Summary

Q6U949

Homolog: P0C5K7.
Function: Cancer/testis antigen 62.

Statistics

Total GO Annotation: 5
Unique PROST Go: 5
Unique BLAST Go: 0

Total Homologs: 29
Unique PROST Homologs: 28
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P0C5K7 (Cancer/testis antigen 62) with a FATCAT P-Value: 0.0338 and RMSD of 3.09 angstrom. The sequence alignment identity is 18.6%.
Structural alignment shown in left. Query protein Q6U949 colored as red in alignment, homolog P0C5K7 colored as blue. Query protein Q6U949 is also shown in right top, homolog P0C5K7 showed in right bottom. They are colored based on secondary structures. 

  Q6U949 -MSKRKWRGFRGAQQERAQPPAASPQPCPAPH-----AGLPGGSRRRAPAPAGQQ---QM-RAESRS-------G------AQRRRGSARRGAH--REAG 75
  P0C5K7 MMHTTSYR--------RLSPPHLTDQPSAYSHTHRTFSHFSCGSQ-----PAAQRLHVELWNADLQSEFLCPCLGLTLYLTCNPQLGKRKFCSHSSEDMS 87

  Q6U949 GCVRGRTRSSGSERSNALWQAVDAAEALALSSP-LRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGRRRRGADLALTPLAGEGHTRWRQPGRPGK 168
  P0C5K7 KMVSRRNVKDSHEVSGSL-QA--TLQVISFSFPFL-------LH-TCSHPLS--------HPTSGQRR-------------------------- 136

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0000932 P-body
2. P GO:0005634 nucleus
2. P GO:0016021 integral component of membrane
2. P GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
2. P GO:0033644 host cell membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6U949 Putative insulin-like growth factor 2 antisense gene protein 0 1.15e-141 9.26e-112
2. P A8MZ25 Putative uncharacterized protein FLJ38767 8.91e-02 5.64e-04 NA
2. P Q5SY85 Protein FAM201A 1.10e-01 1.02e-05 NA
2. P O83829 Uncharacterized protein TP_0857 2.22e-01 2.53e-02 NA
2. P P22440 Protein VP5 NA 1.69e-03 NA
2. P Q8WZB0 Putative uncharacterized protein encoded by LINC00476 2.78e-01 2.55e-04 NA
2. P Q8IYB0 Putative uncharacterized protein MGC39545 3.63e-01 4.56e-03 NA
2. P Q8N910 Putative uncharacterized protein PAK6-AS1 3.22e-01 6.35e-07 NA
2. P P0DMU3 FAM231A/C-like protein LOC102723383 8.23e-02 3.23e-07 NA
2. P P25620 Uncharacterized protein YCR022C 6.18e-01 1.44e-03 NA
2. P Q9Y7P7 Uncharacterized protein C191.03c 2.31e-01 2.02e-02 NA
2. P A1L4Q6 Putative uncharacterized protein FLJ41423 4.60e-01 3.98e-03 NA
2. P P15481 Protein VP5 NA 1.47e-02 NA
2. P Q3E7Z1 Uncharacterized protein YNL146C-A 3.61e-01 3.75e-03 NA
2. P Q9Y4M8 Putative uncharacterized protein encoded by LINC00588 4.63e-02 3.49e-02 NA
2. P Q6ZRV3 Putative uncharacterized protein encoded by LINC00696 8.14e-01 2.60e-05 NA
2. P Q8N1V8 Uncharacterized protein encoded by LINC01561 8.50e-01 6.04e-03 NA
2. P P0C5K7 Cancer/testis antigen 62 3.38e-02 4.26e-03 NA
2. P O83780 Uncharacterized protein TP_0802 6.68e-01 6.47e-03 NA
2. P Q9ULZ0 TP53-target gene 3 protein 2.09e-01 4.78e-04 NA
2. P B5X392 Proline-rich nuclear receptor coactivator 2 2.02e-01 3.01e-02 NA
2. P Q96MZ4 Protein FAM218A 5.54e-02 1.43e-03 NA
2. P A8K010 Putative transcriptional regulator encoded by LINC00473 8.04e-02 3.89e-02 NA
2. P Q96NJ1 Uncharacterized protein FLJ30774 3.31e-01 3.18e-02 NA
2. P Q96NR7 Putative uncharacterized protein WWC2-AS2 2.55e-02 3.79e-03 NA
2. P P25221 Protein VP5 NA 1.48e-02 NA
2. P Q98185 Protein MC014 NA 9.32e-03 NA
2. P P03848 Uncharacterized protein repA4 6.91e-01 3.46e-02 NA
2. P Q8N9P0 Putative uncharacterized protein FLJ36797 3.98e-02 1.69e-02 NA