
1. PB | A0A0A6YYL3 | POTE ankyrin domain family member B | 9.14e-11 | 2.83e-33 | 0.0 |
1. PB | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 1.32e-06 | 6.12e-08 | 7.87e-10 |
1. PB | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 1.99e-06 | 3.20e-03 | 1.39e-05 |
1. PB | A6NCL7 | Ankyrin repeat domain-containing protein 33B | 5.36e-04 | 4.88e-09 | 0.009 |
1. PB | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.95e-07 | 1.77e-05 | 5.91e-05 |
1. PB | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 2.32e-04 | 1.86e-04 | 0.016 |
1. PB | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 7.50e-05 | 5.56e-03 | 7.69e-09 |
1. PB | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 4.05e-04 | 3.10e-05 | 0.002 |
1. PB | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 2.66e-05 | 3.86e-10 | 3.89e-04 |
1. PB | O75762 | Transient receptor potential cation channel subfamily A member 1 | 1.48e-03 | 9.78e-03 | 2.12e-09 |
1. PB | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.90e-06 | 1.58e-08 | 1.62e-05 |
1. PB | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.70e-06 | 1.06e-07 | 5.75e-07 |
1. PB | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 8.27e-04 | 4.44e-02 | 6.99e-09 |
1. PB | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.70e-07 | 6.25e-06 | 3.77e-04 |
1. PB | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.14e-07 | 1.47e-05 | 5.31e-05 |
1. PB | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 2.99e-03 | 1.18e-07 | 0.028 |
1. PB | Q8BXP5 | Photoreceptor ankyrin repeat protein | 2.62e-04 | 5.76e-06 | 2.14e-04 |
1. PB | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.06e-05 | 1.74e-06 | 1.73e-05 |
1. PB | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 4.39e-04 | 1.91e-02 | 0.003 |
1. PB | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.16e-06 | 1.60e-07 | 3.15e-05 |
1. PB | Q6S8J7 | POTE ankyrin domain family member A | 0 | 2.68e-162 | 0.0 |
1. PB | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 6.84e-06 | 2.29e-04 | 1.03e-09 |
1. PB | Q71S22 | Inversin-A | 1.83e-05 | 1.21e-02 | 1.23e-13 |
1. PB | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.89e-07 | 2.30e-05 | 2.79e-05 |
1. PB | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 8.27e-06 | 5.51e-03 | 0.001 |
1. PB | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.22e-06 | 1.57e-05 | 2.75e-04 |
1. PB | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.42e-06 | 1.56e-07 | 6.69e-04 |
1. PB | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 2.31e-05 | 4.14e-07 | 7.64e-04 |
1. PB | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | 8.86e-03 | 6.91e-08 |
1. PB | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 8.65e-06 | 2.94e-02 | 9.67e-05 |
1. PB | P25963 | NF-kappa-B inhibitor alpha | 6.19e-09 | 4.66e-02 | 9.35e-06 |
1. PB | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.38e-06 | 2.00e-05 | 6.55e-05 |
1. PB | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.68e-07 | 8.22e-08 | 2.56e-05 |
1. PB | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.24e-07 | 3.19e-07 | 3.47e-05 |
1. PB | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.24e-06 | 1.47e-05 | 4.20e-05 |
1. PB | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.30e-08 | 1.95e-07 | 1.78e-04 |
1. PB | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 7.08e-06 | 2.14e-06 | 4.68e-09 |
1. PB | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 7.26e-06 | 5.90e-04 | 0.002 |
1. PB | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.95e-05 | 5.74e-08 | 7.36e-04 |
1. PB | Q4R739 | Ankyrin repeat domain-containing protein 53 | 8.63e-04 | 1.58e-08 | 2.60e-05 |
1. PB | Q7Z3H0 | Photoreceptor ankyrin repeat protein | 8.00e-04 | 2.68e-11 | 0.015 |
1. PB | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.12e-06 | 5.84e-04 | 0.001 |
1. PB | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 5.21e-07 | 2.85e-02 | 3.45e-51 |
2. P | Q8GYH5 | Ankyrin repeat-containing protein BDA1 | 2.70e-08 | 3.01e-03 | NA |
2. P | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.47e-05 | 5.09e-12 | NA |
2. P | Q3U0L2 | Ankyrin repeat domain-containing protein 33B | 4.76e-05 | 6.08e-12 | NA |
2. P | Q9D738 | Ankyrin repeat and SOCS box protein 12 | 9.56e-07 | 2.52e-02 | NA |
2. P | Q5UPH4 | Putative ankyrin repeat protein R96 | NA | 5.08e-03 | NA |
2. P | P46060 | Ran GTPase-activating protein 1 | 1.32e-01 | 4.97e-02 | NA |
2. P | Q810N6 | Ankyrin repeat domain-containing protein 45 | 2.57e-04 | 1.88e-03 | NA |
2. P | O13066 | Ran GTPase-activating protein 1 | 2.24e-01 | 2.77e-02 | NA |
2. P | P09959 | Regulatory protein SWI6 | 1.44e-02 | 6.21e-03 | NA |
2. P | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 6.37e-08 | 9.48e-04 | NA |
2. P | Q6P1H6 | Ankyrin repeat and LEM domain-containing protein 2 | 8.14e-02 | 1.59e-02 | NA |
2. P | P33520 | Cell division cycle-related protein res1/sct1 | 4.87e-03 | 1.07e-02 | NA |
2. P | Q9VIW3 | Ran GTPase-activating protein | 9.69e-02 | 2.55e-02 | NA |
2. P | O36972 | IkB-like protein | NA | 1.93e-02 | NA |
2. P | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 2.82e-06 | 4.45e-11 | NA |
2. P | Q19857 | Protein phosphatase 1 regulatory subunit 37 homolog | 2.86e-01 | 1.31e-02 | NA |
2. P | Q5TZF3 | Ankyrin repeat domain-containing protein 45 | 4.05e-05 | 2.66e-03 | NA |
2. P | P25631 | Ankyrin repeat-containing protein YCR051W | 1.20e-04 | 2.16e-02 | NA |
2. P | Q1RJ94 | Putative ankyrin repeat protein RBE_0489 | 3.29e-04 | 2.00e-02 | NA |
2. P | H2KZB2 | Ankyrin repeat and LEM domain-containing protein 2 homolog | 5.22e-02 | 2.61e-05 | NA |
2. P | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.90e-05 | 1.56e-11 | NA |
2. P | Q1RJX2 | Putative ankyrin repeat protein RBE_0261 | 1.10e-02 | 2.58e-04 | NA |
2. P | Q83DF6 | Putative ankyrin repeat protein CBU_0781 | 3.90e-04 | 8.14e-11 | NA |
3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 0.00e+00 | NA | 3.96e-80 |
3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 8.05e-04 | NA | 9.22e-08 |
3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 2.77e-04 | NA | 1.31e-06 |
3. B | P20632 | Interferon antagonist K1L | NA | NA | 0.017 |
3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 1.02e-05 |
3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 2.88e-06 | NA | 5.32e-10 |
3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 1.21e-05 | NA | 7.19e-09 |
3. B | Q3MJ40 | Coiled-coil domain-containing protein 144B | 2.25e-01 | NA | 9.05e-40 |
3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 3.67e-04 | NA | 2.02e-08 |
3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 8.77e-07 | NA | 4.00e-04 |
3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 4.78e-04 | NA | 4.33e-04 |
3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 5.05e-02 | NA | 1.49e-16 |
3. B | A9JR78 | Tonsoku-like protein | 7.24e-02 | NA | 1.03e-04 |
3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 2.97e-06 | NA | 5.76e-13 |
3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 4.82e-03 | NA | 9.83e-07 |
3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 2.75e-12 | NA | 1.01e-05 |
3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 2.13e-06 | NA | 1.42e-11 |
3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 4.00e-04 | NA | 1.11e-09 |
3. B | P0C6P7 | Protein fem-1 homolog B | 8.99e-06 | NA | 7.93e-07 |
3. B | Q8CEF1 | Protein fem-1 homolog C | 6.62e-07 | NA | 2.21e-09 |
3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 1.07e-06 | NA | 0.002 |
3. B | Q4WUD3 | Probable Xaa-Pro aminopeptidase P | 6.65e-01 | NA | 0.012 |
3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 3.40e-08 |
3. B | D3J162 | Protein VAPYRIN | 5.45e-06 | NA | 3.58e-07 |
3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 1.83e-06 | NA | 7.11e-09 |
3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 5.50e-05 | NA | 1.96e-70 |
3. B | Q06527 | Ankyrin homolog | 1.03e-10 | NA | 3.80e-17 |
3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 7.70e-03 | NA | 2.65e-06 |
3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 2.61e-02 | NA | 0.003 |
3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 1.22e-03 | NA | 1.23e-08 |
3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 2.08e-05 | NA | 1.44e-05 |
3. B | P14585 | Protein lin-12 | 1.37e-03 | NA | 2.99e-06 |
3. B | O14593 | DNA-binding protein RFXANK | 3.44e-06 | NA | 3.80e-08 |
3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 2.47e-03 | NA | 6.27e-04 |
3. B | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 | 3.08e-05 | NA | 0.014 |
3. B | Q9UPQ3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 2.23e-01 | NA | 0.002 |
3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 1.83e-02 | NA | 4.15e-08 |
3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 1.10e-02 | NA | 5.50e-05 |
3. B | Q07E41 | Cortactin-binding protein 2 | 3.72e-02 | NA | 5.25e-07 |
3. B | P62774 | Myotrophin | 1.54e-09 | NA | 8.74e-04 |
3. B | Q5I148 | I-Kappa-B like protein G2 | NA | NA | 0.008 |
3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | NA | 1.19e-12 |
3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 4.23e-05 | NA | 1.33e-11 |
3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 1.10e-06 | NA | 7.99e-11 |
3. B | Q02357 | Ankyrin-1 | 2.18e-02 | NA | 3.57e-16 |
3. B | O44997 | Death-associated protein kinase dapk-1 | 3.07e-03 | NA | 2.88e-11 |
3. B | Q5FVC7 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 9.54e-03 | NA | 0.008 |
3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 2.74e-09 | NA | 5.42e-10 |
3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 3.58e-05 | NA | 2.25e-17 |
3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 2.12e-11 | NA | 2.07e-65 |
3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 2.44e-04 | NA | 1.13e-05 |
3. B | Q29RM5 | Protein fem-1 homolog A | 7.17e-06 | NA | 1.87e-06 |
3. B | Q5ZK62 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 4.91e-02 | NA | 0.017 |
3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 5.83e-04 | NA | 2.56e-11 |
3. B | B2FKA7 | Actin-binding protein Smlt3054 | 2.56e-03 | NA | 1.54e-04 |
3. B | Q5U312 | Ankycorbin | 1.24e-06 | NA | 1.91e-17 |
3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 3.59e-02 | NA | 3.25e-10 |
3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 6.58e-07 | NA | 1.45e-09 |
3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 6.30e-04 | NA | 1.02e-07 |
3. B | Q8WUF5 | RelA-associated inhibitor | 7.81e-02 | NA | 0.019 |
3. B | A1ZBY1 | Protein fem-1 homolog B | 2.30e-05 | NA | 4.49e-06 |
3. B | Q08353 | NF-kappa-B inhibitor alpha | 8.52e-07 | NA | 3.04e-06 |
3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 9.23e-06 | NA | 5.87e-05 |
3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 1.52e-03 | NA | 2.59e-65 |
3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 1.86e-03 | NA | 2.95e-12 |
3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 6.23e-07 | NA | 2.11e-04 |
3. B | P53356 | Tyrosine-protein kinase HTK16 | 6.12e-03 | NA | 4.28e-04 |
3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 2.92e-07 | NA | 1.80e-07 |
3. B | Q7T0Q1 | Myotrophin | 1.86e-09 | NA | 1.27e-05 |
3. B | Q8LPS2 | Protein ACCELERATED CELL DEATH 6 | 1.29e-05 | NA | 0.043 |
3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 9.06e-09 | NA | 1.27e-06 |
3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 2.50e-01 | NA | 0.003 |
3. B | O70511 | Ankyrin-3 | 4.21e-02 | NA | 4.92e-16 |
3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 1.20e-04 | NA | 2.94e-04 |
3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 4.08e-05 | NA | 4.84e-14 |
3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 5.40e-03 | NA | 2.98e-04 |
3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | NA | 1.09e-12 |
3. B | P24769 | Ankyrin repeat protein B4 | NA | NA | 7.54e-04 |
3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 1.78e-01 | NA | 1.80e-06 |
3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 4.76e-05 | NA | 3.06e-09 |
3. B | Q5UPE2 | Putative ankyrin repeat protein L63 | NA | NA | 0.002 |
3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 1.97e-03 | NA | 5.00e-17 |
3. B | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 | 9.28e-05 | NA | 0.009 |
3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 6.32e-05 | NA | 6.38e-07 |
3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 1.53e-05 |
3. B | Q7XUW4 | Potassium channel KOR2 | 1.36e-05 | NA | 1.58e-10 |
3. B | Q15057 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 5.39e-03 | NA | 0.008 |
3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 8.12e-08 | NA | 2.20e-09 |
3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 2.31e-01 | NA | 7.14e-07 |
3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 9.87e-05 | NA | 1.08e-70 |
3. B | Q6BP80 | Palmitoyltransferase AKR1 | 6.01e-05 | NA | 0.002 |
3. B | D3J163 | Protein VAPYRIN-LIKE | 6.09e-07 | NA | 0.001 |
3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 8.90e-14 | NA | 1.24e-08 |
3. B | A2A690 | Protein TANC2 | 1.80e-02 | NA | 5.51e-10 |
3. B | A5A3E0 | POTE ankyrin domain family member F | 2.94e-05 | NA | 0.0 |
3. B | Q07DW4 | Cortactin-binding protein 2 | 1.28e-02 | NA | 4.59e-08 |
3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 1.17e-07 | NA | 1.33e-04 |
3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 1.44e-15 | NA | 2.50e-62 |
3. B | Q6FJ70 | Palmitoyltransferase AKR1 | 1.00e-05 | NA | 0.006 |
3. B | Q38898 | Potassium channel AKT2/3 | 7.16e-03 | NA | 1.20e-05 |
3. B | Q8VHH5 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 | 3.36e-01 | NA | 7.88e-05 |
3. B | Q8CGN4 | BCL-6 corepressor | 3.19e-01 | NA | 0.014 |
3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 1.78e-02 | NA | 1.28e-04 |
3. B | Q7T3X9 | Notch-regulated ankyrin repeat-containing protein B | 1.11e-04 | NA | 0.013 |
3. B | Q7T3P8 | Protein fem-1 homolog C | 7.98e-07 | NA | 1.66e-08 |
3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 3.86e-04 |
3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 5.77e-06 | NA | 1.65e-08 |
3. B | P17221 | Sex-determining protein fem-1 | 3.52e-06 | NA | 2.99e-04 |
3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 3.45e-05 | NA | 3.52e-05 |
3. B | A7MB89 | Protein fem-1 homolog C | 8.33e-07 | NA | 2.14e-09 |
3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 1.75e-02 | NA | 5.59e-04 |
3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.19e-04 | NA | 2.40e-04 |
3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 5.09e-03 | NA | 7.37e-12 |
3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 1.01e-03 | NA | 4.86e-06 |
3. B | Q2TB02 | NF-kappa-B inhibitor delta | 1.48e-05 | NA | 0.006 |
3. B | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 5.55e-05 | NA | 4.37e-04 |
3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 6.11e-04 | NA | 4.67e-67 |
3. B | Q06547 | GA-binding protein subunit beta-1 | 2.18e-04 | NA | 2.18e-09 |
3. B | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 1.78e-04 | NA | 2.52e-07 |
3. B | P55273 | Cyclin-dependent kinase 4 inhibitor D | 6.65e-11 | NA | 8.31e-06 |
3. B | Q62415 | Apoptosis-stimulating of p53 protein 1 | 1.16e-01 | NA | 0.019 |
3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 3.24e-09 | NA | 1.20e-11 |
3. B | Q8UVC1 | Inversin | 1.94e-05 | NA | 3.67e-13 |
3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 5.53e-06 | NA | 2.56e-70 |
3. B | Q2IBD4 | Cortactin-binding protein 2 | 1.22e-02 | NA | 1.59e-05 |
3. B | P0CG39 | POTE ankyrin domain family member J | 1.16e-06 | NA | 0.0 |
3. B | P46530 | Neurogenic locus notch homolog protein 1 | 1.37e-02 | NA | 3.01e-05 |
3. B | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 4.63e-06 | NA | 1.81e-04 |
3. B | Q63618 | Espin | 2.90e-04 | NA | 4.50e-07 |
3. B | B9EJA2 | Cortactin-binding protein 2 | 1.57e-02 | NA | 2.07e-06 |
3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 5.21e-03 | NA | 8.46e-18 |
3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 6.21e-01 | NA | 0.002 |
3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 3.30e-02 | NA | 1.98e-12 |
3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 6.72e-07 | NA | 4.61e-10 |
3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 3.08e-14 |
3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 9.02e-08 | NA | 5.63e-09 |
3. B | P40578 | Protein MGA2 | 5.87e-02 | NA | 0.001 |
3. B | Q6W2J9 | BCL-6 corepressor | 2.64e-01 | NA | 0.004 |
3. B | P0DSS9 | Ankyrin repeat protein B4 | NA | NA | 0.001 |
3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 1.91e-07 | NA | 4.91e-17 |
3. B | Q58CT0 | Dynein axonemal heavy chain 12 | 2.99e-05 | NA | 0.002 |
3. B | F1LTE0 | Protein TANC2 | 5.55e-03 | NA | 5.42e-10 |
3. B | B1AK53 | Espin | 1.34e-04 | NA | 2.41e-08 |
3. B | Q9ERC1 | Unconventional myosin-XVI | 2.20e-02 | NA | 3.39e-07 |
3. B | Q9P2R3 | Rabankyrin-5 | 6.74e-04 | NA | 5.12e-11 |
3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.38e-09 | NA | 2.46e-15 |
3. B | Q8UVC3 | Inversin | 1.29e-03 | NA | 2.99e-13 |
3. B | P13508 | Protein glp-1 | 1.70e-03 | NA | 3.67e-04 |
3. B | Q9SCX5 | Probable potassium channel AKT5 | 7.32e-04 | NA | 1.50e-10 |
3. B | Q05823 | 2-5A-dependent ribonuclease | 1.59e-04 | NA | 1.15e-08 |
3. B | P57044 | Integrin-linked protein kinase | 6.31e-05 | NA | 7.12e-07 |
3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 1.04e-08 | NA | 3.36e-08 |
3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 9.98e-05 | NA | 2.97e-04 |
3. B | O54910 | NF-kappa-B inhibitor epsilon | 1.52e-09 | NA | 4.25e-09 |
3. B | Q75HP9 | Potassium channel AKT2 | 3.49e-03 | NA | 4.62e-06 |
3. B | Q4X251 | Palmitoyltransferase akr1 | 2.85e-06 | NA | 3.89e-10 |
3. B | Q12013 | Probable palmitoyltransferase AKR2 | 4.79e-06 | NA | 2.81e-05 |
3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 8.99e-08 | NA | 4.52e-09 |
3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 2.86e-06 |
3. B | Q75HA6 | BTB/POZ domain and ankyrin repeat-containing protein NPR3 | 6.28e-04 | NA | 0.009 |
3. B | Q1RK82 | Putative ankyrin repeat protein RBE_0151 | 1.06e-06 | NA | 0.002 |
3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 5.93e-08 | NA | 1.49e-11 |
3. B | B7WN72 | Protein shank | 2.20e-03 | NA | 9.43e-07 |
3. B | Q9Z205 | DNA-binding protein RFXANK | 2.20e-05 | NA | 1.21e-08 |
3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 1.13e-02 | NA | 1.68e-05 |
3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 5.79e-05 | NA | 3.12e-05 |
3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 4.50e-04 | NA | 2.97e-09 |
3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.36e-04 | NA | 3.65e-16 |
3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 6.91e-04 | NA | 3.65e-11 |
3. B | Q01484 | Ankyrin-2 | NA | NA | 1.64e-17 |
3. B | Q9UK73 | Protein fem-1 homolog B | 6.79e-06 | NA | 7.86e-07 |
3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 1.22e-04 | NA | 1.61e-14 |
3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 7.99e-07 | NA | 1.84e-07 |
3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 2.72e-08 |
3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 1.40e-03 | NA | 3.65e-04 |
3. B | Q9U518 | L-asparaginase | 4.07e-04 | NA | 4.47e-04 |
3. B | Q9Y283 | Inversin | 9.15e-05 | NA | 2.78e-11 |
3. B | Q9J512 | Putative ankyrin repeat protein FPV223 | NA | NA | 1.26e-04 |
3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 3.87e-07 | NA | 1.12e-16 |
3. B | Q9M8S6 | Potassium channel SKOR | 9.08e-04 | NA | 3.61e-08 |
3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 3.02e-03 | NA | 6.04e-18 |
3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 8.72e-06 |
3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 2.15e-09 | NA | 1.51e-11 |
3. B | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 2.85e-06 | NA | 0.001 |
3. B | O70445 | BRCA1-associated RING domain protein 1 | 1.94e-02 | NA | 0.003 |
3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 5.09e-04 | NA | 8.88e-05 |
3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 7.03e-15 |
3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 5.41e-07 | NA | 1.05e-10 |
3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 2.03e-07 | NA | 3.34e-10 |
3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 3.43e-04 | NA | 9.63e-09 |
3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 1.25e-08 |
3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 2.89e-06 | NA | 0.049 |
3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 4.49e-05 | NA | 1.27e-12 |
3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 1.82e-04 | NA | 4.43e-11 |
3. B | Q876L5 | Palmitoyltransferase AKR1 | 7.34e-06 | NA | 9.13e-06 |
3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 8.31e-06 | NA | 1.28e-07 |
3. B | P16157 | Ankyrin-1 | 9.30e-03 | NA | 1.57e-16 |
3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 4.96e-08 | NA | 2.59e-70 |
3. B | O88202 | 60 kDa lysophospholipase | 2.55e-03 | NA | 3.01e-05 |
3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 1.99e-09 | NA | 1.35e-07 |
3. B | A4II29 | Notch-regulated ankyrin repeat-containing protein | 7.77e-05 | NA | 4.34e-04 |
3. B | Q6S8J3 | POTE ankyrin domain family member E | 7.64e-08 | NA | 0.0 |
3. B | Q0VGY8 | Protein TANC1 | 2.74e-03 | NA | 1.99e-12 |
3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 3.11e-05 | NA | 5.53e-11 |
3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 3.18e-03 | NA | 1.33e-14 |
3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 1.48e-03 | NA | 4.50e-09 |
3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 8.50e-03 | NA | 1.50e-04 |
3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 1.23e-02 | NA | 1.77e-07 |
3. B | Q653P0 | Potassium channel KOR1 | 1.31e-03 | NA | 9.71e-05 |
3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 8.94e-03 | NA | 1.38e-14 |
3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 5.13e-07 |
3. B | Q6P1S6 | Myotrophin | 1.38e-09 | NA | 4.46e-06 |
3. B | C7B178 | Protein VAPYRIN | 1.73e-05 | NA | 2.19e-08 |
3. B | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 2.24e-08 | NA | 0.048 |
3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 1.51e-05 | NA | 6.31e-05 |
3. B | Q875M2 | Palmitoyltransferase AKR1 | 6.79e-04 | NA | 1.31e-04 |
3. B | Q8VHK2 | Caskin-1 | 2.79e-03 | NA | 5.40e-12 |
3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 2.26e-02 | NA | 1.53e-04 |
3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 2.35e-04 | NA | 6.25e-04 |
3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 1.22e-02 | NA | 2.21e-71 |
3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 1.77e-04 | NA | 3.91e-09 |
3. B | Q9P0K7 | Ankycorbin | 1.99e-06 | NA | 3.33e-17 |
3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 4.64e-04 | NA | 3.65e-06 |
3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 5.71e-04 | NA | 0.008 |
3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 4.10e-04 | NA | 1.32e-08 |
3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 4.84e-05 | NA | 1.34e-12 |
3. B | Q5DU14 | Unconventional myosin-XVI | 7.47e-02 | NA | 5.78e-07 |
3. B | Q5UPE3 | Putative ankyrin repeat protein L62 | NA | NA | 0.005 |
3. B | Q94527 | Nuclear factor NF-kappa-B p110 subunit | 4.87e-03 | NA | 4.34e-05 |
3. B | Q5UQY4 | Putative ankyrin repeat protein R886 (Fragment) | NA | NA | 5.35e-05 |
3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 2.19e-04 | NA | 3.20e-04 |
3. B | Q15653 | NF-kappa-B inhibitor beta | 4.46e-06 | NA | 5.41e-05 |
3. B | O77617 | Cyclin-dependent kinase inhibitor 2A | 1.94e-05 | NA | 0.048 |
3. B | Q07E28 | Cortactin-binding protein 2 | 1.58e-02 | NA | 8.42e-07 |
3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 6.87e-01 | NA | 0.003 |
3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 6.46e-08 | NA | 2.34e-11 |
3. B | Q96P64 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 | 1.19e-01 | NA | 0.005 |
3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 1.03e-03 | NA | 0.002 |
3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.06e-06 | NA | 5.56e-70 |
3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 1.08e-04 | NA | 1.15e-13 |
3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 6.26e-04 | NA | 3.24e-10 |
3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 2.70e-04 | NA | 7.11e-05 |
3. B | A0M8T5 | Cortactin-binding protein 2 | 1.01e-02 | NA | 1.25e-06 |
3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 2.53e-06 |
3. B | Q5ZM55 | Protein fem-1 homolog B | 1.33e-06 | NA | 8.28e-07 |
3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 1.54e-04 | NA | 1.66e-06 |
3. B | Q07E15 | Cortactin-binding protein 2 | 4.70e-02 | NA | 2.50e-07 |
3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 2.15e-01 | NA | 0.002 |
3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 7.28e-09 | NA | 1.25e-12 |
3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 7.34e-03 | NA | 1.39e-09 |
3. B | Q9V7A7 | G patch domain and ankyrin repeat-containing protein 1 homolog | 4.05e-02 | NA | 0.024 |
3. B | Q94A76 | Potassium channel GORK | 1.54e-03 | NA | 2.50e-07 |
3. B | Q80UP5 | Ankyrin repeat domain-containing protein 13A | 6.27e-02 | NA | 0.040 |
3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 2.40e-08 | NA | 5.02e-20 |
3. B | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 5.03e-05 | NA | 0.003 |
3. B | O35516 | Neurogenic locus notch homolog protein 2 | 2.57e-02 | NA | 2.31e-05 |
3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 3.07e-11 | NA | 1.33e-04 |
3. B | Q755Y0 | Palmitoyltransferase AKR1 | 2.50e-06 | NA | 2.17e-06 |
3. B | Q6XJU9 | Osteoclast-stimulating factor 1 | 6.45e-05 | NA | 0.050 |
3. B | Q3UHD9 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 3.32e-01 | NA | 0.038 |
3. B | Q03017 | NF-kappa-B inhibitor cactus | 2.04e-05 | NA | 1.20e-06 |
3. B | Q91WD2 | Transient receptor potential cation channel subfamily V member 6 | 5.12e-05 | NA | 8.63e-05 |
3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 4.20e-03 | NA | 5.22e-06 |
3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 4.36e-06 | NA | 7.30e-13 |
3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 3.53e-05 | NA | 1.06e-06 |
3. B | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | NA | 0.003 |
3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 1.32e-03 | NA | 2.79e-06 |
3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 2.93e-04 | NA | 7.81e-04 |
3. B | A0M8S4 | Cortactin-binding protein 2 | 3.21e-02 | NA | 2.75e-07 |
3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 1.03e-07 | NA | 1.95e-05 |
3. B | A6NIR3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 | 1.48e-01 | NA | 0.004 |
3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 1.37e-06 | NA | 1.83e-15 |
3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 4.49e-04 | NA | 2.57e-09 |
3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 3.98e-01 | NA | 2.68e-06 |
3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 1.54e-04 | NA | 4.38e-13 |
3. B | Q9XSM3 | Transient receptor potential cation channel subfamily V member 5 | 1.24e-03 | NA | 0.004 |
3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 3.67e-06 | NA | 1.74e-13 |
3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 2.54e-06 | NA | 3.54e-07 |
3. B | Q6P9K8 | Caskin-1 | 1.86e-03 | NA | 4.16e-12 |
3. B | Q7ZUV0 | Ankyrin repeat domain-containing protein 13C | 3.80e-02 | NA | 0.027 |
3. B | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 9.61e-05 | NA | 6.49e-04 |
3. B | Q2IBA2 | Cortactin-binding protein 2 | 2.78e-02 | NA | 2.83e-07 |
3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 2.53e-06 | NA | 1.23e-10 |
3. B | Q3SWY2 | Integrin-linked protein kinase | 6.85e-04 | NA | 9.36e-07 |
3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.66e-04 | NA | 2.41e-13 |
3. B | Q876A6 | Palmitoyltransferase AKR1 | 1.25e-04 | NA | 2.19e-06 |
3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 1.72e-03 | NA | 2.79e-14 |
3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 2.52e-04 | NA | 3.39e-04 |
3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 1.57e-09 | NA | 1.75e-11 |
3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 2.86e-05 | NA | 9.88e-11 |
3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 5.99e-07 |
3. B | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 3.63e-08 | NA | 2.51e-05 |
3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 4.87e-03 | NA | 0.007 |
3. B | Q8NI38 | NF-kappa-B inhibitor delta | 7.85e-08 | NA | 0.028 |
3. B | Q9BYH8 | NF-kappa-B inhibitor zeta | 2.41e-04 | NA | 0.005 |
3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 3.02e-07 | NA | 4.72e-75 |
3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 4.62e-09 |
3. B | Q09701 | Palmitoyltransferase akr1 | 1.66e-07 | NA | 3.13e-06 |
3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 2.37e-02 | NA | 1.12e-06 |
3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 3.61e-05 | NA | 4.78e-05 |
3. B | P0C550 | Potassium channel AKT1 | 4.78e-03 | NA | 4.90e-07 |
3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 2.83e-03 | NA | 2.22e-05 |
3. B | G5EGA3 | Ankyrin repeat and LEM domain-containing protein 1 homolog | 8.11e-02 | NA | 0.001 |
3. B | Q8TF27 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 | 1.11e-01 | NA | 0.008 |
3. B | Q13625 | Apoptosis-stimulating of p53 protein 2 | 9.23e-02 | NA | 0.009 |
3. B | Q5VUJ5 | Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 | 1.08e-01 | NA | 0.005 |
3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 3.78e-05 | NA | 8.79e-08 |
3. B | Q2IBF8 | Cortactin-binding protein 2 | 1.87e-02 | NA | 4.23e-07 |
3. B | Q2T9K6 | Protein fem-1 homolog C | 5.27e-07 | NA | 3.86e-10 |
3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 5.70e-03 | NA | 8.27e-14 |
3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 9.42e-05 | NA | 3.40e-08 |
3. B | Q8VHK1 | Caskin-2 | 2.55e-04 | NA | 3.59e-06 |
3. B | Q9Y6X6 | Unconventional myosin-XVI | 7.95e-03 | NA | 4.64e-06 |
3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 3.13e-09 | NA | 1.90e-07 |
3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 3.11e-02 | NA | 5.59e-05 |
3. B | A5PK26 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 4.39e-02 | NA | 0.009 |
3. B | P46531 | Neurogenic locus notch homolog protein 1 | 5.25e-02 | NA | 1.79e-06 |
3. B | Q2IBE6 | Cortactin-binding protein 2 | 8.24e-03 | NA | 2.01e-06 |
3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 1.41e-07 | NA | 2.16e-12 |
3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 8.82e-05 | NA | 4.23e-06 |
3. B | Q09YG9 | Cortactin-binding protein 2 | 1.69e-02 | NA | 1.79e-06 |
3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 9.70e-05 | NA | 2.46e-06 |
3. B | Q0P5G1 | Tonsoku-like protein | 8.03e-02 | NA | 0.003 |
3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 6.36e-05 | NA | 0.002 |
3. B | Q52T38 | Protein S-acyltransferase 24 | 1.16e-06 | NA | 1.26e-04 |
3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 3.81e-04 | NA | 1.86e-13 |
3. B | Q96JP0 | Protein fem-1 homolog C | 6.51e-07 | NA | 2.03e-09 |
3. B | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 3.40e-03 | NA | 1.29e-06 |
3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 8.79e-02 | NA | 0.003 |
3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 3.56e-05 | NA | 8.11e-14 |
3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 3.82e-07 | NA | 5.45e-16 |
3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 9.59e-08 | NA | 1.14e-12 |
3. B | Q9DF58 | Integrin-linked protein kinase | 6.40e-04 | NA | 6.42e-07 |
3. B | Q8BLS7 | Ankyrin repeat domain-containing protein SOWAHA | 7.03e-03 | NA | 5.25e-04 |
3. B | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 2.12e-08 | NA | 3.22e-04 |
3. B | O60237 | Protein phosphatase 1 regulatory subunit 12B | 8.36e-04 | NA | 1.96e-05 |
3. B | Q6NZL6 | Tonsoku-like protein | 2.86e-02 | NA | 0.005 |
3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 9.13e-02 | NA | 0.029 |
3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 2.54e-04 | NA | 2.72e-07 |
3. B | Q569N2 | Ankyrin repeat domain-containing protein 37 | 8.58e-04 | NA | 0.015 |
3. B | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 7.16e-05 | NA | 0.005 |
3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 2.74e-04 | NA | 2.26e-07 |
3. B | Q00PJ1 | Cortactin-binding protein 2 | 4.39e-02 | NA | 1.87e-06 |
3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 9.40e-04 | NA | 1.24e-08 |
3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 1.03e-17 |
3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 8.79e-04 | NA | 4.17e-08 |
3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 1.33e-01 | NA | 1.60e-04 |
3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 1.21e-06 | NA | 3.67e-14 |
3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 1.10e-04 | NA | 7.64e-09 |
3. B | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 2.90e-05 | NA | 1.03e-04 |
3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 1.15e-03 | NA | 4.98e-60 |
3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 8.31e-05 | NA | 4.36e-11 |
3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 1.87e-04 | NA | 5.68e-05 |
3. B | O89019 | Inversin | 1.15e-04 | NA | 9.12e-12 |
3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 1.27e-03 | NA | 4.80e-06 |
3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 3.86e-08 | NA | 2.55e-09 |
3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | NA | 1.34e-11 |
3. B | Q9J4Z8 | Putative ankyrin repeat protein FPV242 | NA | NA | 0.015 |
3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 8.21e-07 | NA | 5.87e-17 |
3. B | Q0JKV1 | Potassium channel AKT1 | 1.50e-03 | NA | 4.95e-07 |
3. B | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 5.10e-11 | NA | 5.61e-05 |
3. B | Q2IBB2 | Cortactin-binding protein 2 | 1.89e-02 | NA | 1.70e-07 |
3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 1.43e-05 |
3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 9.72e-03 | NA | 3.49e-17 |
3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 1.57e-07 | NA | 4.52e-10 |
3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 5.62e-04 |
3. B | Q91955 | Myotrophin | 1.35e-09 | NA | 6.86e-04 |
3. B | P58546 | Myotrophin | 1.47e-09 | NA | 0.001 |
3. B | Q2QLG9 | Cortactin-binding protein 2 | 3.20e-02 | NA | 3.88e-06 |
3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 8.26e-08 | NA | 4.82e-09 |
3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 3.15e-12 |
3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 1.77e-11 |
3. B | Q5I1X5 | RelA-associated inhibitor | 3.64e-02 | NA | 0.003 |
3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 2.24e-04 | NA | 8.81e-06 |
3. B | P0CG38 | POTE ankyrin domain family member I | 1.52e-05 | NA | 0.0 |
3. B | O74205 | Transcription factor TOXE | 2.40e-04 | NA | 0.003 |
3. B | Q6S5H5 | POTE ankyrin domain family member G | 1.18e-08 | NA | 0.0 |
3. B | P77736 | Putative ankyrin repeat protein YahD | 6.22e-15 | NA | 1.15e-04 |
3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 7.29e-05 | NA | 1.22e-15 |
3. B | Q9EST8 | NF-kappa-B inhibitor zeta | 1.09e-03 | NA | 0.002 |
3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 4.00e-09 |
3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 1.70e-05 | NA | 1.06e-14 |
3. B | P0CS67 | Palmitoyltransferase AKR1 | 9.88e-06 | NA | 3.72e-07 |
3. B | Q9Z2G0 | Protein fem-1 homolog B | 1.95e-06 | NA | 8.07e-07 |
3. B | Q9XXH8 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 | 2.18e-02 | NA | 0.010 |
3. B | P14356 | Ankyrin repeat protein M1 | NA | NA | 0.004 |
3. B | G5E8K5 | Ankyrin-3 | 5.89e-03 | NA | 1.16e-16 |
3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 9.49e-05 | NA | 1.35e-12 |
3. B | Q4UJC0 | Putative ankyrin repeat protein RF_p42/RF_pd42 | 5.73e-06 | NA | 0.007 |
3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 1.60e-05 | NA | 3.83e-43 |
3. B | Q6DD51 | Caskin-2 | 4.04e-03 | NA | 1.90e-08 |
3. B | Q5VW22 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 | 1.30e-01 | NA | 0.007 |
3. B | Q3TYA6 | M-phase phosphoprotein 8 | 3.05e-03 | NA | 4.06e-04 |
3. B | P21783 | Neurogenic locus notch homolog protein 1 | 3.04e-02 | NA | 3.17e-06 |
3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 6.39e-04 | NA | 2.23e-13 |
3. B | Q6NUI1 | Putative coiled-coil domain-containing protein 144 N-terminal-like | 3.39e-01 | NA | 5.83e-05 |
3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 1.70e-06 | NA | 7.15e-14 |
3. B | Q96HA7 | Tonsoku-like protein | 3.77e-02 | NA | 0.004 |
3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 1.60e-05 | NA | 2.86e-73 |
3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 7.33e-07 | NA | 1.49e-09 |
3. B | Q99549 | M-phase phosphoprotein 8 | 8.44e-03 | NA | 7.00e-05 |
3. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 1.13e-01 | NA | 2.48e-06 |
3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 3.31e-08 | NA | 1.95e-08 |
3. B | Q63746 | NF-kappa-B inhibitor alpha | 6.72e-08 | NA | 2.53e-05 |
3. B | Q9R186 | Transient receptor potential cation channel subfamily V member 6 | 2.44e-05 | NA | 9.91e-05 |
3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 2.45e-03 | NA | 3.78e-04 |
3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 3.09e-07 |
3. B | Q07DV1 | Cortactin-binding protein 2 | 2.57e-02 | NA | 2.15e-06 |
3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 2.23e-05 | NA | 3.14e-14 |
3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 1.82e-06 | NA | 7.83e-08 |
3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 1.08e-05 | NA | 9.35e-05 |
3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 4.18e-01 | NA | 0.001 |
3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 6.41e-03 | NA | 2.11e-05 |
3. B | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 6.43e-05 | NA | 4.10e-06 |
3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 3.23e-04 | NA | 3.46e-07 |
3. B | Q07DX4 | Cortactin-binding protein 2 | 2.09e-02 | NA | 2.51e-06 |
3. B | Q1RHQ8 | Putative ankyrin repeat protein RBE_1025 | 4.64e-06 | NA | 0.003 |
3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 1.83e-07 | NA | 2.10e-15 |
3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 5.50e-06 | NA | 3.08e-04 |
3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 6.65e-05 | NA | 9.35e-06 |
3. B | Q8H569 | Potassium channel AKT3 | 1.23e-02 | NA | 3.16e-07 |
3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 2.35e-03 | NA | 4.30e-13 |
3. B | A6NI47 | Putative POTE ankyrin domain family member M | 4.23e-09 | NA | 0.0 |
3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 6.29e-09 |
3. B | Q6C520 | Palmitoyltransferase AKR1 | 2.48e-07 | NA | 3.25e-06 |
3. B | Q2QLA2 | Cortactin-binding protein 2 | 2.18e-02 | NA | 3.60e-07 |
3. B | Q74ZH9 | Glycerophosphocholine phosphodiesterase GDE1 | 6.66e-03 | NA | 0.020 |
3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 6.72e-09 | NA | 5.77e-09 |
3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 2.37e-02 | NA | 1.25e-16 |
3. B | Q86AT8 | Stress-activated protein kinase alpha | 2.04e-05 | NA | 5.08e-09 |
3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 1.41e-12 | NA | 2.17e-07 |
3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 1.78e-05 | NA | 0.040 |
3. B | Q09YM8 | Cortactin-binding protein 2 | 2.01e-02 | NA | 7.93e-06 |
3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 4.17e-04 | NA | 7.74e-10 |
3. B | Q6GPE5 | Protein fem-1 homolog B | 1.43e-05 | NA | 1.09e-05 |
3. B | Q8WXE0 | Caskin-2 | 4.41e-04 | NA | 5.02e-06 |
3. B | Q8BXK8 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 3.70e-01 | NA | 0.002 |
3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 7.11e-07 | NA | 2.22e-08 |
3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 3.53e-03 | NA | 1.15e-10 |
3. B | Q80YE7 | Death-associated protein kinase 1 | 5.81e-03 | NA | 3.53e-17 |
3. B | Q5URB8 | Putative ankyrin repeat protein R841 | NA | NA | 2.73e-04 |
3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 2.89e-09 |
3. B | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 9.25e-03 | NA | 6.70e-05 |
3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 9.77e-07 | NA | 7.94e-10 |
3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 2.32e-03 | NA | 7.76e-09 |
3. B | Q7Z6K4 | Notch-regulated ankyrin repeat-containing protein | 6.19e-04 | NA | 0.001 |
3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 9.77e-15 | NA | 8.98e-12 |
3. B | O00221 | NF-kappa-B inhibitor epsilon | 1.58e-06 | NA | 2.03e-08 |
3. B | P33825 | Ankyrin repeat protein M1 | NA | NA | 0.022 |
3. B | Q3UYR4 | Espin-like protein | 4.45e-05 | NA | 8.49e-05 |
3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 9.24e-03 | NA | 5.69e-17 |
3. B | Q4V890 | Protein fem-1 homolog A | 2.22e-06 | NA | 3.10e-05 |
3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 1.69e-05 | NA | 5.55e-74 |
3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 8.75e-13 |
3. B | P20640 | Ankyrin repeat protein M1 | NA | NA | 0.004 |
3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 2.51e-06 | NA | 3.64e-124 |
3. B | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 4.18e-11 | NA | 2.32e-05 |
3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 2.05e-02 | NA | 0.008 |
3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 1.40e-07 | NA | 1.41e-07 |
3. B | Q8CGU4 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 5.72e-01 | NA | 0.038 |
3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 8.51e-06 | NA | 8.64e-11 |
3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 3.39e-07 |
3. B | Q91974 | NF-kappa-B inhibitor alpha | 8.91e-08 | NA | 9.62e-05 |
3. B | Q5AL27 | Palmitoyltransferase AKR1 | 3.84e-05 | NA | 3.80e-04 |
3. B | Q54F46 | Homeobox protein Wariai | 1.88e-04 | NA | 1.08e-11 |
3. B | A2RUR9 | Coiled-coil domain-containing protein 144A | 4.60e-01 | NA | 4.97e-38 |
3. B | Q108T9 | Cortactin-binding protein 2 | 1.80e-02 | NA | 3.31e-08 |
3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 8.57e-10 | NA | 1.49e-11 |
3. B | Q9ET47 | Espin | 5.78e-05 | NA | 2.84e-06 |
3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 4.06e-07 | NA | 5.99e-14 |
3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 1.17e-04 | NA | 1.81e-11 |
3. B | Q05921 | 2-5A-dependent ribonuclease | 4.96e-04 | NA | 1.34e-08 |
3. B | Q8CG79 | Apoptosis-stimulating of p53 protein 2 | 9.90e-02 | NA | 0.008 |
3. B | Q99490 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 5.14e-01 | NA | 0.048 |
3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 2.12e-05 | NA | 1.36e-16 |
3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 1.21e-14 | NA | 0.003 |
3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 7.10e-05 | NA | 5.88e-08 |
3. B | Q02979 | Glycerophosphocholine phosphodiesterase GDE1 | 3.42e-02 | NA | 4.67e-05 |
3. B | B0Y3V7 | Probable Xaa-Pro aminopeptidase P | 6.43e-01 | NA | 0.012 |
3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.03e-03 | NA | 3.83e-17 |
3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 1.43e-08 |
3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 2.61e-05 | NA | 2.74e-09 |
3. B | P81069 | GA-binding protein subunit beta-2 | 3.69e-07 | NA | 8.88e-09 |
3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 1.69e-03 | NA | 6.99e-04 |
3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 4.17e-03 | NA | 5.87e-74 |
3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 1.69e-05 | NA | 9.96e-18 |
3. B | Q00420 | GA-binding protein subunit beta-1 | 2.15e-06 | NA | 2.80e-09 |
3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.95e-05 | NA | 3.87e-04 |
3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 2.19e-06 |
3. B | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 1.44e-05 | NA | 0.040 |
3. B | Q96P47 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 | 2.70e-01 | NA | 6.68e-05 |
3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 3.66e-06 | NA | 1.18e-08 |
3. B | Q4UKI1 | Putative ankyrin repeat protein RF_1099 | 1.41e-05 | NA | 0.005 |
3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 9.00e-04 | NA | 1.49e-10 |
3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 1.44e-03 | NA | 0.019 |
3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 1.05e-03 | NA | 1.46e-05 |
3. B | Q13418 | Integrin-linked protein kinase | 6.04e-04 | NA | 9.45e-07 |
3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 6.78e-05 |
3. B | Q6ZVH7 | Espin-like protein | 3.16e-04 | NA | 1.04e-04 |
3. B | Q9BE45 | NF-kappa-B inhibitor zeta | 5.57e-04 | NA | 0.003 |
3. B | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 4.47e-04 | NA | 0.006 |
3. B | Q9C0D5 | Protein TANC1 | 5.65e-03 | NA | 9.27e-11 |
3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 2.25e-05 | NA | 5.52e-11 |
3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 5.83e-04 | NA | 1.44e-05 |
3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 1.17e-05 |
3. B | Q6ZQK5 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 5.29e-02 | NA | 0.008 |
3. B | Q07DZ5 | Cortactin-binding protein 2 | 3.12e-02 | NA | 2.34e-06 |
3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 2.69e-02 | NA | 7.14e-07 |
3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 4.38e-10 | NA | 1.94e-56 |
3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 4.99e-03 | NA | 3.94e-12 |
3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 7.92e-02 | NA | 5.51e-10 |
3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 1.83e-04 | NA | 3.80e-07 |
3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 1.01e-05 | NA | 1.50e-09 |
3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.64e-05 | NA | 2.46e-17 |
3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.62e-04 | NA | 3.71e-16 |
3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.57e-09 | NA | 8.31e-11 |
3. B | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 1.22e-03 | NA | 4.51e-04 |
3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 2.47e-03 | NA | 0.004 |
3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 3.17e-01 | NA | 0.002 |
3. B | Q20500 | Intracellular phospholipase A2 | 3.03e-03 | NA | 4.11e-05 |
3. B | Q9EP71 | Ankycorbin | 1.97e-05 | NA | 2.77e-18 |
3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 2.39e-01 | NA | 5.67e-04 |
3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 2.27e-03 | NA | 2.69e-07 |
3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 2.11e-04 | NA | 2.72e-19 |
3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 2.09e-04 | NA | 4.70e-13 |
3. B | Q2QLB3 | Cortactin-binding protein 2 | 1.76e-02 | NA | 5.92e-07 |
3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 4.18e-01 | NA | 2.38e-06 |
3. B | O22265 | Signal recognition particle 43 kDa protein, chloroplastic | 3.16e-03 | NA | 2.88e-04 |
3. B | Q9JIA3 | NF-kappa-B inhibitor beta | 2.04e-05 | NA | 3.09e-07 |
3. B | O55222 | Integrin-linked protein kinase | 1.04e-04 | NA | 1.02e-06 |
3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 7.99e-09 |
3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 3.36e-05 | NA | 4.15e-15 |
3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 6.01e-05 | NA | 1.77e-09 |
3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 1.34e-03 | NA | 2.81e-04 |
3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 1.18e-04 | NA | 3.25e-04 |
3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 4.89e-03 | NA | 2.54e-07 |
3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 4.33e-02 | NA | 2.14e-05 |
3. B | Q09YI1 | Cortactin-binding protein 2 | 1.81e-02 | NA | 6.22e-07 |
3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 1.21e-07 | NA | 4.00e-04 |
3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 4.85e-09 | NA | 1.50e-07 |
3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 9.32e-04 | NA | 5.69e-17 |
3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 5.94e-07 | NA | 1.92e-09 |
3. B | Q7T2B9 | Myotrophin | 4.38e-09 | NA | 2.78e-06 |
3. B | P0DST0 | Ankyrin repeat protein B4 | NA | NA | 0.001 |
3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 9.19e-12 |
3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.67e-05 | NA | 4.28e-15 |
3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 9.99e-08 | NA | 2.49e-09 |
3. B | Q6P9Z4 | Protein fem-1 homolog A | 1.93e-06 | NA | 8.50e-08 |
3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 1.77e-05 | NA | 9.76e-10 |
3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 5.16e-04 | NA | 9.58e-09 |
3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 2.62e-02 | NA | 2.35e-05 |
3. B | Q86U10 | 60 kDa lysophospholipase | 2.39e-03 | NA | 1.63e-04 |
3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 1.48e-04 | NA | 3.28e-04 |
3. B | Q60649 | Caseinolytic peptidase B protein homolog | 3.32e-02 | NA | 5.59e-04 |
3. B | Q6IVG4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 5.23e-02 | NA | 0.007 |
3. B | Q6NRL1 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 2.61e-01 | NA | 0.037 |
3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 4.64e-05 | NA | 1.23e-14 |
3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 3.11e-03 | NA | 6.28e-05 |
3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 9.10e-06 | NA | 2.20e-06 |
3. B | Q0VC93 | Ankyrin repeat domain-containing protein 37 | 4.91e-05 | NA | 0.010 |
3. B | Q9BSK4 | Protein fem-1 homolog A | 3.75e-06 | NA | 2.39e-06 |
3. B | A1DF27 | Probable Xaa-Pro aminopeptidase P | 6.61e-01 | NA | 0.012 |
3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 7.47e-03 | NA | 1.10e-10 |
3. B | A0JNU3 | 60 kDa lysophospholipase | 1.66e-03 | NA | 1.46e-06 |
3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 2.83e-04 | NA | 1.54e-14 |
3. B | Q8IYA2 | Putative coiled-coil domain-containing protein 144C | 7.74e-01 | NA | 8.10e-10 |
3. B | D4A615 | Tonsoku-like protein | 2.08e-02 | NA | 0.004 |
3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.48e-04 | NA | 6.91e-17 |
3. B | Q96KQ4 | Apoptosis-stimulating of p53 protein 1 | 4.60e-02 | NA | 0.018 |
3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 4.12e-09 | NA | 1.51e-10 |
3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.32e-04 | NA | 1.98e-14 |
3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 1.11e-06 | NA | 5.85e-06 |
3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 4.15e-05 | NA | 1.51e-12 |
3. B | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 2.81e-03 | NA | 1.41e-06 |
3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 4.30e-07 | NA | 2.32e-12 |
3. B | Q810B6 | Rabankyrin-5 | 3.96e-04 | NA | 1.25e-11 |
3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 1.80e-11 |
3. B | Q09YJ3 | Cortactin-binding protein 2 | 2.40e-02 | NA | 3.00e-07 |
3. B | Q12955 | Ankyrin-3 | NA | NA | 1.69e-16 |
3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 5.78e-05 | NA | 5.43e-04 |
3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 1.44e-04 | NA | 1.86e-04 |
3. B | Q8C0T1 | Protein fem-1 homolog A-B | 3.69e-06 | NA | 4.78e-05 |
3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 7.69e-02 | NA | 6.65e-08 |
3. B | P04297 | Interferon antagonist K1L | NA | NA | 0.020 |
3. B | Q38998 | Potassium channel AKT1 | 1.44e-03 | NA | 3.81e-07 |
3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 8.04e-07 | NA | 8.38e-10 |
3. B | Q54LF0 | NAD-dependent deacetylase sir2B | 5.01e-05 | NA | 0.002 |
3. B | P20749 | B-cell lymphoma 3 protein | 5.31e-07 | NA | 4.01e-13 |
3. B | Q7S3M5 | Palmitoyltransferase akr1 | 1.15e-05 | NA | 6.09e-10 |
3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 9.66e-04 | NA | 1.40e-13 |
3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 2.28e-03 | NA | 4.24e-05 |
3. B | Q5R5V4 | Integrin-linked protein kinase | 1.02e-04 | NA | 9.20e-07 |
3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 4.73e-06 | NA | 6.81e-09 |
3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | NA | 3.64e-12 |
3. B | P62775 | Myotrophin | 1.18e-09 | NA | 8.74e-04 |
3. B | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | NA | 0.009 |
3. B | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 3.02e-05 | NA | 4.49e-12 |
3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 2.24e-02 | NA | 3.38e-04 |
3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 1.64e-01 | NA | 5.72e-05 |
3. B | P31695 | Neurogenic locus notch homolog protein 4 | 2.52e-02 | NA | 3.74e-09 |
3. B | Q8GXE6 | Potassium channel AKT6 | 6.57e-03 | NA | 6.20e-10 |
3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 6.77e-02 | NA | 8.25e-06 |
3. B | Q9N3Q8 | Dauer abnormal formation protein 25 | 3.40e-04 | NA | 0.010 |
3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 1.28e-02 | NA | 3.45e-04 |
3. B | Q09YK4 | Cortactin-binding protein 2 | 1.96e-02 | NA | 6.34e-06 |
3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 2.06e-17 |
3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 5.88e-04 | NA | 5.76e-14 |
3. B | Q6F6B3 | Protein TANC1 | 2.54e-03 | NA | 7.78e-12 |
3. B | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 8.62e-13 | NA | 0.021 |
3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 5.96e-06 | NA | 3.28e-04 |
3. B | Q7T3Y0 | Notch-regulated ankyrin repeat-containing protein A | 3.71e-04 | NA | 0.002 |
3. B | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 4.31e-06 | NA | 4.36e-07 |
3. B | P40480 | Protein HOS4 | 1.87e-04 | NA | 6.12e-04 |
3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 1.12e-04 | NA | 2.42e-06 |
3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 2.76e-04 | NA | 6.56e-09 |
3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 9.71e-04 | NA | 1.34e-13 |
3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 8.15e-09 | NA | 7.02e-12 |
3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 2.83e-03 | NA | 7.48e-06 |
3. B | Q92HB1 | Putative ankyrin repeat protein RC0860 | 9.68e-03 | NA | 1.02e-04 |
3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 3.28e-02 | NA | 0.006 |
3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 3.29e-09 | NA | 1.32e-13 |
3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.77e-09 | NA | 6.44e-14 |
3. B | Q91ZA8 | Notch-regulated ankyrin repeat-containing protein | 4.30e-04 | NA | 0.001 |
3. B | Q96P50 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 | 1.88e-02 | NA | 0.002 |
3. B | P42570 | DNA replication inhibitor plutonium | 1.10e-06 | NA | 4.33e-04 |
3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 9.93e-07 |
3. B | Q99728 | BRCA1-associated RING domain protein 1 | 4.32e-02 | NA | 8.58e-04 |
3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 5.28e-05 | NA | 7.85e-11 |
3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 1.68e-03 | NA | 9.11e-13 |
3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 4.37e-02 | NA | 9.88e-07 |
3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 2.56e-04 | NA | 6.65e-06 |
3. B | Q3T0F7 | Myotrophin | 1.41e-09 | NA | 0.001 |
3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 6.06e-02 | NA | 3.81e-63 |
3. B | Q07DY4 | Cortactin-binding protein 2 | 7.43e-02 | NA | 2.85e-07 |
3. B | Q9HCD6 | Protein TANC2 | 2.78e-02 | NA | 1.81e-10 |
3. B | A1X157 | Cortactin-binding protein 2 | 3.92e-02 | NA | 8.35e-07 |
3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 5.36e-11 | NA | 0.011 |
3. B | Q6S545 | POTE ankyrin domain family member H | 3.65e-07 | NA | 0.0 |
3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 2.19e-04 | NA | 4.33e-19 |
3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 3.53e-04 | NA | 1.41e-13 |
3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 4.86e-05 | NA | 5.85e-11 |
3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 8.41e-05 | NA | 3.42e-09 |
3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 4.00e-07 | NA | 3.10e-12 |
3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 7.74e-10 |
3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 7.92e-06 | NA | 1.56e-08 |
3. B | P18954 | Protein PhlB | 1.67e-06 | NA | 2.48e-07 |
3. B | Q99J82 | Integrin-linked protein kinase | 5.71e-04 | NA | 1.02e-06 |
3. B | Q2QLF8 | Cortactin-binding protein 2 | 2.78e-02 | NA | 1.07e-06 |
3. B | Q2IBF7 | Cortactin-binding protein 2 | 1.43e-02 | NA | 2.11e-06 |
3. B | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 7.80e-07 | NA | 0.002 |
3. B | Q1RI31 | Putative ankyrin repeat protein RBE_0902 | 8.23e-06 | NA | 0.033 |
3. B | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 1.46e-03 | NA | 3.99e-04 |
3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 1.50e-04 | NA | 4.17e-18 |
3. B | P53355 | Death-associated protein kinase 1 | 6.06e-03 | NA | 3.88e-17 |
3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 3.17e-03 | NA | 7.46e-11 |
3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.66e-04 | NA | 1.83e-13 |
3. B | Q875S9 | Palmitoyltransferase AKR1 | 1.57e-04 | NA | 8.58e-07 |
3. B | P0CS66 | Palmitoyltransferase AKR1 | 6.70e-04 | NA | 3.72e-07 |
3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 1.05e-08 | NA | 1.93e-09 |
3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 2.56e-09 | NA | 4.95e-11 |
3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.97e-03 | NA | 1.96e-15 |
3. B | P21001 | Ankyrin repeat protein B4 | NA | NA | 0.002 |
3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 2.60e-03 | NA | 1.93e-12 |
3. B | Q863Z4 | Myotrophin | 1.33e-09 | NA | 0.001 |
3. B | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 1.39e-08 | NA | 5.15e-04 |
3. B | Q6JAN1 | Inversin | 2.20e-04 | NA | 2.84e-11 |
3. B | G3V8T1 | M-phase phosphoprotein 8 | 4.53e-03 | NA | 0.001 |
3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 3.38e-04 | NA | 3.51e-06 |
3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 3.16e-05 | NA | 2.09e-14 |
3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 2.71e-10 |
3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 5.51e-12 | NA | 0.003 |
3. B | P23631 | Alpha-latrotoxin-Lt1a | 2.94e-03 | NA | 1.06e-08 |
3. B | Q5U5A6 | Notch-regulated ankyrin repeat-containing protein | 6.50e-04 | NA | 4.09e-04 |
3. B | P39010 | Palmitoyltransferase AKR1 | 1.94e-05 | NA | 5.14e-05 |
3. B | Q8WXD9 | Caskin-1 | 8.46e-04 | NA | 1.32e-12 |
3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 2.40e-06 | NA | 7.28e-15 |
3. B | Q60778 | NF-kappa-B inhibitor beta | 3.82e-07 | NA | 5.55e-07 |
3. B | Q9FPH0 | Putative E3 ubiquitin-protein ligase XBAT34 | 5.12e-03 | NA | 0.041 |
3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 1.90e-02 | NA | 0.009 |
3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 4.30e-02 | NA | 2.18e-08 |
3. B | Q8WZ74 | Cortactin-binding protein 2 | 2.47e-02 | NA | 2.28e-06 |
3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 2.27e-07 | NA | 3.78e-07 |
3. B | Q5B0V6 | Palmitoyltransferase akr1 | 5.02e-05 | NA | 1.48e-07 |
3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 1.24e-03 | NA | 2.16e-05 |
3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 3.19e-03 | NA | 1.23e-09 |
3. B | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 8.77e-08 | NA | 1.16e-06 |
3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 6.92e-05 | NA | 1.86e-14 |
3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 8.62e-04 | NA | 1.81e-06 |
3. B | Q2QL82 | Cortactin-binding protein 2 | 2.63e-02 | NA | 1.11e-07 |
3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 1.80e-03 | NA | 3.23e-13 |
3. B | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 1.18e-05 | NA | 0.003 |