Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P10775
(Ribonuclease inhibitor) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.96 angstrom. The sequence alignment identity is 25.0%.
Structural alignment shown in left. Query protein Q6UY01 colored as red in alignment, homolog P10775 colored as blue.
Query protein Q6UY01 is also shown in right top, homolog P10775 showed in right bottom. They are colored based on secondary structures.
Q6UY01 MSQTRKKTSSEGETKPQTSTVNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAKPLSSEMEWRSSMEKNEHFLQKLGKKAVNKCLDLNNCGLTT 100 P10775 --------------------------------------------------------------------------------------MN--LDI-HC---- 7 Q6UY01 ADMKEMVALLPFLPDLEEL-DISWNGFVGGT-LLSITQQMHLVSKLKILRLGSCRLTTDDVQALGEAFEMIPELEELNLSWNSKVG--GNLPLILQKFQK 196 P10775 ----------------EQLSDARW------TELLPLLQQYEVV------RLDDCGLTEEHCKDIGSALRANPSLTELCLRTN-ELGDAG-VHLVLQGLQS 77 Q6UY01 GS-KIQMIELVDCSLTSEDGTFLGQLLP-MLQSLEVL-DLSINRDIVGS--LNSIAQGLKSTS-NLKVLKLHSCGLSQKSVKILDAAFRYLGELRKLDLS 290 P10775 PTCKIQKLSLQNCSLT-EAG--CG-VLPSTLRSLPTLRELHLSDNPLGDAGLRLLCEGLLDPQCHLEKLQLEYCRLTAASCEPLASVLRATRALKELTVS 173 Q6UY01 CNKDLG--G------GFEDSPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKKMGSS--SE---NLLSRLRFLPA--LKSLVINN 375 P10775 -NNDIGEAGARVLGQGLADSACQ------LETLRLENCGLTPANCKDLCGIVASQASLRELDLGSN-GLGDAGIAELCPGLLS-----PASRLKTLWLWE 260 Q6UY01 CALESETFTALAE-ASVHLSA---LEVFNLSWNKCVG--GNLKLLLETLKL--SMSLQVLRLSSCSLVT----EDVALLASVIQTGHLAKLQKLDLSYN- 462 P10775 CDI---TASGCRDLCRV-LQAKETLKELSLAGNK-LGDEG-ARLLCESL-LQPGCQLESLWVKSCSL-TAACCQHVSLM--LTQNKHL--LE-LQLSSNK 347 Q6UY01 --DS----ICDA----GWTMF-------------CQNVRFL----KELIELDISLRPSNFRDC-GQWFRHLLYAVTKLPQITEIG--MKRWILPASQE-E 531 P10775 LGDSGIQELCQALSQPGTTLRVLCLGDCEVTNSGCSSLASLLLANRSLRELDL----SN--NCVGD--PGVLQLLGSLEQ---PGCALEQLVLYDTYWTE 436 Q6UY01 ELECFDQDKKRSIHFDHG---GFQ--- 552 P10775 EVE----DRLQAL---EGSKPGLRVIS 456
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006954 | inflammatory response |
| 1. PB | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 1. PB | GO:0002237 | response to molecule of bacterial origin |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0008428 | ribonuclease inhibitor activity |
| 1. PB | GO:0032311 | angiogenin-PRI complex |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0014070 | response to organic cyclic compound |
| 1. PB | GO:0045087 | innate immune response |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0005654 | nucleoplasm |
| 1. PB | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0045765 | regulation of angiogenesis |
| 2. P | GO:0021540 | corpus callosum morphogenesis |
| 2. P | GO:0010011 | auxin binding |
| 2. P | GO:0010508 | positive regulation of autophagy |
| 2. P | GO:0090141 | positive regulation of mitochondrial fission |
| 2. P | GO:1901970 | positive regulation of mitotic sister chromatid separation |
| 2. P | GO:0070848 | response to growth factor |
| 2. P | GO:0000425 | pexophagy |
| 2. P | GO:0005589 | collagen type VI trimer |
| 2. P | GO:0055046 | microgametogenesis |
| 2. P | GO:0032496 | response to lipopolysaccharide |
| 2. P | GO:0043202 | lysosomal lumen |
| 2. P | GO:0036312 | phosphatidylinositol 3-kinase regulatory subunit binding |
| 2. P | GO:0051216 | cartilage development |
| 2. P | GO:0006404 | RNA import into nucleus |
| 2. P | GO:0034612 | response to tumor necrosis factor |
| 2. P | GO:0035882 | defecation rhythm |
| 2. P | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 2. P | GO:0032914 | positive regulation of transforming growth factor beta1 production |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0001847 | opsonin receptor activity |
| 2. P | GO:0009524 | phragmoplast |
| 2. P | GO:0000056 | ribosomal small subunit export from nucleus |
| 2. P | GO:0045121 | membrane raft |
| 2. P | GO:0070171 | negative regulation of tooth mineralization |
| 2. P | GO:0002718 | regulation of cytokine production involved in immune response |
| 2. P | GO:0009873 | ethylene-activated signaling pathway |
| 2. P | GO:0030688 | preribosome, small subunit precursor |
| 2. P | GO:0061608 | nuclear import signal receptor activity |
| 2. P | GO:0000159 | protein phosphatase type 2A complex |
| 2. P | GO:0035307 | positive regulation of protein dephosphorylation |
| 2. P | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 2. P | GO:2000746 | regulation of defecation rhythm |
| 2. P | GO:0000447 | endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0016567 | protein ubiquitination |
| 2. P | GO:0106167 | extracellular ATP signaling |
| 2. P | GO:0031578 | mitotic spindle orientation checkpoint signaling |
| 2. P | GO:1903044 | protein localization to membrane raft |
| 2. P | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 2. P | GO:0042567 | insulin-like growth factor ternary complex |
| 2. P | GO:0031430 | M band |
| 2. P | GO:0071562 | nucleus-vacuole junction assembly |
| 2. P | GO:0032026 | response to magnesium ion |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0019903 | protein phosphatase binding |
| 2. P | GO:0000329 | fungal-type vacuole membrane |
| 2. P | GO:0042942 | D-serine transport |
| 2. P | GO:0072542 | protein phosphatase activator activity |
| 2. P | GO:0003431 | growth plate cartilage chondrocyte development |
| 2. P | GO:0034517 | ribophagy |
| 2. P | GO:0008543 | fibroblast growth factor receptor signaling pathway |
| 2. P | GO:1905393 | plant organ formation |
| 2. P | GO:0004842 | ubiquitin-protein transferase activity |
| 2. P | GO:0070891 | lipoteichoic acid binding |
| 2. P | GO:2001042 | negative regulation of septum digestion after cytokinesis |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0050840 | extracellular matrix binding |
| 2. P | GO:0010105 | negative regulation of ethylene-activated signaling pathway |
| 2. P | GO:0000480 | endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0043066 | negative regulation of apoptotic process |
| 2. P | GO:0009897 | external side of plasma membrane |
| 2. P | GO:0009612 | response to mechanical stimulus |
| 2. P | GO:0004722 | protein serine/threonine phosphatase activity |
| 2. P | GO:0006513 | protein monoubiquitination |
| 2. P | GO:0002244 | hematopoietic progenitor cell differentiation |
| 2. P | GO:0071378 | cellular response to growth hormone stimulus |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:1905909 | regulation of dauer entry |
| 2. P | GO:1904027 | negative regulation of collagen fibril organization |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0035304 | regulation of protein dephosphorylation |
| 2. P | GO:0000822 | inositol hexakisphosphate binding |
| 2. P | GO:0099575 | regulation of protein catabolic process at presynapse, modulating synaptic transmission |
| 2. P | GO:0001822 | kidney development |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0003735 | structural constituent of ribosome |
| 2. P | GO:0005520 | insulin-like growth factor binding |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0042635 | positive regulation of hair cycle |
| 2. P | GO:0042144 | vacuole fusion, non-autophagic |
| 2. P | GO:0061975 | articular cartilage development |
| 2. P | GO:0044830 | modulation by host of viral RNA genome replication |
| 2. P | GO:0000109 | nucleotide-excision repair complex |
| 2. P | GO:0071727 | cellular response to triacyl bacterial lipopeptide |
| 2. P | GO:0042383 | sarcolemma |
| 2. P | GO:0071365 | cellular response to auxin stimulus |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0048443 | stamen development |
| 2. P | GO:0061303 | cornea development in camera-type eye |
| 2. P | GO:0071219 | cellular response to molecule of bacterial origin |
| 2. P | GO:0060348 | bone development |
| 2. P | GO:0042325 | regulation of phosphorylation |
| 2. P | GO:0010506 | regulation of autophagy |
| 2. P | GO:0009861 | jasmonic acid and ethylene-dependent systemic resistance |
| 2. P | GO:0061073 | ciliary body morphogenesis |
| 2. P | GO:0033085 | negative regulation of T cell differentiation in thymus |
| 2. P | GO:0009451 | RNA modification |
| 2. P | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 2. P | GO:0009555 | pollen development |
| 2. P | GO:2000022 | regulation of jasmonic acid mediated signaling pathway |
| 2. P | GO:0043624 | |
| 2. P | GO:0070245 | positive regulation of thymocyte apoptotic process |
| 2. P | GO:0042564 | NLS-dependent protein nuclear import complex |
| 2. P | GO:0032911 | negative regulation of transforming growth factor beta1 production |
| 2. P | GO:0043495 | protein-membrane adaptor activity |
| 2. P | GO:0010596 | negative regulation of endothelial cell migration |
| 2. P | GO:0071726 | cellular response to diacyl bacterial lipopeptide |
| 2. P | GO:0045596 | negative regulation of cell differentiation |
| 2. P | GO:0071222 | cellular response to lipopolysaccharide |
| 2. P | GO:0007568 | aging |
| 2. P | GO:0046600 | negative regulation of centriole replication |
| 2. P | GO:0030282 | bone mineralization |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0098633 | collagen fibril binding |
| 2. P | GO:0021960 | anterior commissure morphogenesis |
| 2. P | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 2. P | GO:0071460 | cellular response to cell-matrix adhesion |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0032760 | positive regulation of tumor necrosis factor production |
| 2. P | GO:0007601 | visual perception |
| 2. P | GO:0045182 | translation regulator activity |
| 2. P | GO:0051901 | positive regulation of mitochondrial depolarization |
| 2. P | GO:0043153 | entrainment of circadian clock by photoperiod |
| 2. P | GO:0045892 | negative regulation of transcription, DNA-templated |
| 2. P | GO:0048511 | rhythmic process |
| 2. P | GO:0043326 | chemotaxis to folate |
| 2. P | GO:1904761 | negative regulation of myofibroblast differentiation |
| 2. P | GO:0008139 | nuclear localization sequence binding |
| 2. P | GO:0006898 | receptor-mediated endocytosis |
| 2. P | GO:0000086 | G2/M transition of mitotic cell cycle |
| 2. P | GO:1901332 | negative regulation of lateral root development |
| 2. P | GO:0010311 | lateral root formation |
| 2. P | GO:0045471 | response to ethanol |
| 2. P | GO:0000472 | endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0005518 | collagen binding |
| 2. P | GO:0031012 | extracellular matrix |
| 2. P | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 2. P | GO:0032481 | positive regulation of type I interferon production |
| 2. P | GO:0010239 | chloroplast mRNA processing |
| 2. P | GO:0043053 | dauer entry |
| 2. P | GO:0071255 | Cvt vesicle assembly |
| 2. P | GO:0071723 | lipopeptide binding |
| 2. P | GO:0019888 | protein phosphatase regulator activity |
| 2. P | GO:0030686 | 90S preribosome |
| 2. P | GO:0032757 | positive regulation of interleukin-8 production |
| 2. P | GO:0001530 | lipopolysaccharide binding |
| 2. P | GO:0005539 | glycosaminoglycan binding |
| 2. P | GO:0001890 | placenta development |
| 2. P | GO:0048387 | negative regulation of retinoic acid receptor signaling pathway |
| 2. P | GO:0008157 | protein phosphatase 1 binding |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0005516 | calmodulin binding |
| 2. P | GO:0071223 | cellular response to lipoteichoic acid |
| 2. P | GO:0006171 | cAMP biosynthetic process |
| 2. P | GO:0001974 | blood vessel remodeling |
| 2. P | GO:0031362 | anchored component of external side of plasma membrane |
| 2. P | GO:1902916 | positive regulation of protein polyubiquitination |
| 2. P | GO:0016019 | peptidoglycan immune receptor activity |
| 2. P | GO:0009617 | response to bacterium |
| 2. P | GO:0001662 | behavioral fear response |
| 2. P | GO:0019800 | peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan |
| 2. P | GO:0097009 | energy homeostasis |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0031344 | regulation of cell projection organization |
| 2. P | GO:0051602 | response to electrical stimulus |
| 2. P | GO:0009641 | shade avoidance |
| 2. P | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 2. P | GO:0009723 | response to ethylene |
| 2. P | GO:0000011 | vacuole inheritance |
| 2. P | GO:0070936 | protein K48-linked ubiquitination |
| 2. P | GO:0005583 | fibrillar collagen trimer |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0033148 | positive regulation of intracellular estrogen receptor signaling pathway |
| 2. P | GO:0046579 | positive regulation of Ras protein signal transduction |
| 2. P | GO:0008284 | positive regulation of cell population proliferation |
| 2. P | GO:0071561 | nucleus-vacuole junction |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0019900 | kinase binding |
| 2. P | GO:0098868 | bone growth |
| 2. P | GO:0030199 | collagen fibril organization |
| 2. P | GO:0038198 | auxin receptor activity |
| 2. P | GO:0016525 | negative regulation of angiogenesis |
| 2. P | GO:0047485 | protein N-terminus binding |
| 2. P | GO:0046872 | metal ion binding |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0002213 | defense response to insect |
| 2. P | GO:0006364 | rRNA processing |
| 2. P | GO:0007519 | skeletal muscle tissue development |
| 2. P | GO:0030133 | transport vesicle |
| 2. P | GO:0062023 | collagen-containing extracellular matrix |
| 2. P | GO:0051726 | regulation of cell cycle |
| 2. P | GO:1900865 | chloroplast RNA modification |
| 2. P | GO:0042060 | wound healing |
| 2. P | GO:0007181 | transforming growth factor beta receptor complex assembly |
| 2. P | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0006607 | NLS-bearing protein import into nucleus |
| 2. P | GO:0009901 | anther dehiscence |
| 2. P | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 2. P | GO:0000164 | protein phosphatase type 1 complex |
| 2. P | GO:0055047 | generative cell mitosis |
| 2. P | GO:0045807 | positive regulation of endocytosis |
| 2. P | GO:0071563 | Myo2p-Vac17p-Vac8p transport complex |
| 2. P | GO:0031648 | protein destabilization |
| 2. P | GO:0010152 | pollen maturation |
| 2. P | GO:1900747 | negative regulation of vascular endothelial growth factor signaling pathway |
| 2. P | GO:0009734 | auxin-activated signaling pathway |
| 3. B | GO:0010555 | response to mannitol |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0051402 | neuron apoptotic process |
| 3. B | GO:0051656 | establishment of organelle localization |
| 3. B | GO:0002526 | acute inflammatory response |
| 3. B | GO:0051260 | protein homooligomerization |
| 3. B | GO:0045630 | positive regulation of T-helper 2 cell differentiation |
| 3. B | GO:0045571 | negative regulation of imaginal disc growth |
| 3. B | GO:0032717 | negative regulation of interleukin-8 production |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0072559 | NLRP3 inflammasome complex |
| 3. B | GO:0032491 | detection of molecule of fungal origin |
| 3. B | GO:0010375 | stomatal complex patterning |
| 3. B | GO:0090333 | regulation of stomatal closure |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0031953 | negative regulation of protein autophosphorylation |
| 3. B | GO:0072558 | NLRP1 inflammasome complex |
| 3. B | GO:0045186 | zonula adherens assembly |
| 3. B | GO:0043549 | regulation of kinase activity |
| 3. B | GO:2000553 | positive regulation of T-helper 2 cell cytokine production |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0016333 | morphogenesis of follicular epithelium |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0045851 | pH reduction |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0034123 | positive regulation of toll-like receptor signaling pathway |
| 3. B | GO:0060471 | cortical granule exocytosis |
| 3. B | GO:0061133 | endopeptidase activator activity |
| 3. B | GO:0060340 | positive regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0140426 | PAMP-triggered immunity signalling pathway |
| 3. B | GO:0032879 | regulation of localization |
| 3. B | GO:0071224 | cellular response to peptidoglycan |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0010376 | stomatal complex formation |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0032754 | positive regulation of interleukin-5 production |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0004864 | protein phosphatase inhibitor activity |
| 3. B | GO:0010954 | positive regulation of protein processing |
| 3. B | GO:0002830 | positive regulation of type 2 immune response |
| 3. B | GO:0061851 | leading edge of lamellipodium |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0140608 | cysteine-type endopeptidase activator activity |
| 3. B | GO:0072002 | Malpighian tubule development |
| 3. B | GO:0060581 | cell fate commitment involved in pattern specification |
| 3. B | GO:0007318 | pole plasm protein localization |
| 3. B | GO:0051293 | establishment of spindle localization |
| 3. B | GO:1901895 | negative regulation of ATPase-coupled calcium transmembrane transporter activity |
| 3. B | GO:0090630 | activation of GTPase activity |
| 3. B | GO:0048226 | Casparian strip |
| 3. B | GO:0072089 | stem cell proliferation |
| 3. B | GO:0019991 | septate junction assembly |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0032753 | positive regulation of interleukin-4 production |
| 3. B | GO:1990723 | cytoplasmic periphery of the nuclear pore complex |
| 3. B | GO:0010090 | trichome morphogenesis |
| 3. B | GO:0007464 | R3/R4 cell fate commitment |
| 3. B | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 3. B | GO:0060339 | negative regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0045345 | positive regulation of MHC class I biosynthetic process |
| 3. B | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:1905034 | regulation of antifungal innate immune response |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0030714 | anterior/posterior axis specification, follicular epithelium |
| 3. B | GO:0034162 | toll-like receptor 9 signaling pathway |
| 3. B | GO:0016334 | establishment or maintenance of polarity of follicular epithelium |
| 3. B | GO:0089720 | caspase binding |
| 3. B | GO:0071485 | cellular response to absence of light |
| 3. B | GO:0045169 | fusome |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0009934 | regulation of meristem structural organization |
| 3. B | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0016332 | establishment or maintenance of polarity of embryonic epithelium |
| 3. B | GO:0008656 | cysteine-type endopeptidase activator activity involved in apoptotic process |
| 3. B | GO:0009416 | response to light stimulus |
| 3. B | GO:0008154 | actin polymerization or depolymerization |
| 3. B | GO:0061702 | inflammasome complex |
| 3. B | GO:0036126 | sperm flagellum |
| 3. B | GO:0071391 | cellular response to estrogen stimulus |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0060473 | cortical granule |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0032661 | regulation of interleukin-18 production |
| 3. B | GO:0048678 | response to axon injury |
| 3. B | GO:0002674 | negative regulation of acute inflammatory response |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0042659 | regulation of cell fate specification |
| 3. B | GO:1990794 | basolateral part of cell |
| 3. B | GO:0044546 | NLRP3 inflammasome complex assembly |
| 3. B | GO:0090696 | post-embryonic plant organ development |
| 3. B | GO:0036289 | peptidyl-serine autophosphorylation |
| 3. B | GO:0016715 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen |
| 3. B | GO:0002720 | positive regulation of cytokine production involved in immune response |
| 3. B | GO:0009742 | brassinosteroid mediated signaling pathway |
| 3. B | GO:0071215 | cellular response to abscisic acid stimulus |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0016335 | morphogenesis of larval imaginal disc epithelium |
| 3. B | GO:0043281 | regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:1904784 | NLRP1 inflammasome complex assembly |
| 3. B | GO:0045175 | basal protein localization |
| 3. B | GO:0012501 | programmed cell death |
| 3. B | GO:0034163 | regulation of toll-like receptor 9 signaling pathway |
| 3. B | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 3. B | GO:0097264 | self proteolysis |
| 3. B | GO:0044614 | nuclear pore cytoplasmic filaments |
| 3. B | GO:0043621 | protein self-association |
| 3. B | GO:0036019 | endolysosome |
| 3. B | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0097202 | activation of cysteine-type endopeptidase activity |
| 3. B | GO:0032715 | negative regulation of interleukin-6 production |
| 3. B | GO:0032692 | negative regulation of interleukin-1 production |
| 3. B | GO:2000067 | regulation of root morphogenesis |
| 3. B | GO:0051014 | actin filament severing |
| 3. B | GO:0009968 | negative regulation of signal transduction |
| 3. B | GO:0002218 | activation of innate immune response |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0045322 | unmethylated CpG binding |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0035635 | entry of bacterium into host cell |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:0043204 | perikaryon |
| 3. B | GO:0060335 | positive regulation of interferon-gamma-mediated signaling pathway |
| 3. B | GO:0036020 | endolysosome membrane |
| 3. B | GO:0002758 | innate immune response-activating signal transduction |
| 3. B | GO:0043027 | cysteine-type endopeptidase inhibitor activity involved in apoptotic process |
| 3. B | GO:0002523 | leukocyte migration involved in inflammatory response |
| 3. B | GO:0051607 | defense response to virus |
| 3. B | GO:0042393 | histone binding |
| 3. B | GO:0035088 | establishment or maintenance of apical/basal cell polarity |
| 3. B | GO:0032731 | positive regulation of interleukin-1 beta production |
| 3. B | GO:0032741 | positive regulation of interleukin-18 production |
| 3. B | GO:0070373 | negative regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0017024 | myosin I binding |
| 3. B | GO:0090708 | specification of plant organ axis polarity |
| 3. B | GO:0000724 | double-strand break repair via homologous recombination |
| 3. B | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0032736 | positive regulation of interleukin-13 production |
| 3. B | GO:0042585 | germinal vesicle |
| 3. B | GO:0043487 | regulation of RNA stability |
| 3. B | GO:0106333 | subcortical maternal complex |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:1904115 | axon cytoplasm |
| 3. B | GO:0007252 | I-kappaB phosphorylation |
| 3. B | GO:0030317 | flagellated sperm motility |
| 3. B | GO:0001653 | peptide receptor activity |
| 3. B | GO:1901528 | hydrogen peroxide mediated signaling pathway involved in stomatal movement |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:0008233 | peptidase activity |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0070685 | macropinocytic cup |
| 3. B | GO:0097300 | programmed necrotic cell death |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0051016 | barbed-end actin filament capping |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0106311 | |
| 3. B | GO:0032691 | negative regulation of interleukin-1 beta production |
| 3. B | GO:0002240 | response to molecule of oomycetes origin |
| 3. B | GO:0040019 | positive regulation of embryonic development |
| 3. B | GO:0032090 | Pyrin domain binding |
| 3. B | GO:0033612 | receptor serine/threonine kinase binding |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0042555 | MCM complex |
| 3. B | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 3. B | GO:0015631 | tubulin binding |
| 3. B | GO:0050727 | regulation of inflammatory response |
| 3. B | GO:0072557 | IPAF inflammasome complex |
| 3. B | GO:0016045 | detection of bacterium |
| 3. B | GO:0042742 | defense response to bacterium |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:0007472 | wing disc morphogenesis |
| 3. B | GO:0000776 | kinetochore |
| 3. B | GO:0045577 | regulation of B cell differentiation |
| 3. B | GO:1904117 | cellular response to vasopressin |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0005662 | DNA replication factor A complex |
| 3. B | GO:0035101 | FACT complex |
| 3. B | GO:0070269 | pyroptosis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6UY01 | Leucine-rich repeat-containing protein 31 | 0 | 8.22e-149 | 0.0 |
| 1. PB | Q8HZP9 | Ribonuclease inhibitor | 7.77e-16 | 1.78e-12 | 1.53e-16 |
| 1. PB | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 4.08e-05 | 1.60e-11 | 0.001 |
| 1. PB | P13489 | Ribonuclease inhibitor | 5.55e-16 | 2.14e-12 | 2.03e-17 |
| 1. PB | P10775 | Ribonuclease inhibitor | 1.11e-16 | 2.68e-09 | 9.88e-17 |
| 1. PB | P29315 | Ribonuclease inhibitor | 7.77e-16 | 6.83e-09 | 2.87e-16 |
| 1. PB | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 8.39e-09 | 4.94e-12 | 0.008 |
| 1. PB | Q91VI7 | Ribonuclease inhibitor | 6.66e-16 | 8.88e-09 | 2.55e-18 |
| 2. P | Q94819 | Telomerase component p95 | 7.13e-05 | 3.12e-05 | NA |
| 2. P | Q6PEZ8 | Podocan-like protein 1 | 1.85e-08 | 4.04e-05 | NA |
| 2. P | Q6ZQY2 | Leucine-rich repeat-containing protein 74B | 1.29e-09 | 9.00e-15 | NA |
| 2. P | Q66GN3 | Protein NPGR2 | 4.37e-02 | 1.97e-02 | NA |
| 2. P | P22194 | Protein phosphatase 1 regulatory subunit SDS22 | 1.65e-08 | 1.57e-06 | NA |
| 2. P | Q7XVM8 | Transport inhibitor response 1-like protein Os04g0395600 | 2.64e-07 | 2.22e-02 | NA |
| 2. P | Q9BYS8 | Leucine-rich repeat-containing protein 2 | 1.35e-04 | 9.01e-06 | NA |
| 2. P | Q5UQA7 | Putative F-box/LRR-repeat protein R542 | NA | 1.22e-02 | NA |
| 2. P | Q8AVI4 | Leucine-rich repeat protein SHOC-2 | 6.09e-06 | 9.11e-16 | NA |
| 2. P | O35343 | Importin subunit alpha-3 | 1.34e-01 | 4.35e-02 | NA |
| 2. P | B4IBI9 | Leucine-rich repeat protein soc-2 homolog | 1.04e-05 | 3.86e-04 | NA |
| 2. P | Q32L08 | Protein AMN1 homolog | 4.31e-04 | 7.07e-06 | NA |
| 2. P | A2RTY3 | Protein HEATR9 | 4.46e-02 | 3.90e-04 | NA |
| 2. P | Q5RFE9 | Leucine-rich repeat-containing protein 40 | 1.83e-05 | 2.81e-02 | NA |
| 2. P | Q9M8W9 | Pentatricopeptide repeat-containing protein At3g04130, mitochondrial | 1.71e-02 | 3.04e-02 | NA |
| 2. P | Q9LSK8 | Pentatricopeptide repeat-containing protein At3g18020 | 2.03e-02 | 4.99e-02 | NA |
| 2. P | A6NHZ5 | Leucine-rich repeat-containing protein 14B | 3.06e-05 | 2.33e-02 | NA |
| 2. P | Q2U5T5 | Vacuolar protein 8 | 1.36e-02 | 6.99e-04 | NA |
| 2. P | Q9DE68 | Decorin | 1.12e-05 | 4.50e-06 | NA |
| 2. P | C5JK19 | Nucleolar protein 9 | 6.60e-02 | 6.90e-05 | NA |
| 2. P | Q8N4B4 | F-box only protein 39 | 8.87e-05 | 8.89e-03 | NA |
| 2. P | P0C8Q3 | Pentatricopeptide repeat-containing protein At4g19890 | 1.96e-02 | 4.80e-02 | NA |
| 2. P | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | 3.48e-03 | NA |
| 2. P | P51885 | Lumican | 1.07e-07 | 2.16e-03 | NA |
| 2. P | Q7SXW3 | Leucine-rich repeat-containing protein 40 | 1.16e-05 | 3.28e-02 | NA |
| 2. P | Q8N1E6 | F-box/LRR-repeat protein 14 | 2.77e-08 | 2.87e-05 | NA |
| 2. P | O88520 | Leucine-rich repeat protein SHOC-2 | 2.82e-06 | 1.95e-12 | NA |
| 2. P | A6NM36 | Leucine-rich repeat-containing protein 30 | 4.99e-06 | 1.80e-07 | NA |
| 2. P | Q09299 | Putative RNA-binding protein EEED8.10 | 1.70e-05 | 1.16e-02 | NA |
| 2. P | Q5UPQ4 | Putative ankyrin repeat protein L764 | NA | 5.06e-03 | NA |
| 2. P | Q9XSD9 | Decorin | 6.37e-06 | 1.26e-03 | NA |
| 2. P | B3FL73 | F-box/LRR-repeat protein 21 | 2.81e-04 | 1.16e-02 | NA |
| 2. P | Q810Y8 | Preferentially expressed antigen in melanoma-like protein 7 | 4.55e-06 | 1.06e-03 | NA |
| 2. P | O95522 | PRAME family member 12 | 1.40e-05 | 1.68e-02 | NA |
| 2. P | Q5UPU9 | Putative ankyrin repeat protein L273 | NA | 1.75e-02 | NA |
| 2. P | Q759Y1 | ATPase expression protein 1, mitochondrial | 9.50e-02 | 6.41e-03 | NA |
| 2. P | P07585 | Decorin | 1.18e-05 | 1.44e-03 | NA |
| 2. P | Q7RXW1 | Vacuolar protein 8 | 2.04e-02 | 3.16e-02 | NA |
| 2. P | Q28680 | Monocyte differentiation antigen CD14 | 2.76e-04 | 6.62e-04 | NA |
| 2. P | Q6GPJ5 | Leucine-rich repeat-containing protein 40 | 1.66e-05 | 3.16e-03 | NA |
| 2. P | P13605 | Fibromodulin | 1.01e-04 | 3.94e-03 | NA |
| 2. P | Q8VC16 | Leucine-rich repeat-containing protein 14 | 6.57e-06 | 2.01e-02 | NA |
| 2. P | B5DX45 | Leucine-rich repeat protein soc-2 homolog | 1.68e-06 | 1.30e-04 | NA |
| 2. P | B8N3R8 | Nucleolar protein 9 | 9.19e-02 | 1.27e-02 | NA |
| 2. P | B4N9T4 | Leucine-rich repeat protein soc-2 homolog | 3.85e-06 | 2.88e-03 | NA |
| 2. P | Q4R642 | Dynein regulatory complex subunit 5 | 2.70e-06 | 1.43e-03 | NA |
| 2. P | P14356 | Ankyrin repeat protein M1 | NA | 1.06e-02 | NA |
| 2. P | Q3UV48 | Leucine-rich repeat-containing protein 30 | 1.12e-05 | 4.23e-06 | NA |
| 2. P | Q7Z5L7 | Podocan | 2.87e-06 | 2.84e-09 | NA |
| 2. P | O74999 | DNA repair protein rhp7 | 3.05e-05 | 2.31e-02 | NA |
| 2. P | Q5R3Z8 | F-box/LRR-repeat protein 2 | 8.55e-10 | 7.83e-05 | NA |
| 2. P | P34284 | F-box/LRR-repeat protein fbxl-1 | 2.14e-07 | 1.11e-07 | NA |
| 2. P | B3P3E8 | Leucine-rich repeat protein soc-2 homolog | 4.03e-06 | 4.59e-05 | NA |
| 2. P | Q7TQ62 | Podocan | 8.35e-06 | 2.13e-08 | NA |
| 2. P | Q3URY6 | Armadillo repeat-containing protein 2 | 1.04e-01 | 3.55e-02 | NA |
| 2. P | P21810 | Biglycan | 5.02e-08 | 5.16e-05 | NA |
| 2. P | O43028 | Vacuolar protein 8 | 1.65e-02 | 4.02e-03 | NA |
| 2. P | Q4R6F0 | Leucine-rich repeat and death domain-containing protein 1 | 1.26e-05 | 4.50e-12 | NA |
| 2. P | O00505 | Importin subunit alpha-4 | 7.70e-02 | 2.28e-02 | NA |
| 2. P | Q5R8X9 | Protein AMN1 homolog | 1.79e-05 | 1.31e-03 | NA |
| 2. P | Q6CTF5 | Meiotic sister-chromatid recombination protein 6, mitochondrial | 1.29e-02 | 3.09e-04 | NA |
| 2. P | P0DUQ2 | PRAME family member 9 | NA | 1.50e-02 | NA |
| 2. P | Q6DIQ3 | Protein phosphatase 1 regulatory subunit 7 | 1.32e-07 | 1.94e-07 | NA |
| 2. P | Q708Y0 | EIN3-binding F-box protein 2 | 2.42e-07 | 1.07e-02 | NA |
| 2. P | Q8VYT5 | F-box protein At5g07670 | 9.59e-05 | 7.56e-05 | NA |
| 2. P | Q0P4D1 | Protein AMN1 homolog | 2.45e-05 | 4.13e-08 | NA |
| 2. P | Q9UKT7 | F-box/LRR-repeat protein 3 | 5.86e-05 | 2.86e-02 | NA |
| 2. P | Q5UQC5 | Uncharacterized protein L228 | NA | 1.75e-03 | NA |
| 2. P | C5DQD7 | Nucleolar protein 9 | 5.78e-02 | 3.10e-02 | NA |
| 2. P | C5G8V2 | Nucleolar protein 9 | 5.35e-02 | 3.85e-05 | NA |
| 2. P | Q5M8G4 | Leucine-rich repeat-containing protein 40 | 1.25e-05 | 5.90e-03 | NA |
| 2. P | A6NGN4 | PRAME family member 25 | 3.19e-06 | 1.61e-02 | NA |
| 2. P | O02678 | Biglycan | 5.20e-05 | 2.96e-06 | NA |
| 2. P | A8XWW4 | Leucine-rich repeat protein soc-2 | 3.81e-07 | 4.03e-14 | NA |
| 2. P | Q9BXN1 | Asporin | 2.85e-05 | 1.46e-02 | NA |
| 2. P | Q99MW3 | Preferentially expressed antigen in melanoma-like protein 1 | 1.90e-05 | 2.14e-03 | NA |
| 2. P | Q9SMY8 | F-box/LRR-repeat protein 15 | 1.24e-04 | 5.78e-03 | NA |
| 2. P | P11745 | Ran GTPase-activating protein 1 | 1.51e-07 | 1.03e-03 | NA |
| 2. P | P47853 | Biglycan | 6.04e-05 | 3.72e-05 | NA |
| 2. P | Q4R744 | Protein HEATR9 | 7.85e-02 | 2.57e-02 | NA |
| 2. P | Q3UJB3 | Leucine-rich repeat-containing protein 14B | 3.83e-05 | 1.34e-04 | NA |
| 2. P | P26337 | Putative adenylate cyclase regulatory protein | 6.84e-07 | 1.03e-06 | NA |
| 2. P | Q0VAA2 | Leucine-rich repeat-containing protein 74A | 1.78e-07 | 1.42e-08 | NA |
| 2. P | Q8N531 | F-box/LRR-repeat protein 6 | 4.05e-07 | 4.40e-02 | NA |
| 2. P | Q5R1V9 | Decorin | 2.86e-05 | 1.44e-03 | NA |
| 2. P | Q28CU0 | Leucine-rich repeat-containing protein 23 | 7.72e-05 | 6.62e-04 | NA |
| 2. P | P28654 | Decorin | 6.20e-06 | 8.98e-03 | NA |
| 2. P | Q22875 | Leucine-rich repeat protein soc-2 | 1.40e-06 | 3.84e-15 | NA |
| 2. P | Q640Z9 | Leucine-rich repeat-containing protein 14 | 1.16e-05 | 3.16e-03 | NA |
| 2. P | B4PU77 | Leucine-rich repeat protein soc-2 homolog | 6.88e-06 | 4.71e-02 | NA |
| 2. P | P23799 | Putative adenylate cyclase regulatory protein | 9.36e-06 | 4.12e-06 | NA |
| 2. P | Q8N9N7 | Leucine-rich repeat-containing protein 57 | 4.90e-06 | 3.91e-02 | NA |
| 2. P | Q15435 | Protein phosphatase 1 regulatory subunit 7 | 2.06e-06 | 7.63e-08 | NA |
| 2. P | O74783 | SCF E3 ubiquitin ligase complex F-box protein pof2 | 3.65e-08 | 3.26e-06 | NA |
| 2. P | Q5UPH1 | Putative ankyrin repeat protein L99 | NA | 9.55e-03 | NA |
| 2. P | Q5NBU5 | F-box only protein 39 | 6.99e-05 | 4.62e-02 | NA |
| 2. P | Q9FGN4 | F-box protein At5g51370 | 3.01e-05 | 4.98e-04 | NA |
| 2. P | Q2TB02 | NF-kappa-B inhibitor delta | 1.51e-01 | 4.48e-02 | NA |
| 2. P | Q2HJ90 | Leucine-rich repeat-containing protein 42 | 1.71e-02 | 1.80e-02 | NA |
| 2. P | Q8IY45 | Protein AMN1 homolog | 1.82e-05 | 1.24e-03 | NA |
| 2. P | P0C895 | LRR repeats and ubiquitin-like domain-containing protein At2g30105 | 7.77e-04 | 2.40e-02 | NA |
| 2. P | C1FYU3 | Nucleolar protein 9 | 3.20e-02 | 1.64e-03 | NA |
| 2. P | P35859 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.23e-06 | 1.10e-06 | NA |
| 2. P | Q4I1B1 | Vacuolar protein 8 | 1.18e-02 | 7.47e-04 | NA |
| 2. P | Q8BMC4 | Nucleolar protein 9 | 3.82e-02 | 2.38e-02 | NA |
| 2. P | Q29393 | Decorin | 3.26e-05 | 8.89e-05 | NA |
| 2. P | Q8LB33 | F-box protein At3g58530 | 2.01e-08 | 1.96e-06 | NA |
| 2. P | Q7TPD7 | Leucine-rich repeat-containing protein 75B | 3.73e-03 | 3.45e-02 | NA |
| 2. P | P50609 | Fibromodulin | 7.23e-05 | 1.97e-03 | NA |
| 2. P | P50608 | Fibromodulin | 6.04e-05 | 2.07e-02 | NA |
| 2. P | Q6INV3 | Leucine-rich repeat-containing protein 57 | 5.29e-06 | 4.62e-02 | NA |
| 2. P | Q8GZ63 | Pentatricopeptide repeat-containing protein At5g25630 | 1.86e-02 | 7.83e-05 | NA |
| 2. P | Q9SKK0 | EIN3-binding F-box protein 1 | 4.50e-07 | 2.06e-04 | NA |
| 2. P | Q5RD03 | Armadillo repeat-containing protein 6 | 6.88e-02 | 8.28e-03 | NA |
| 2. P | P0C9T2 | Protein MGF 505-4R | NA | 1.80e-02 | NA |
| 2. P | A0A0G2JMD5 | PRAME family member 33 | 5.54e-05 | 1.40e-02 | NA |
| 2. P | Q54Q39 | Protein phosphatase 1 regulatory subunit pprA | 5.83e-12 | 4.18e-08 | NA |
| 2. P | P20640 | Ankyrin repeat protein M1 | NA | 1.18e-02 | NA |
| 2. P | E9Q5G7 | Oogenesin-1 | 2.70e-05 | 1.64e-03 | NA |
| 2. P | O01322 | Pumilio domain-containing protein 6 | 9.23e-02 | 1.24e-02 | NA |
| 2. P | C0STK7 | Phospholipase A2 inhibitor beta | NA | 1.10e-02 | NA |
| 2. P | Q3UWY1 | Oogenesin-3 | 1.52e-05 | 1.75e-03 | NA |
| 2. P | Q5B3J5 | Nucleolar protein 9 | 1.17e-01 | 1.15e-02 | NA |
| 2. P | A6H6A4 | Leucine-rich repeat and IQ domain-containing protein 4 | 1.70e-06 | 6.03e-03 | NA |
| 2. P | Q8R2U7 | Leucine-rich repeat-containing protein 42 | 3.09e-02 | 8.11e-03 | NA |
| 2. P | Q9ZU29 | Pentatricopeptide repeat-containing protein At2g01390 | 4.34e-03 | 3.28e-02 | NA |
| 2. P | Q75A58 | Antagonist of mitotic exit network protein 1 | 1.06e-05 | 1.32e-02 | NA |
| 2. P | Q32PL1 | Protein phosphatase 1 regulatory subunit 7 | 2.20e-07 | 4.23e-05 | NA |
| 2. P | P21809 | Biglycan | 3.24e-05 | 1.38e-06 | NA |
| 2. P | Q6NXE6 | Armadillo repeat-containing protein 6 | 7.43e-02 | 4.53e-02 | NA |
| 2. P | O54910 | NF-kappa-B inhibitor epsilon | 3.53e-01 | 2.24e-02 | NA |
| 2. P | Q99MQ4 | Asporin | 4.60e-06 | 1.13e-02 | NA |
| 2. P | Q65Z91 | Tsukushi | 1.64e-05 | 1.25e-02 | NA |
| 2. P | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 1.19e-04 | 5.32e-04 | NA |
| 2. P | Q8VYG9 | Plant intracellular Ras-group-related LRR protein 9 | 2.96e-04 | 9.30e-05 | NA |
| 2. P | Q5VWM4 | PRAME family member 8 | 9.87e-07 | 4.65e-03 | NA |
| 2. P | Q5RI43 | Keratocan | 1.70e-05 | 4.37e-03 | NA |
| 2. P | B4LXW1 | Leucine-rich repeat protein soc-2 homolog | 6.16e-06 | 2.43e-09 | NA |
| 2. P | Q9C5D2 | F-box/LRR-repeat protein 4 | 1.12e-10 | 4.76e-04 | NA |
| 2. P | A8HMZ4 | Dynein regulatory complex subunit 5 | 5.13e-08 | 1.16e-05 | NA |
| 2. P | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 1.82e-04 | 9.57e-07 | NA |
| 2. P | Q9FGN3 | F-box protein At5g51380 | 7.62e-05 | 9.20e-05 | NA |
| 2. P | Q54HL8 | FNIP repeat-containing protein DDB_G0289381 | 8.31e-03 | 2.67e-03 | NA |
| 2. P | Q84QA7 | Coronatine-insensitive protein homolog 2 | 2.71e-07 | 2.31e-03 | NA |
| 2. P | P0DUQ1 | PRAME family member 15 | NA | 1.50e-02 | NA |
| 2. P | P45969 | Protein phosphatase 1 regulatory subunit SDS22 homolog | 2.12e-06 | 3.69e-06 | NA |
| 2. P | Q15048 | Leucine-rich repeat-containing protein 14 | 5.24e-06 | 1.71e-03 | NA |
| 2. P | Q8N4P6 | Leucine-rich repeat-containing protein 71 | 1.42e-02 | 2.28e-03 | NA |
| 2. P | Q3T0W4 | Protein phosphatase 1 regulatory subunit 7 | 1.60e-08 | 3.09e-09 | NA |
| 2. P | Q9VEK6 | Leucine-rich repeat protein soc-2 homolog | 7.82e-06 | 2.92e-02 | NA |
| 2. P | A7SFP1 | Leucine-rich repeat protein soc-2 homolog | 1.15e-05 | 1.37e-15 | NA |
| 2. P | P35858 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.63e-06 | 2.55e-06 | NA |
| 2. P | D4D9R6 | Nucleolar protein 9 | 6.14e-02 | 7.48e-03 | NA |
| 2. P | Q96IG2 | F-box/LRR-repeat protein 20 | 2.12e-08 | 1.83e-05 | NA |
| 2. P | Q63691 | Monocyte differentiation antigen CD14 | 1.63e-04 | 1.02e-03 | NA |
| 2. P | Q05443 | Lumican | 4.53e-06 | 2.52e-05 | NA |
| 2. P | Q5VXH5 | PRAME family member 7 | 2.12e-05 | 1.17e-02 | NA |
| 2. P | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 1.06e-08 | 1.31e-10 | NA |
| 2. P | O35125 | Leucine-rich repeat-containing protein 23 | 1.05e-03 | 2.09e-02 | NA |
| 2. P | Q38950 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform | 8.62e-03 | 5.06e-03 | NA |
| 2. P | Q9QXW0 | F-box/LRR-repeat protein 6 | 6.04e-06 | 1.70e-04 | NA |
| 2. P | Q28888 | Decorin | 8.17e-06 | 4.33e-03 | NA |
| 2. P | O60810 | PRAME family member 4 | 1.27e-05 | 1.66e-02 | NA |
| 2. P | Q65YW8 | Tsukushi-A | 3.09e-04 | 4.76e-04 | NA |
| 2. P | Q9M651 | RAN GTPase-activating protein 2 | 5.55e-09 | 6.71e-07 | NA |
| 2. P | P28653 | Biglycan | 1.06e-05 | 5.60e-05 | NA |
| 2. P | Q8RWU5 | F-box/LRR-repeat protein 3 | 1.05e-12 | 5.40e-11 | NA |
| 2. P | B2W8X8 | Nucleolar protein 9 | 5.27e-02 | 5.78e-03 | NA |
| 2. P | O46542 | Decorin | 1.69e-05 | 1.47e-02 | NA |
| 2. P | Q9LTX2 | Transport inhibitor response 1-like protein | 4.83e-07 | 4.28e-06 | NA |
| 2. P | Q66H10 | F-box only protein 39 | 7.97e-05 | 4.75e-02 | NA |
| 2. P | Q4WVW4 | Vacuolar protein 8 | 1.67e-02 | 5.16e-03 | NA |
| 2. P | Q9D1G5 | Leucine-rich repeat-containing protein 57 | 3.58e-06 | 1.27e-02 | NA |
| 2. P | Q5RAV5 | Leucine-rich repeat protein SHOC-2 | 1.70e-06 | 2.39e-13 | NA |
| 2. P | Q0WNP3 | Pentatricopeptide repeat-containing protein At4g18520, chloroplastic | 5.26e-03 | 4.95e-03 | NA |
| 2. P | Q5HZV9 | Protein phosphatase 1 regulatory subunit 7 | 1.76e-08 | 1.94e-08 | NA |
| 2. P | P02750 | Leucine-rich alpha-2-glycoprotein | 1.71e-06 | 1.91e-03 | NA |
| 2. P | Q9CQ76 | Nephrocan | 2.10e-08 | 1.53e-02 | NA |
| 2. P | Q570C0 | Protein TRANSPORT INHIBITOR RESPONSE 1 | 3.13e-07 | 4.53e-02 | NA |
| 2. P | P78395 | Melanoma antigen preferentially expressed in tumors | 1.99e-05 | 3.88e-02 | NA |
| 2. P | Q9UQ13 | Leucine-rich repeat protein SHOC-2 | 2.86e-06 | 2.39e-13 | NA |
| 2. P | P51884 | Lumican | 2.09e-05 | 2.46e-03 | NA |
| 2. P | Q9LE82 | RAN GTPase-activating protein 1 | 5.89e-10 | 7.42e-09 | NA |
| 2. P | Q6AYI5 | Leucine-rich repeat protein SHOC-2 | 2.78e-07 | 8.39e-14 | NA |
| 2. P | Q9CZV8 | F-box/LRR-repeat protein 20 | 2.02e-09 | 6.81e-06 | NA |
| 2. P | Q5UPH0 | Putative ankyrin repeat protein L100 | NA | 2.01e-02 | NA |
| 2. P | B8JKV0 | Protein AMN1 homolog | 8.53e-05 | 2.86e-04 | NA |
| 2. P | A2WX30 | Coronatine-insensitive protein homolog 1a | 2.54e-07 | 7.48e-03 | NA |
| 2. P | Q32LM4 | F-box only protein 39 | 9.22e-05 | 1.25e-02 | NA |
| 2. P | Q5RFS7 | Protein phosphatase 1 regulatory subunit 7 | 1.15e-06 | 8.88e-09 | NA |
| 2. P | Q3UM45 | Protein phosphatase 1 regulatory subunit 7 | 1.90e-07 | 4.51e-07 | NA |
| 2. P | P51887 | Fibromodulin | 8.38e-05 | 5.87e-04 | NA |
| 2. P | F1R6I3 | Leucine-rich repeat-containing protein 39 | 3.52e-05 | 1.69e-06 | NA |
| 2. P | Q9FJV1 | F-box/FBD/LRR-repeat protein At5g56570 | 1.49e-03 | 4.23e-02 | NA |
| 2. P | O04197 | Coronatine-insensitive protein 1 | 2.23e-07 | 4.94e-02 | NA |
| 2. P | P70389 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.94e-06 | 2.10e-08 | NA |
| 2. P | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 4.70e-04 | 8.54e-03 | NA |
| 2. P | Q7K486 | Armadillo repeat-containing protein 6 homolog | 5.63e-02 | 4.84e-02 | NA |
| 2. P | C5DCN9 | ATPase expression protein 1, mitochondrial | 1.72e-02 | 2.12e-03 | NA |
| 2. P | O35344 | Importin subunit alpha-4 | 1.01e-01 | 2.75e-02 | NA |
| 2. P | Q9UKC9 | F-box/LRR-repeat protein 2 | 6.31e-10 | 1.76e-04 | NA |
| 2. P | Q13309 | S-phase kinase-associated protein 2 | 1.37e-05 | 1.82e-04 | NA |
| 2. P | C0S4C4 | Nucleolar protein 9 | 3.22e-02 | 3.19e-04 | NA |
| 2. P | Q7TPX8 | Oogenesin-2 | 2.15e-05 | 1.64e-02 | NA |
| 2. P | Q38845 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform | 9.16e-03 | 1.51e-03 | NA |
| 2. P | C1H8W8 | Nucleolar protein 9 | 3.50e-02 | 5.55e-03 | NA |
| 2. P | Q95122 | Monocyte differentiation antigen CD14 | 2.12e-04 | 1.57e-05 | NA |
| 2. P | O42235 | Keratocan | 2.58e-06 | 1.20e-02 | NA |
| 2. P | Q9IB75 | Biglycan | 3.87e-05 | 4.18e-05 | NA |
| 2. P | E3RP32 | Nucleolar protein 9 | 5.07e-02 | 3.42e-02 | NA |
| 2. P | P36047 | Protein phosphatase 1 regulatory subunit SDS22 | 5.85e-08 | 3.66e-08 | NA |
| 2. P | B4JTV9 | Leucine-rich repeat protein soc-2 homolog | 5.50e-06 | 1.22e-04 | NA |
| 2. P | Q58DG6 | F-box/LRR-repeat protein 20 | 3.07e-08 | 1.83e-05 | NA |
| 2. P | H0Y7S4 | Putative PRAME family member 26 | 2.60e-07 | 3.35e-05 | NA |
| 2. P | Q8BID8 | F-box/LRR-repeat protein 14 | 5.72e-10 | 6.54e-03 | NA |
| 2. P | Q02821 | Importin subunit alpha | 6.48e-02 | 6.96e-03 | NA |
| 2. P | P08571 | Monocyte differentiation antigen CD14 | 2.94e-04 | 4.87e-05 | NA |
| 2. P | Q8W104 | F-box/LRR-repeat protein 17 | 4.26e-05 | 2.46e-03 | NA |
| 2. P | O49286 | F-box protein SKP2B | 4.83e-06 | 3.70e-03 | NA |
| 2. P | Q569B5 | Leucine-rich repeat-containing protein 14 | 6.22e-06 | 1.01e-03 | NA |
| 2. P | B0W6M9 | Leucine-rich repeat protein soc-2 homolog | 3.22e-06 | 6.37e-07 | NA |
| 2. P | Q9Z0Z3 | S-phase kinase-associated protein 2 | 3.37e-05 | 4.03e-04 | NA |
| 2. P | O46403 | Biglycan | 1.47e-04 | 8.69e-06 | NA |
| 2. P | O02833 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.69e-07 | 2.17e-06 | NA |
| 2. P | Q8C4V4 | F-box/LRR-repeat protein 3 | 6.37e-05 | 6.89e-03 | NA |
| 2. P | A0JPI9 | Leucine-rich repeat-containing protein 74A | 1.47e-08 | 4.81e-05 | NA |
| 2. P | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 2.06e-04 | 1.97e-07 | NA |
| 2. P | Q9Z1S7 | Osteomodulin | 5.26e-06 | 6.03e-03 | NA |
| 2. P | Q9CRC8 | Leucine-rich repeat-containing protein 40 | 6.09e-06 | 6.82e-03 | NA |
| 2. P | Q53EV4 | Leucine-rich repeat-containing protein 23 | 7.49e-04 | 2.11e-02 | NA |
| 2. P | Q5QNV8 | Protein HEATR9 | 1.10e-01 | 1.37e-03 | NA |
| 2. P | Q9TTE2 | Decorin | 4.74e-06 | 5.14e-04 | NA |
| 2. P | Q17R01 | F-box/LRR-repeat protein 14 | 7.83e-10 | 6.54e-03 | NA |
| 2. P | Q54AX5 | Leucine-rich repeat protein lrrA | 9.38e-12 | 9.15e-10 | NA |
| 2. P | A1D6V7 | Nucleolar protein 9 | 8.72e-02 | 3.59e-02 | NA |
| 2. P | C5P9D1 | Nucleolar protein 9 | 7.73e-02 | 3.01e-02 | NA |
| 2. P | B3LWU3 | Leucine-rich repeat protein soc-2 homolog | 1.36e-05 | 5.22e-05 | NA |
| 2. P | Q6Y9P5 | Coronatine-insensitive protein homolog 1a | 3.94e-08 | 7.48e-03 | NA |
| 2. P | Q58A48 | Tsukushi | 4.00e-05 | 4.48e-02 | NA |
| 2. P | Q1L8Y7 | Leucine-rich repeat protein SHOC-2 | 3.24e-07 | 1.00e-13 | NA |
| 2. P | B4QVR7 | Leucine-rich repeat protein soc-2 homolog | 1.05e-05 | 1.33e-04 | NA |
| 2. P | Q8NEE6 | Dynein regulatory complex subunit 6 | 1.82e-06 | 7.71e-04 | NA |
| 2. P | Q8IZ02 | Leucine-rich repeat-containing protein 34 | 1.14e-07 | 1.43e-13 | NA |
| 2. P | A2R3A7 | Nucleolar protein 9 | 9.44e-02 | 1.06e-02 | NA |
| 2. P | Q5FVI3 | Leucine-rich repeat-containing protein 57 | 5.47e-06 | 1.43e-02 | NA |
| 2. P | P10810 | Monocyte differentiation antigen CD14 | 1.13e-05 | 4.23e-05 | NA |
| 2. P | Q4R3P6 | Leucine-rich repeat-containing protein 40 | 3.80e-05 | 2.07e-02 | NA |
| 2. P | Q9SII7 | Pentatricopeptide repeat-containing protein At2g17210 | 1.97e-02 | 7.87e-03 | NA |
| 2. P | Q99983 | Osteomodulin | 8.73e-06 | 1.30e-03 | NA |
| 2. P | Q6BTZ4 | Vacuolar protein 8 | 2.47e-02 | 8.28e-03 | NA |
| 2. P | Q9D3W5 | Leucine-rich repeat-containing protein 71 | 4.47e-03 | 2.89e-02 | NA |
| 2. P | A2XEV1 | Coronatine-insensitive protein homolog 2 | 2.11e-07 | 2.31e-03 | NA |
| 2. P | Q96DD0 | Leucine-rich repeat-containing protein 39 | 2.54e-04 | 1.19e-06 | NA |
| 2. P | Q5U201 | Protein AMN1 homolog | 1.51e-04 | 1.15e-05 | NA |
| 2. P | Q60EH4 | Coronatine-insensitive protein homolog 1b | 3.38e-07 | 1.42e-02 | NA |
| 2. P | O77742 | Osteomodulin | 1.68e-05 | 2.51e-03 | NA |
| 2. P | Q9LPL4 | F-box protein SKP2A | 1.64e-06 | 1.31e-02 | NA |
| 2. P | Q4KM95 | Leucine-rich repeat-containing protein 42 | 1.69e-02 | 3.55e-02 | NA |
| 2. P | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 5.09e-05 | 1.80e-06 | NA |
| 2. P | Q7XDQ7 | Plant intracellular Ras-group-related LRR protein 8 | 9.10e-05 | 1.89e-02 | NA |
| 2. P | P51886 | Lumican | 5.02e-06 | 4.56e-03 | NA |
| 2. P | Q06828 | Fibromodulin | 4.47e-05 | 2.82e-03 | NA |
| 2. P | Q84WJ9 | Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog | 1.78e-12 | 3.90e-05 | NA |
| 2. P | Q6C5Y8 | Vacuolar protein 8 | 1.14e-02 | 6.15e-03 | NA |
| 2. P | P52170 | Importin subunit alpha-5 | 6.05e-02 | 2.05e-02 | NA |
| 2. P | Q8BH16 | F-box/LRR-repeat protein 2 | 1.74e-09 | 2.94e-05 | NA |
| 2. P | Q55CN0 | Tubulin-specific chaperone E | 2.01e-03 | 1.78e-04 | NA |
| 2. P | Q8RWQ8 | F-box protein FBX14 | 6.04e-07 | 8.32e-04 | NA |
| 2. P | Q2UKV0 | Nucleolar protein 9 | 1.38e-01 | 1.15e-02 | NA |
| 2. P | A6QLV3 | Leucine-rich repeat protein SHOC-2 | 7.54e-06 | 5.29e-13 | NA |
| 2. P | O35103 | Osteomodulin | 1.42e-06 | 3.07e-03 | NA |
| 2. P | A1CKL4 | Nucleolar protein 9 | 7.37e-02 | 4.07e-02 | NA |
| 2. P | Q01129 | Decorin | 1.17e-05 | 6.28e-03 | NA |
| 2. P | P28675 | Decorin | 3.80e-06 | 1.55e-06 | NA |
| 2. P | Q38951 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform | 1.88e-02 | 4.33e-03 | NA |
| 2. P | Q54JC0 | Calmodulin-binding protein CmbB | 2.85e-04 | 2.68e-06 | NA |
| 2. P | Q6P3Y9 | Podocan-like protein 1 | 6.00e-08 | 2.45e-06 | NA |
| 2. P | Q14BP6 | Leucine-rich repeat-containing protein 74B | 3.41e-09 | 6.47e-16 | NA |
| 2. P | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 2.20e-05 | 6.75e-11 | NA |
| 2. P | O46390 | Biglycan | 2.69e-05 | 1.65e-06 | NA |
| 2. P | Q9DE66 | Keratocan | 2.84e-06 | 1.02e-02 | NA |
| 2. P | C8V4D4 | SCF E3 ubiquitin ligase complex F-box protein grrA | 2.04e-08 | 1.23e-06 | NA |
| 2. P | Q8RWS8 | Pentatricopeptide repeat-containing protein At2g41720 | 4.86e-02 | 2.28e-03 | NA |
| 2. P | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 1.05e-06 | 1.38e-08 | NA |
| 2. P | A6H779 | F-box/LRR-repeat protein 2 | 9.12e-09 | 2.26e-04 | NA |
| 2. P | O60809 | PRAME family member 10 | 1.02e-04 | 3.94e-03 | NA |
| 2. P | Q5EFZ4 | Vacuolar protein 8 | 2.54e-02 | 1.13e-03 | NA |
| 2. P | Q8BNU0 | Armadillo repeat-containing protein 6 | 5.69e-02 | 6.75e-03 | NA |
| 2. P | Q8L6Y3 | Pentatricopeptide repeat-containing protein At5g24830 | 4.89e-02 | 8.45e-03 | NA |
| 2. P | A5PJJ5 | Leucine-rich repeat-containing protein 14 | 4.80e-06 | 5.62e-04 | NA |
| 2. P | Q9S9X4 | Putative F-box/LRR-repeat protein 8 | 5.23e-08 | 2.36e-04 | NA |
| 2. P | P21793 | Decorin | 4.33e-06 | 3.47e-05 | NA |
| 2. P | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 1.80e-04 | 1.20e-08 | NA |
| 3. B | C6FG12 | Protein NLRC5 | 1.73e-05 | NA | 1.19e-07 |
| 3. B | Q9FZ59 | Leucine-rich repeat receptor-like protein kinase PEPR2 | 5.45e-05 | NA | 0.004 |
| 3. B | F6R2G2 | NLR family CARD domain-containing protein 4 | 1.01e-07 | NA | 2.51e-09 |
| 3. B | Q8S7M7 | Plant intracellular Ras-group-related LRR protein 5 | 1.22e-04 | NA | 0.022 |
| 3. B | Q9R016 | Baculoviral IAP repeat-containing protein 1e | 1.19e-05 | NA | 0.046 |
| 3. B | Q66X19 | NACHT, LRR and PYD domains-containing protein 4E | 4.26e-07 | NA | 0.005 |
| 3. B | O48849 | Receptor like protein 23 | 1.71e-05 | NA | 0.003 |
| 3. B | D9I2G3 | NACHT, LRR and PYD domains-containing protein 1 allele 2 | 5.34e-02 | NA | 0.003 |
| 3. B | A6H639 | Dynein regulatory complex subunit 5 | 1.59e-06 | NA | 0.003 |
| 3. B | Q86WI3 | Protein NLRC5 | 4.05e-06 | NA | 2.98e-06 |
| 3. B | Q9QWK5 | Baculoviral IAP repeat-containing protein 1a | 1.52e-05 | NA | 0.003 |
| 3. B | Q93YT3 | Receptor-like protein 50 | 4.33e-06 | NA | 2.54e-05 |
| 3. B | C0LGQ9 | LRR receptor-like serine/threonine-protein kinase GHR1 | 2.38e-04 | NA | 0.035 |
| 3. B | Q9C000 | NACHT, LRR and PYD domains-containing protein 1 | 5.72e-03 | NA | 3.28e-05 |
| 3. B | D9I2H0 | NACHT, LRR and PYD domains-containing protein 1a allele 3 | 7.66e-02 | NA | 0.003 |
| 3. B | Q9SRL2 | Receptor-like protein 34 | 3.38e-06 | NA | 0.018 |
| 3. B | Q5JU00 | Dynein regulatory complex subunit 5 | 5.08e-06 | NA | 0.039 |
| 3. B | A7Z026 | Protein phosphatase 1 regulatory subunit 37 | 2.42e-07 | NA | 0.020 |
| 3. B | P82963 | Chaoptin (Fragment) | 2.49e-05 | NA | 5.93e-04 |
| 3. B | C3VPR6 | Protein NLRC5 | 6.48e-05 | NA | 2.05e-08 |
| 3. B | Q6B966 | NACHT, LRR and PYD domains-containing protein 14 | 9.60e-09 | NA | 0.014 |
| 3. B | P59045 | NACHT, LRR and PYD domains-containing protein 11 | 2.14e-06 | NA | 0.048 |
| 3. B | Q9R1M5 | NACHT, LRR and PYD domains-containing protein 5 | 1.92e-07 | NA | 2.61e-04 |
| 3. B | D9I2G1 | NACHT, LRR and PYD domains-containing protein 1a allele 4 | 6.25e-02 | NA | 0.003 |
| 3. B | Q7FZR1 | Receptor-like protein 52 | 5.52e-05 | NA | 0.001 |
| 3. B | B2RYF1 | Protein phosphatase 1 regulatory subunit 37 | 1.07e-08 | NA | 0.005 |
| 3. B | Q69JN6 | Brassinosteroid LRR receptor kinase BRL1 | 4.26e-05 | NA | 1.04e-04 |
| 3. B | P59047 | NACHT, LRR and PYD domains-containing protein 5 | 2.62e-08 | NA | 0.003 |
| 3. B | Q86W25 | NACHT, LRR and PYD domains-containing protein 13 | 3.67e-06 | NA | 1.09e-04 |
| 3. B | Q13045 | Protein flightless-1 homolog | 4.42e-06 | NA | 0.002 |
| 3. B | Q9M2Y3 | Receptor-like protein 44 | 1.75e-02 | NA | 0.035 |
| 3. B | P08678 | Adenylate cyclase | 6.12e-02 | NA | 0.008 |
| 3. B | Q96MN2 | NACHT, LRR and PYD domains-containing protein 4 | 4.16e-07 | NA | 5.74e-05 |
| 3. B | Q9SRL7 | Receptor-like protein 35 | 2.22e-05 | NA | 0.009 |
| 3. B | Q54M77 | Probable serine/threonine-protein kinase roco8 | 6.27e-02 | NA | 0.010 |
| 3. B | D9I2F9 | NACHT, LRR and PYD domains-containing protein 1a allele 1 | 2.09e-02 | NA | 0.003 |
| 3. B | P34342 | Ran GTPase-activating protein 2 | 1.45e-09 | NA | 0.004 |
| 3. B | Q9C7S5 | Tyrosine-sulfated glycopeptide receptor 1 | 6.57e-05 | NA | 0.023 |
| 3. B | Q9NPP4 | NLR family CARD domain-containing protein 4 | 1.83e-06 | NA | 0.003 |
| 3. B | Q9JIB3 | Baculoviral IAP repeat-containing protein 1g | 3.20e-06 | NA | 0.002 |
| 3. B | Q7KRY7 | Protein lap4 | 4.69e-04 | NA | 0.008 |
| 3. B | P46060 | Ran GTPase-activating protein 1 | 2.34e-08 | NA | 1.85e-05 |
| 3. B | Q9FIZ3 | LRR receptor-like serine/threonine-protein kinase GSO2 | 1.07e-04 | NA | 0.012 |
| 3. B | D9I2G4 | NACHT, LRR and PYD domains-containing protein 1a allele 5 | 5.12e-02 | NA | 0.003 |
| 3. B | Q9SSD1 | Protein TOO MANY MOUTHS | 4.54e-05 | NA | 0.004 |
| 3. B | O13066 | Ran GTPase-activating protein 1 | 2.86e-09 | NA | 7.03e-07 |
| 3. B | Q9SYQ8 | Receptor protein kinase CLAVATA1 | 4.41e-05 | NA | 0.002 |
| 3. B | A0A1P8ATR9 | Receptor-like protein 9b | 6.32e-08 | NA | 0.012 |
| 3. B | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 5.36e-07 | NA | 0.011 |
| 3. B | D4A615 | Tonsoku-like protein | 4.05e-04 | NA | 0.006 |
| 3. B | P46061 | Ran GTPase-activating protein 1 | 8.38e-08 | NA | 9.95e-06 |
| 3. B | Q9FXF2 | Probable LRR receptor-like serine/threonine-protein kinase RFK1 | 5.88e-03 | NA | 0.004 |
| 3. B | Q5JTW2 | Centrosomal protein of 78 kDa | 6.24e-04 | NA | 0.017 |
| 3. B | E9Q5R7 | NACHT, LRR and PYD domains-containing protein 12 | 6.61e-08 | NA | 2.06e-09 |
| 3. B | P59046 | NACHT, LRR and PYD domains-containing protein 12 | 7.49e-07 | NA | 6.55e-10 |
| 3. B | Q9LY03 | Probable LRR receptor-like serine/threonine-protein kinase IRK | 2.65e-05 | NA | 3.56e-05 |
| 3. B | Q9NR96 | Toll-like receptor 9 | 3.82e-05 | NA | 0.017 |
| 3. B | F1MHT9 | NLR family CARD domain-containing protein 4 | 1.74e-06 | NA | 3.60e-05 |
| 3. B | Q647I9 | NACHT, LRR and PYD domains-containing protein 5 | 5.35e-09 | NA | 1.69e-05 |
| 3. B | F1M649 | NLR family CARD domain-containing protein 4 | 1.67e-06 | NA | 1.86e-05 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 1.38e-03 | NA | 5.79e-04 |
| 3. B | Q9LVN2 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 | 3.22e-04 | NA | 0.003 |
| 3. B | Q96HA7 | Tonsoku-like protein | 6.67e-04 | NA | 0.010 |
| 3. B | Q95VZ3 | Protein CARMIL | 1.90e-09 | NA | 0.002 |
| 3. B | Q9JJ28 | Protein flightless-1 homolog | 4.37e-05 | NA | 8.41e-04 |
| 3. B | Q3UP24 | NLR family CARD domain-containing protein 4 | 1.04e-06 | NA | 2.61e-07 |
| 3. B | Q9QUK4 | Baculoviral IAP repeat-containing protein 1b | 2.22e-05 | NA | 0.003 |
| 3. B | Q9FN37 | Phytosulfokine receptor 2 | 6.67e-05 | NA | 0.040 |
| 3. B | G9LZD7 | Probable inactive leucine-rich repeat receptor kinase XIAO | 8.44e-06 | NA | 2.52e-05 |
| 3. B | Q13075 | Baculoviral IAP repeat-containing protein 1 | 2.83e-04 | NA | 0.005 |
| 3. B | Q9JIB6 | Baculoviral IAP repeat-containing protein 1f | 2.04e-06 | NA | 0.001 |
| 3. B | Q9NX02 | NACHT, LRR and PYD domains-containing protein 2 | 3.98e-06 | NA | 0.018 |
| 3. B | Q86W24 | NACHT, LRR and PYD domains-containing protein 14 | 5.99e-09 | NA | 8.05e-05 |
| 3. B | F4K4T3 | Receptor-like protein 56 | 1.34e-05 | NA | 0.040 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 1.17e-03 | NA | 7.93e-04 |
| 3. B | D4A523 | NACHT, LRR and PYD domains-containing protein 3 | 2.99e-06 | NA | 8.40e-04 |
| 3. B | O49328 | Receptor like protein 26 | 3.61e-06 | NA | 0.010 |
| 3. B | Q8R4B8 | NACHT, LRR and PYD domains-containing protein 3 | 5.04e-06 | NA | 0.004 |