Results | PROST

Summary

Q6UY01

Homolog: P10775.
Function: Ribonuclease inhibitor.

Statistics

Total GO Annotation: 410
Unique PROST Go: 209
Unique BLAST Go: 188

Total Homologs: 379
Unique PROST Homologs: 293
Unique BLAST Homologs: 78

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P10775 (Ribonuclease inhibitor) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.96 angstrom. The sequence alignment identity is 25.0%.
Structural alignment shown in left. Query protein Q6UY01 colored as red in alignment, homolog P10775 colored as blue. Query protein Q6UY01 is also shown in right top, homolog P10775 showed in right bottom. They are colored based on secondary structures.

  Q6UY01 MSQTRKKTSSEGETKPQTSTVNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAKPLSSEMEWRSSMEKNEHFLQKLGKKAVNKCLDLNNCGLTT 100
  P10775 --------------------------------------------------------------------------------------MN--LDI-HC---- 7

  Q6UY01 ADMKEMVALLPFLPDLEEL-DISWNGFVGGT-LLSITQQMHLVSKLKILRLGSCRLTTDDVQALGEAFEMIPELEELNLSWNSKVG--GNLPLILQKFQK 196
  P10775 ----------------EQLSDARW------TELLPLLQQYEVV------RLDDCGLTEEHCKDIGSALRANPSLTELCLRTN-ELGDAG-VHLVLQGLQS 77

  Q6UY01 GS-KIQMIELVDCSLTSEDGTFLGQLLP-MLQSLEVL-DLSINRDIVGS--LNSIAQGLKSTS-NLKVLKLHSCGLSQKSVKILDAAFRYLGELRKLDLS 290
  P10775 PTCKIQKLSLQNCSLT-EAG--CG-VLPSTLRSLPTLRELHLSDNPLGDAGLRLLCEGLLDPQCHLEKLQLEYCRLTAASCEPLASVLRATRALKELTVS 173

  Q6UY01 CNKDLG--G------GFEDSPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKKMGSS--SE---NLLSRLRFLPA--LKSLVINN 375
  P10775 -NNDIGEAGARVLGQGLADSACQ------LETLRLENCGLTPANCKDLCGIVASQASLRELDLGSN-GLGDAGIAELCPGLLS-----PASRLKTLWLWE 260

  Q6UY01 CALESETFTALAE-ASVHLSA---LEVFNLSWNKCVG--GNLKLLLETLKL--SMSLQVLRLSSCSLVT----EDVALLASVIQTGHLAKLQKLDLSYN- 462
  P10775 CDI---TASGCRDLCRV-LQAKETLKELSLAGNK-LGDEG-ARLLCESL-LQPGCQLESLWVKSCSL-TAACCQHVSLM--LTQNKHL--LE-LQLSSNK 347

  Q6UY01 --DS----ICDA----GWTMF-------------CQNVRFL----KELIELDISLRPSNFRDC-GQWFRHLLYAVTKLPQITEIG--MKRWILPASQE-E 531
  P10775 LGDSGIQELCQALSQPGTTLRVLCLGDCEVTNSGCSSLASLLLANRSLRELDL----SN--NCVGD--PGVLQLLGSLEQ---PGCALEQLVLYDTYWTE 436

  Q6UY01 ELECFDQDKKRSIHFDHG---GFQ--- 552
  P10775 EVE----DRLQAL---EGSKPGLRVIS 456

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0006954	inflammatory response
1. PB	GO:2000321	positive regulation of T-helper 17 cell differentiation
1. PB	GO:0002237	response to molecule of bacterial origin
1. PB	GO:0005829	cytosol
1. PB	GO:0008428	ribonuclease inhibitor activity
1. PB	GO:0032311	angiogenin-PRI complex
1. PB	GO:0032088	negative regulation of NF-kappaB transcription factor activity
1. PB	GO:0014070	response to organic cyclic compound
1. PB	GO:0045087	innate immune response
1. PB	GO:0007165	signal transduction
1. PB	GO:0005654	nucleoplasm
1. PB	GO:1901224	positive regulation of NIK/NF-kappaB signaling
1. PB	GO:0045765	regulation of angiogenesis
2. P	GO:0021540	corpus callosum morphogenesis
2. P	GO:0010011	auxin binding
2. P	GO:0010508	positive regulation of autophagy
2. P	GO:0090141	positive regulation of mitochondrial fission
2. P	GO:1901970	positive regulation of mitotic sister chromatid separation
2. P	GO:0070848	response to growth factor
2. P	GO:0000425	pexophagy
2. P	GO:0005589	collagen type VI trimer
2. P	GO:0055046	microgametogenesis
2. P	GO:0032496	response to lipopolysaccharide
2. P	GO:0043202	lysosomal lumen
2. P	GO:0036312	phosphatidylinositol 3-kinase regulatory subunit binding
2. P	GO:0051216	cartilage development
2. P	GO:0006404	RNA import into nucleus
2. P	GO:0034612	response to tumor necrosis factor
2. P	GO:0035882	defecation rhythm
2. P	GO:0006511	ubiquitin-dependent protein catabolic process
2. P	GO:0032914	positive regulation of transforming growth factor beta1 production
2. P	GO:0005796	Golgi lumen
2. P	GO:0001847	opsonin receptor activity
2. P	GO:0009524	phragmoplast
2. P	GO:0000056	ribosomal small subunit export from nucleus
2. P	GO:0045121	membrane raft
2. P	GO:0070171	negative regulation of tooth mineralization
2. P	GO:0002718	regulation of cytokine production involved in immune response
2. P	GO:0009873	ethylene-activated signaling pathway
2. P	GO:0030688	preribosome, small subunit precursor
2. P	GO:0061608	nuclear import signal receptor activity
2. P	GO:0000159	protein phosphatase type 2A complex
2. P	GO:0035307	positive regulation of protein dephosphorylation
2. P	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
2. P	GO:2000746	regulation of defecation rhythm
2. P	GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0016567	protein ubiquitination
2. P	GO:0106167	extracellular ATP signaling
2. P	GO:0031578	mitotic spindle orientation checkpoint signaling
2. P	GO:1903044	protein localization to membrane raft
2. P	GO:0030021	extracellular matrix structural constituent conferring compression resistance
2. P	GO:0042567	insulin-like growth factor ternary complex
2. P	GO:0031430	M band
2. P	GO:0071562	nucleus-vacuole junction assembly
2. P	GO:0032026	response to magnesium ion
2. P	GO:0032729	positive regulation of interferon-gamma production
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0000329	fungal-type vacuole membrane
2. P	GO:0042942	D-serine transport
2. P	GO:0072542	protein phosphatase activator activity
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0034517	ribophagy
2. P	GO:0008543	fibroblast growth factor receptor signaling pathway
2. P	GO:1905393	plant organ formation
2. P	GO:0004842	ubiquitin-protein transferase activity
2. P	GO:0070891	lipoteichoic acid binding
2. P	GO:2001042	negative regulation of septum digestion after cytokinesis
2. P	GO:0005615	extracellular space
2. P	GO:0050840	extracellular matrix binding
2. P	GO:0010105	negative regulation of ethylene-activated signaling pathway
2. P	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0043066	negative regulation of apoptotic process
2. P	GO:0009897	external side of plasma membrane
2. P	GO:0009612	response to mechanical stimulus
2. P	GO:0004722	protein serine/threonine phosphatase activity
2. P	GO:0006513	protein monoubiquitination
2. P	GO:0002244	hematopoietic progenitor cell differentiation
2. P	GO:0071378	cellular response to growth hormone stimulus
2. P	GO:0016239	positive regulation of macroautophagy
2. P	GO:1905909	regulation of dauer entry
2. P	GO:1904027	negative regulation of collagen fibril organization
2. P	GO:0070062	extracellular exosome
2. P	GO:0035304	regulation of protein dephosphorylation
2. P	GO:0000822	inositol hexakisphosphate binding
2. P	GO:0099575	regulation of protein catabolic process at presynapse, modulating synaptic transmission
2. P	GO:0001822	kidney development
2. P	GO:0019005	SCF ubiquitin ligase complex
2. P	GO:0003735	structural constituent of ribosome
2. P	GO:0005520	insulin-like growth factor binding
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0042635	positive regulation of hair cycle
2. P	GO:0042144	vacuole fusion, non-autophagic
2. P	GO:0061975	articular cartilage development
2. P	GO:0044830	modulation by host of viral RNA genome replication
2. P	GO:0000109	nucleotide-excision repair complex
2. P	GO:0071727	cellular response to triacyl bacterial lipopeptide
2. P	GO:0042383	sarcolemma
2. P	GO:0071365	cellular response to auxin stimulus
2. P	GO:0005886	plasma membrane
2. P	GO:0048443	stamen development
2. P	GO:0061303	cornea development in camera-type eye
2. P	GO:0071219	cellular response to molecule of bacterial origin
2. P	GO:0060348	bone development
2. P	GO:0042325	regulation of phosphorylation
2. P	GO:0010506	regulation of autophagy
2. P	GO:0009861	jasmonic acid and ethylene-dependent systemic resistance
2. P	GO:0061073	ciliary body morphogenesis
2. P	GO:0033085	negative regulation of T cell differentiation in thymus
2. P	GO:0009451	RNA modification
2. P	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
2. P	GO:0009555	pollen development
2. P	GO:2000022	regulation of jasmonic acid mediated signaling pathway
2. P	GO:0043624
2. P	GO:0070245	positive regulation of thymocyte apoptotic process
2. P	GO:0042564	NLS-dependent protein nuclear import complex
2. P	GO:0032911	negative regulation of transforming growth factor beta1 production
2. P	GO:0043495	protein-membrane adaptor activity
2. P	GO:0010596	negative regulation of endothelial cell migration
2. P	GO:0071726	cellular response to diacyl bacterial lipopeptide
2. P	GO:0045596	negative regulation of cell differentiation
2. P	GO:0071222	cellular response to lipopolysaccharide
2. P	GO:0007568	aging
2. P	GO:0046600	negative regulation of centriole replication
2. P	GO:0030282	bone mineralization
2. P	GO:0005730	nucleolus
2. P	GO:2000300	regulation of synaptic vesicle exocytosis
2. P	GO:0034142	toll-like receptor 4 signaling pathway
2. P	GO:0098633	collagen fibril binding
2. P	GO:0021960	anterior commissure morphogenesis
2. P	GO:0034122	negative regulation of toll-like receptor signaling pathway
2. P	GO:0071460	cellular response to cell-matrix adhesion
2. P	GO:0030500	regulation of bone mineralization
2. P	GO:0032760	positive regulation of tumor necrosis factor production
2. P	GO:0007601	visual perception
2. P	GO:0045182	translation regulator activity
2. P	GO:0051901	positive regulation of mitochondrial depolarization
2. P	GO:0043153	entrainment of circadian clock by photoperiod
2. P	GO:0045892	negative regulation of transcription, DNA-templated
2. P	GO:0048511	rhythmic process
2. P	GO:0043326	chemotaxis to folate
2. P	GO:1904761	negative regulation of myofibroblast differentiation
2. P	GO:0008139	nuclear localization sequence binding
2. P	GO:0006898	receptor-mediated endocytosis
2. P	GO:0000086	G2/M transition of mitotic cell cycle
2. P	GO:1901332	negative regulation of lateral root development
2. P	GO:0010311	lateral root formation
2. P	GO:0045471	response to ethanol
2. P	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0005634	nucleus
2. P	GO:0005518	collagen binding
2. P	GO:0031012	extracellular matrix
2. P	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
2. P	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
2. P	GO:0032481	positive regulation of type I interferon production
2. P	GO:0010239	chloroplast mRNA processing
2. P	GO:0043053	dauer entry
2. P	GO:0071255	Cvt vesicle assembly
2. P	GO:0071723	lipopeptide binding
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0030686	90S preribosome
2. P	GO:0032757	positive regulation of interleukin-8 production
2. P	GO:0001530	lipopolysaccharide binding
2. P	GO:0005539	glycosaminoglycan binding
2. P	GO:0001890	placenta development
2. P	GO:0048387	negative regulation of retinoic acid receptor signaling pathway
2. P	GO:0008157	protein phosphatase 1 binding
2. P	GO:0007155	cell adhesion
2. P	GO:0005516	calmodulin binding
2. P	GO:0071223	cellular response to lipoteichoic acid
2. P	GO:0006171	cAMP biosynthetic process
2. P	GO:0001974	blood vessel remodeling
2. P	GO:0031362	anchored component of external side of plasma membrane
2. P	GO:1902916	positive regulation of protein polyubiquitination
2. P	GO:0016019	peptidoglycan immune receptor activity
2. P	GO:0009617	response to bacterium
2. P	GO:0001662	behavioral fear response
2. P	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
2. P	GO:0097009	energy homeostasis
2. P	GO:0046696	lipopolysaccharide receptor complex
2. P	GO:0031344	regulation of cell projection organization
2. P	GO:0051602	response to electrical stimulus
2. P	GO:0009641	shade avoidance
2. P	GO:0031663	lipopolysaccharide-mediated signaling pathway
2. P	GO:0009723	response to ethylene
2. P	GO:0000011	vacuole inheritance
2. P	GO:0070936	protein K48-linked ubiquitination
2. P	GO:0005583	fibrillar collagen trimer
2. P	GO:0016021	integral component of membrane
2. P	GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway
2. P	GO:0046579	positive regulation of Ras protein signal transduction
2. P	GO:0008284	positive regulation of cell population proliferation
2. P	GO:0071561	nucleus-vacuole junction
2. P	GO:0031514	motile cilium
2. P	GO:0019900	kinase binding
2. P	GO:0098868	bone growth
2. P	GO:0030199	collagen fibril organization
2. P	GO:0038198	auxin receptor activity
2. P	GO:0016525	negative regulation of angiogenesis
2. P	GO:0047485	protein N-terminus binding
2. P	GO:0046872	metal ion binding
2. P	GO:0006606	protein import into nucleus
2. P	GO:0002213	defense response to insect
2. P	GO:0006364	rRNA processing
2. P	GO:0007519	skeletal muscle tissue development
2. P	GO:0030133	transport vesicle
2. P	GO:0062023	collagen-containing extracellular matrix
2. P	GO:0051726	regulation of cell cycle
2. P	GO:1900865	chloroplast RNA modification
2. P	GO:0042060	wound healing
2. P	GO:0007181	transforming growth factor beta receptor complex assembly
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0006607	NLS-bearing protein import into nucleus
2. P	GO:0009901	anther dehiscence
2. P	GO:0045944	positive regulation of transcription by RNA polymerase II
2. P	GO:0000164	protein phosphatase type 1 complex
2. P	GO:0055047	generative cell mitosis
2. P	GO:0045807	positive regulation of endocytosis
2. P	GO:0071563	Myo2p-Vac17p-Vac8p transport complex
2. P	GO:0031648	protein destabilization
2. P	GO:0010152	pollen maturation
2. P	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
2. P	GO:0009734	auxin-activated signaling pathway
3. B	GO:0010555	response to mannitol
3. B	GO:0036336	dendritic cell migration
3. B	GO:0051402	neuron apoptotic process
3. B	GO:0051656	establishment of organelle localization
3. B	GO:0002526	acute inflammatory response
3. B	GO:0051260	protein homooligomerization
3. B	GO:0045630	positive regulation of T-helper 2 cell differentiation
3. B	GO:0045571	negative regulation of imaginal disc growth
3. B	GO:0032717	negative regulation of interleukin-8 production
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0072559	NLRP3 inflammasome complex
3. B	GO:0032491	detection of molecule of fungal origin
3. B	GO:0010375	stomatal complex patterning
3. B	GO:0090333	regulation of stomatal closure
3. B	GO:0001738	morphogenesis of a polarized epithelium
3. B	GO:0031953	negative regulation of protein autophosphorylation
3. B	GO:0072558	NLRP1 inflammasome complex
3. B	GO:0045186	zonula adherens assembly
3. B	GO:0043549	regulation of kinase activity
3. B	GO:2000553	positive regulation of T-helper 2 cell cytokine production
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0016333	morphogenesis of follicular epithelium
3. B	GO:0071345	cellular response to cytokine stimulus
3. B	GO:0045851	pH reduction
3. B	GO:0034451	centriolar satellite
3. B	GO:0031297	replication fork processing
3. B	GO:0034123	positive regulation of toll-like receptor signaling pathway
3. B	GO:0060471	cortical granule exocytosis
3. B	GO:0061133	endopeptidase activator activity
3. B	GO:0060340	positive regulation of type I interferon-mediated signaling pathway
3. B	GO:0140426	PAMP-triggered immunity signalling pathway
3. B	GO:0032879	regulation of localization
3. B	GO:0071224	cellular response to peptidoglycan
3. B	GO:0001737	establishment of imaginal disc-derived wing hair orientation
3. B	GO:0010376	stomatal complex formation
3. B	GO:0045751	negative regulation of Toll signaling pathway
3. B	GO:0032754	positive regulation of interleukin-5 production
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0004864	protein phosphatase inhibitor activity
3. B	GO:0010954	positive regulation of protein processing
3. B	GO:0002830	positive regulation of type 2 immune response
3. B	GO:0061851	leading edge of lamellipodium
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0140608	cysteine-type endopeptidase activator activity
3. B	GO:0072002	Malpighian tubule development
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0007318	pole plasm protein localization
3. B	GO:0051293	establishment of spindle localization
3. B	GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity
3. B	GO:0090630	activation of GTPase activity
3. B	GO:0048226	Casparian strip
3. B	GO:0072089	stem cell proliferation
3. B	GO:0019991	septate junction assembly
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0032753	positive regulation of interleukin-4 production
3. B	GO:1990723	cytoplasmic periphery of the nuclear pore complex
3. B	GO:0010090	trichome morphogenesis
3. B	GO:0007464	R3/R4 cell fate commitment
3. B	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
3. B	GO:0060339	negative regulation of type I interferon-mediated signaling pathway
3. B	GO:0016235	aggresome
3. B	GO:0045345	positive regulation of MHC class I biosynthetic process
3. B	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production
3. B	GO:0005903	brush border
3. B	GO:1905034	regulation of antifungal innate immune response
3. B	GO:0051092	positive regulation of NF-kappaB transcription factor activity
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0034162	toll-like receptor 9 signaling pathway
3. B	GO:0016334	establishment or maintenance of polarity of follicular epithelium
3. B	GO:0089720	caspase binding
3. B	GO:0071485	cellular response to absence of light
3. B	GO:0045169	fusome
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0009934	regulation of meristem structural organization
3. B	GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0016332	establishment or maintenance of polarity of embryonic epithelium
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0009416	response to light stimulus
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0061702	inflammasome complex
3. B	GO:0036126	sperm flagellum
3. B	GO:0071391	cellular response to estrogen stimulus
3. B	GO:0140374	antiviral innate immune response
3. B	GO:0007015	actin filament organization
3. B	GO:0060473	cortical granule
3. B	GO:0005096	GTPase activator activity
3. B	GO:0032661	regulation of interleukin-18 production
3. B	GO:0048678	response to axon injury
3. B	GO:0002674	negative regulation of acute inflammatory response
3. B	GO:0030239	myofibril assembly
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:1990794	basolateral part of cell
3. B	GO:0044546	NLRP3 inflammasome complex assembly
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0036289	peptidyl-serine autophosphorylation
3. B	GO:0016715	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
3. B	GO:0002720	positive regulation of cytokine production involved in immune response
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0016335	morphogenesis of larval imaginal disc epithelium
3. B	GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:1904784	NLRP1 inflammasome complex assembly
3. B	GO:0045175	basal protein localization
3. B	GO:0012501	programmed cell death
3. B	GO:0034163	regulation of toll-like receptor 9 signaling pathway
3. B	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
3. B	GO:0097264	self proteolysis
3. B	GO:0044614	nuclear pore cytoplasmic filaments
3. B	GO:0043621	protein self-association
3. B	GO:0036019	endolysosome
3. B	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0097202	activation of cysteine-type endopeptidase activity
3. B	GO:0032715	negative regulation of interleukin-6 production
3. B	GO:0032692	negative regulation of interleukin-1 production
3. B	GO:2000067	regulation of root morphogenesis
3. B	GO:0051014	actin filament severing
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:0002218	activation of innate immune response
3. B	GO:0043596	nuclear replication fork
3. B	GO:0006887	exocytosis
3. B	GO:0045322	unmethylated CpG binding
3. B	GO:0016604	nuclear body
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0035635	entry of bacterium into host cell
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:0043204	perikaryon
3. B	GO:0060335	positive regulation of interferon-gamma-mediated signaling pathway
3. B	GO:0036020	endolysosome membrane
3. B	GO:0002758	innate immune response-activating signal transduction
3. B	GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
3. B	GO:0002523	leukocyte migration involved in inflammatory response
3. B	GO:0051607	defense response to virus
3. B	GO:0042393	histone binding
3. B	GO:0035088	establishment or maintenance of apical/basal cell polarity
3. B	GO:0032731	positive regulation of interleukin-1 beta production
3. B	GO:0032741	positive regulation of interleukin-18 production
3. B	GO:0070373	negative regulation of ERK1 and ERK2 cascade
3. B	GO:0004672	protein kinase activity
3. B	GO:0017024	myosin I binding
3. B	GO:0090708	specification of plant organ axis polarity
3. B	GO:0000724	double-strand break repair via homologous recombination
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0032736	positive regulation of interleukin-13 production
3. B	GO:0042585	germinal vesicle
3. B	GO:0043487	regulation of RNA stability
3. B	GO:0106333	subcortical maternal complex
3. B	GO:0042981	regulation of apoptotic process
3. B	GO:0042067	establishment of ommatidial planar polarity
3. B	GO:1904115	axon cytoplasm
3. B	GO:0007252	I-kappaB phosphorylation
3. B	GO:0030317	flagellated sperm motility
3. B	GO:0001653	peptide receptor activity
3. B	GO:1901528	hydrogen peroxide mediated signaling pathway involved in stomatal movement
3. B	GO:0051302	regulation of cell division
3. B	GO:0008233	peptidase activity
3. B	GO:0006915	apoptotic process
3. B	GO:0070685	macropinocytic cup
3. B	GO:0097300	programmed necrotic cell death
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0071244	cellular response to carbon dioxide
3. B	GO:0106311
3. B	GO:0032691	negative regulation of interleukin-1 beta production
3. B	GO:0002240	response to molecule of oomycetes origin
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0032090	Pyrin domain binding
3. B	GO:0033612	receptor serine/threonine kinase binding
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0042555	MCM complex
3. B	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
3. B	GO:0015631	tubulin binding
3. B	GO:0050727	regulation of inflammatory response
3. B	GO:0072557	IPAF inflammasome complex
3. B	GO:0016045	detection of bacterium
3. B	GO:0042742	defense response to bacterium
3. B	GO:0005918	septate junction
3. B	GO:0007472	wing disc morphogenesis
3. B	GO:0000776	kinetochore
3. B	GO:0045577	regulation of B cell differentiation
3. B	GO:1904117	cellular response to vasopressin
3. B	GO:0005938	cell cortex
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0035101	FACT complex
3. B	GO:0070269	pyroptosis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q6UY01	Leucine-rich repeat-containing protein 31	0	8.22e-149	0.0
1. PB	Q8HZP9	Ribonuclease inhibitor	7.77e-16	1.78e-12	1.53e-16
1. PB	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	4.08e-05	1.60e-11	0.001
1. PB	P13489	Ribonuclease inhibitor	5.55e-16	2.14e-12	2.03e-17
1. PB	P10775	Ribonuclease inhibitor	1.11e-16	2.68e-09	9.88e-17
1. PB	P29315	Ribonuclease inhibitor	7.77e-16	6.83e-09	2.87e-16
1. PB	Q4V8D9	Leucine-rich repeat-containing protein 34	8.39e-09	4.94e-12	0.008
1. PB	Q91VI7	Ribonuclease inhibitor	6.66e-16	8.88e-09	2.55e-18
2. P	Q94819	Telomerase component p95	7.13e-05	3.12e-05	NA
2. P	Q6PEZ8	Podocan-like protein 1	1.85e-08	4.04e-05	NA
2. P	Q6ZQY2	Leucine-rich repeat-containing protein 74B	1.29e-09	9.00e-15	NA
2. P	Q66GN3	Protein NPGR2	4.37e-02	1.97e-02	NA
2. P	P22194	Protein phosphatase 1 regulatory subunit SDS22	1.65e-08	1.57e-06	NA
2. P	Q7XVM8	Transport inhibitor response 1-like protein Os04g0395600	2.64e-07	2.22e-02	NA
2. P	Q9BYS8	Leucine-rich repeat-containing protein 2	1.35e-04	9.01e-06	NA
2. P	Q5UQA7	Putative F-box/LRR-repeat protein R542	NA	1.22e-02	NA
2. P	Q8AVI4	Leucine-rich repeat protein SHOC-2	6.09e-06	9.11e-16	NA
2. P	O35343	Importin subunit alpha-3	1.34e-01	4.35e-02	NA
2. P	B4IBI9	Leucine-rich repeat protein soc-2 homolog	1.04e-05	3.86e-04	NA
2. P	Q32L08	Protein AMN1 homolog	4.31e-04	7.07e-06	NA
2. P	A2RTY3	Protein HEATR9	4.46e-02	3.90e-04	NA
2. P	Q5RFE9	Leucine-rich repeat-containing protein 40	1.83e-05	2.81e-02	NA
2. P	Q9M8W9	Pentatricopeptide repeat-containing protein At3g04130, mitochondrial	1.71e-02	3.04e-02	NA
2. P	Q9LSK8	Pentatricopeptide repeat-containing protein At3g18020	2.03e-02	4.99e-02	NA
2. P	A6NHZ5	Leucine-rich repeat-containing protein 14B	3.06e-05	2.33e-02	NA
2. P	Q2U5T5	Vacuolar protein 8	1.36e-02	6.99e-04	NA
2. P	Q9DE68	Decorin	1.12e-05	4.50e-06	NA
2. P	C5JK19	Nucleolar protein 9	6.60e-02	6.90e-05	NA
2. P	Q8N4B4	F-box only protein 39	8.87e-05	8.89e-03	NA
2. P	P0C8Q3	Pentatricopeptide repeat-containing protein At4g19890	1.96e-02	4.80e-02	NA
2. P	Q5UPG7	Putative ankyrin repeat protein L91	NA	3.48e-03	NA
2. P	P51885	Lumican	1.07e-07	2.16e-03	NA
2. P	Q7SXW3	Leucine-rich repeat-containing protein 40	1.16e-05	3.28e-02	NA
2. P	Q8N1E6	F-box/LRR-repeat protein 14	2.77e-08	2.87e-05	NA
2. P	O88520	Leucine-rich repeat protein SHOC-2	2.82e-06	1.95e-12	NA
2. P	A6NM36	Leucine-rich repeat-containing protein 30	4.99e-06	1.80e-07	NA
2. P	Q09299	Putative RNA-binding protein EEED8.10	1.70e-05	1.16e-02	NA
2. P	Q5UPQ4	Putative ankyrin repeat protein L764	NA	5.06e-03	NA
2. P	Q9XSD9	Decorin	6.37e-06	1.26e-03	NA
2. P	B3FL73	F-box/LRR-repeat protein 21	2.81e-04	1.16e-02	NA
2. P	Q810Y8	Preferentially expressed antigen in melanoma-like protein 7	4.55e-06	1.06e-03	NA
2. P	O95522	PRAME family member 12	1.40e-05	1.68e-02	NA
2. P	Q5UPU9	Putative ankyrin repeat protein L273	NA	1.75e-02	NA
2. P	Q759Y1	ATPase expression protein 1, mitochondrial	9.50e-02	6.41e-03	NA
2. P	P07585	Decorin	1.18e-05	1.44e-03	NA
2. P	Q7RXW1	Vacuolar protein 8	2.04e-02	3.16e-02	NA
2. P	Q28680	Monocyte differentiation antigen CD14	2.76e-04	6.62e-04	NA
2. P	Q6GPJ5	Leucine-rich repeat-containing protein 40	1.66e-05	3.16e-03	NA
2. P	P13605	Fibromodulin	1.01e-04	3.94e-03	NA
2. P	Q8VC16	Leucine-rich repeat-containing protein 14	6.57e-06	2.01e-02	NA
2. P	B5DX45	Leucine-rich repeat protein soc-2 homolog	1.68e-06	1.30e-04	NA
2. P	B8N3R8	Nucleolar protein 9	9.19e-02	1.27e-02	NA
2. P	B4N9T4	Leucine-rich repeat protein soc-2 homolog	3.85e-06	2.88e-03	NA
2. P	Q4R642	Dynein regulatory complex subunit 5	2.70e-06	1.43e-03	NA
2. P	P14356	Ankyrin repeat protein M1	NA	1.06e-02	NA
2. P	Q3UV48	Leucine-rich repeat-containing protein 30	1.12e-05	4.23e-06	NA
2. P	Q7Z5L7	Podocan	2.87e-06	2.84e-09	NA
2. P	O74999	DNA repair protein rhp7	3.05e-05	2.31e-02	NA
2. P	Q5R3Z8	F-box/LRR-repeat protein 2	8.55e-10	7.83e-05	NA
2. P	P34284	F-box/LRR-repeat protein fbxl-1	2.14e-07	1.11e-07	NA
2. P	B3P3E8	Leucine-rich repeat protein soc-2 homolog	4.03e-06	4.59e-05	NA
2. P	Q7TQ62	Podocan	8.35e-06	2.13e-08	NA
2. P	Q3URY6	Armadillo repeat-containing protein 2	1.04e-01	3.55e-02	NA
2. P	P21810	Biglycan	5.02e-08	5.16e-05	NA
2. P	O43028	Vacuolar protein 8	1.65e-02	4.02e-03	NA
2. P	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	1.26e-05	4.50e-12	NA
2. P	O00505	Importin subunit alpha-4	7.70e-02	2.28e-02	NA
2. P	Q5R8X9	Protein AMN1 homolog	1.79e-05	1.31e-03	NA
2. P	Q6CTF5	Meiotic sister-chromatid recombination protein 6, mitochondrial	1.29e-02	3.09e-04	NA
2. P	P0DUQ2	PRAME family member 9	NA	1.50e-02	NA
2. P	Q6DIQ3	Protein phosphatase 1 regulatory subunit 7	1.32e-07	1.94e-07	NA
2. P	Q708Y0	EIN3-binding F-box protein 2	2.42e-07	1.07e-02	NA
2. P	Q8VYT5	F-box protein At5g07670	9.59e-05	7.56e-05	NA
2. P	Q0P4D1	Protein AMN1 homolog	2.45e-05	4.13e-08	NA
2. P	Q9UKT7	F-box/LRR-repeat protein 3	5.86e-05	2.86e-02	NA
2. P	Q5UQC5	Uncharacterized protein L228	NA	1.75e-03	NA
2. P	C5DQD7	Nucleolar protein 9	5.78e-02	3.10e-02	NA
2. P	C5G8V2	Nucleolar protein 9	5.35e-02	3.85e-05	NA
2. P	Q5M8G4	Leucine-rich repeat-containing protein 40	1.25e-05	5.90e-03	NA
2. P	A6NGN4	PRAME family member 25	3.19e-06	1.61e-02	NA
2. P	O02678	Biglycan	5.20e-05	2.96e-06	NA
2. P	A8XWW4	Leucine-rich repeat protein soc-2	3.81e-07	4.03e-14	NA
2. P	Q9BXN1	Asporin	2.85e-05	1.46e-02	NA
2. P	Q99MW3	Preferentially expressed antigen in melanoma-like protein 1	1.90e-05	2.14e-03	NA
2. P	Q9SMY8	F-box/LRR-repeat protein 15	1.24e-04	5.78e-03	NA
2. P	P11745	Ran GTPase-activating protein 1	1.51e-07	1.03e-03	NA
2. P	P47853	Biglycan	6.04e-05	3.72e-05	NA
2. P	Q4R744	Protein HEATR9	7.85e-02	2.57e-02	NA
2. P	Q3UJB3	Leucine-rich repeat-containing protein 14B	3.83e-05	1.34e-04	NA
2. P	P26337	Putative adenylate cyclase regulatory protein	6.84e-07	1.03e-06	NA
2. P	Q0VAA2	Leucine-rich repeat-containing protein 74A	1.78e-07	1.42e-08	NA
2. P	Q8N531	F-box/LRR-repeat protein 6	4.05e-07	4.40e-02	NA
2. P	Q5R1V9	Decorin	2.86e-05	1.44e-03	NA
2. P	Q28CU0	Leucine-rich repeat-containing protein 23	7.72e-05	6.62e-04	NA
2. P	P28654	Decorin	6.20e-06	8.98e-03	NA
2. P	Q22875	Leucine-rich repeat protein soc-2	1.40e-06	3.84e-15	NA
2. P	Q640Z9	Leucine-rich repeat-containing protein 14	1.16e-05	3.16e-03	NA
2. P	B4PU77	Leucine-rich repeat protein soc-2 homolog	6.88e-06	4.71e-02	NA
2. P	P23799	Putative adenylate cyclase regulatory protein	9.36e-06	4.12e-06	NA
2. P	Q8N9N7	Leucine-rich repeat-containing protein 57	4.90e-06	3.91e-02	NA
2. P	Q15435	Protein phosphatase 1 regulatory subunit 7	2.06e-06	7.63e-08	NA
2. P	O74783	SCF E3 ubiquitin ligase complex F-box protein pof2	3.65e-08	3.26e-06	NA
2. P	Q5UPH1	Putative ankyrin repeat protein L99	NA	9.55e-03	NA
2. P	Q5NBU5	F-box only protein 39	6.99e-05	4.62e-02	NA
2. P	Q9FGN4	F-box protein At5g51370	3.01e-05	4.98e-04	NA
2. P	Q2TB02	NF-kappa-B inhibitor delta	1.51e-01	4.48e-02	NA
2. P	Q2HJ90	Leucine-rich repeat-containing protein 42	1.71e-02	1.80e-02	NA
2. P	Q8IY45	Protein AMN1 homolog	1.82e-05	1.24e-03	NA
2. P	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	7.77e-04	2.40e-02	NA
2. P	C1FYU3	Nucleolar protein 9	3.20e-02	1.64e-03	NA
2. P	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	1.23e-06	1.10e-06	NA
2. P	Q4I1B1	Vacuolar protein 8	1.18e-02	7.47e-04	NA
2. P	Q8BMC4	Nucleolar protein 9	3.82e-02	2.38e-02	NA
2. P	Q29393	Decorin	3.26e-05	8.89e-05	NA
2. P	Q8LB33	F-box protein At3g58530	2.01e-08	1.96e-06	NA
2. P	Q7TPD7	Leucine-rich repeat-containing protein 75B	3.73e-03	3.45e-02	NA
2. P	P50609	Fibromodulin	7.23e-05	1.97e-03	NA
2. P	P50608	Fibromodulin	6.04e-05	2.07e-02	NA
2. P	Q6INV3	Leucine-rich repeat-containing protein 57	5.29e-06	4.62e-02	NA
2. P	Q8GZ63	Pentatricopeptide repeat-containing protein At5g25630	1.86e-02	7.83e-05	NA
2. P	Q9SKK0	EIN3-binding F-box protein 1	4.50e-07	2.06e-04	NA
2. P	Q5RD03	Armadillo repeat-containing protein 6	6.88e-02	8.28e-03	NA
2. P	P0C9T2	Protein MGF 505-4R	NA	1.80e-02	NA
2. P	A0A0G2JMD5	PRAME family member 33	5.54e-05	1.40e-02	NA
2. P	Q54Q39	Protein phosphatase 1 regulatory subunit pprA	5.83e-12	4.18e-08	NA
2. P	P20640	Ankyrin repeat protein M1	NA	1.18e-02	NA
2. P	E9Q5G7	Oogenesin-1	2.70e-05	1.64e-03	NA
2. P	O01322	Pumilio domain-containing protein 6	9.23e-02	1.24e-02	NA
2. P	C0STK7	Phospholipase A2 inhibitor beta	NA	1.10e-02	NA
2. P	Q3UWY1	Oogenesin-3	1.52e-05	1.75e-03	NA
2. P	Q5B3J5	Nucleolar protein 9	1.17e-01	1.15e-02	NA
2. P	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	1.70e-06	6.03e-03	NA
2. P	Q8R2U7	Leucine-rich repeat-containing protein 42	3.09e-02	8.11e-03	NA
2. P	Q9ZU29	Pentatricopeptide repeat-containing protein At2g01390	4.34e-03	3.28e-02	NA
2. P	Q75A58	Antagonist of mitotic exit network protein 1	1.06e-05	1.32e-02	NA
2. P	Q32PL1	Protein phosphatase 1 regulatory subunit 7	2.20e-07	4.23e-05	NA
2. P	P21809	Biglycan	3.24e-05	1.38e-06	NA
2. P	Q6NXE6	Armadillo repeat-containing protein 6	7.43e-02	4.53e-02	NA
2. P	O54910	NF-kappa-B inhibitor epsilon	3.53e-01	2.24e-02	NA
2. P	Q99MQ4	Asporin	4.60e-06	1.13e-02	NA
2. P	Q65Z91	Tsukushi	1.64e-05	1.25e-02	NA
2. P	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	1.19e-04	5.32e-04	NA
2. P	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	2.96e-04	9.30e-05	NA
2. P	Q5VWM4	PRAME family member 8	9.87e-07	4.65e-03	NA
2. P	Q5RI43	Keratocan	1.70e-05	4.37e-03	NA
2. P	B4LXW1	Leucine-rich repeat protein soc-2 homolog	6.16e-06	2.43e-09	NA
2. P	Q9C5D2	F-box/LRR-repeat protein 4	1.12e-10	4.76e-04	NA
2. P	A8HMZ4	Dynein regulatory complex subunit 5	5.13e-08	1.16e-05	NA
2. P	Q3ZC49	Leucine-rich repeat-containing protein 39	1.82e-04	9.57e-07	NA
2. P	Q9FGN3	F-box protein At5g51380	7.62e-05	9.20e-05	NA
2. P	Q54HL8	FNIP repeat-containing protein DDB_G0289381	8.31e-03	2.67e-03	NA
2. P	Q84QA7	Coronatine-insensitive protein homolog 2	2.71e-07	2.31e-03	NA
2. P	P0DUQ1	PRAME family member 15	NA	1.50e-02	NA
2. P	P45969	Protein phosphatase 1 regulatory subunit SDS22 homolog	2.12e-06	3.69e-06	NA
2. P	Q15048	Leucine-rich repeat-containing protein 14	5.24e-06	1.71e-03	NA
2. P	Q8N4P6	Leucine-rich repeat-containing protein 71	1.42e-02	2.28e-03	NA
2. P	Q3T0W4	Protein phosphatase 1 regulatory subunit 7	1.60e-08	3.09e-09	NA
2. P	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	7.82e-06	2.92e-02	NA
2. P	A7SFP1	Leucine-rich repeat protein soc-2 homolog	1.15e-05	1.37e-15	NA
2. P	P35858	Insulin-like growth factor-binding protein complex acid labile subunit	1.63e-06	2.55e-06	NA
2. P	D4D9R6	Nucleolar protein 9	6.14e-02	7.48e-03	NA
2. P	Q96IG2	F-box/LRR-repeat protein 20	2.12e-08	1.83e-05	NA
2. P	Q63691	Monocyte differentiation antigen CD14	1.63e-04	1.02e-03	NA
2. P	Q05443	Lumican	4.53e-06	2.52e-05	NA
2. P	Q5VXH5	PRAME family member 7	2.12e-05	1.17e-02	NA
2. P	Q9DAM1	Leucine-rich repeat-containing protein 34	1.06e-08	1.31e-10	NA
2. P	O35125	Leucine-rich repeat-containing protein 23	1.05e-03	2.09e-02	NA
2. P	Q38950	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform	8.62e-03	5.06e-03	NA
2. P	Q9QXW0	F-box/LRR-repeat protein 6	6.04e-06	1.70e-04	NA
2. P	Q28888	Decorin	8.17e-06	4.33e-03	NA
2. P	O60810	PRAME family member 4	1.27e-05	1.66e-02	NA
2. P	Q65YW8	Tsukushi-A	3.09e-04	4.76e-04	NA
2. P	Q9M651	RAN GTPase-activating protein 2	5.55e-09	6.71e-07	NA
2. P	P28653	Biglycan	1.06e-05	5.60e-05	NA
2. P	Q8RWU5	F-box/LRR-repeat protein 3	1.05e-12	5.40e-11	NA
2. P	B2W8X8	Nucleolar protein 9	5.27e-02	5.78e-03	NA
2. P	O46542	Decorin	1.69e-05	1.47e-02	NA
2. P	Q9LTX2	Transport inhibitor response 1-like protein	4.83e-07	4.28e-06	NA
2. P	Q66H10	F-box only protein 39	7.97e-05	4.75e-02	NA
2. P	Q4WVW4	Vacuolar protein 8	1.67e-02	5.16e-03	NA
2. P	Q9D1G5	Leucine-rich repeat-containing protein 57	3.58e-06	1.27e-02	NA
2. P	Q5RAV5	Leucine-rich repeat protein SHOC-2	1.70e-06	2.39e-13	NA
2. P	Q0WNP3	Pentatricopeptide repeat-containing protein At4g18520, chloroplastic	5.26e-03	4.95e-03	NA
2. P	Q5HZV9	Protein phosphatase 1 regulatory subunit 7	1.76e-08	1.94e-08	NA
2. P	P02750	Leucine-rich alpha-2-glycoprotein	1.71e-06	1.91e-03	NA
2. P	Q9CQ76	Nephrocan	2.10e-08	1.53e-02	NA
2. P	Q570C0	Protein TRANSPORT INHIBITOR RESPONSE 1	3.13e-07	4.53e-02	NA
2. P	P78395	Melanoma antigen preferentially expressed in tumors	1.99e-05	3.88e-02	NA
2. P	Q9UQ13	Leucine-rich repeat protein SHOC-2	2.86e-06	2.39e-13	NA
2. P	P51884	Lumican	2.09e-05	2.46e-03	NA
2. P	Q9LE82	RAN GTPase-activating protein 1	5.89e-10	7.42e-09	NA
2. P	Q6AYI5	Leucine-rich repeat protein SHOC-2	2.78e-07	8.39e-14	NA
2. P	Q9CZV8	F-box/LRR-repeat protein 20	2.02e-09	6.81e-06	NA
2. P	Q5UPH0	Putative ankyrin repeat protein L100	NA	2.01e-02	NA
2. P	B8JKV0	Protein AMN1 homolog	8.53e-05	2.86e-04	NA
2. P	A2WX30	Coronatine-insensitive protein homolog 1a	2.54e-07	7.48e-03	NA
2. P	Q32LM4	F-box only protein 39	9.22e-05	1.25e-02	NA
2. P	Q5RFS7	Protein phosphatase 1 regulatory subunit 7	1.15e-06	8.88e-09	NA
2. P	Q3UM45	Protein phosphatase 1 regulatory subunit 7	1.90e-07	4.51e-07	NA
2. P	P51887	Fibromodulin	8.38e-05	5.87e-04	NA
2. P	F1R6I3	Leucine-rich repeat-containing protein 39	3.52e-05	1.69e-06	NA
2. P	Q9FJV1	F-box/FBD/LRR-repeat protein At5g56570	1.49e-03	4.23e-02	NA
2. P	O04197	Coronatine-insensitive protein 1	2.23e-07	4.94e-02	NA
2. P	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	1.94e-06	2.10e-08	NA
2. P	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	4.70e-04	8.54e-03	NA
2. P	Q7K486	Armadillo repeat-containing protein 6 homolog	5.63e-02	4.84e-02	NA
2. P	C5DCN9	ATPase expression protein 1, mitochondrial	1.72e-02	2.12e-03	NA
2. P	O35344	Importin subunit alpha-4	1.01e-01	2.75e-02	NA
2. P	Q9UKC9	F-box/LRR-repeat protein 2	6.31e-10	1.76e-04	NA
2. P	Q13309	S-phase kinase-associated protein 2	1.37e-05	1.82e-04	NA
2. P	C0S4C4	Nucleolar protein 9	3.22e-02	3.19e-04	NA
2. P	Q7TPX8	Oogenesin-2	2.15e-05	1.64e-02	NA
2. P	Q38845	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform	9.16e-03	1.51e-03	NA
2. P	C1H8W8	Nucleolar protein 9	3.50e-02	5.55e-03	NA
2. P	Q95122	Monocyte differentiation antigen CD14	2.12e-04	1.57e-05	NA
2. P	O42235	Keratocan	2.58e-06	1.20e-02	NA
2. P	Q9IB75	Biglycan	3.87e-05	4.18e-05	NA
2. P	E3RP32	Nucleolar protein 9	5.07e-02	3.42e-02	NA
2. P	P36047	Protein phosphatase 1 regulatory subunit SDS22	5.85e-08	3.66e-08	NA
2. P	B4JTV9	Leucine-rich repeat protein soc-2 homolog	5.50e-06	1.22e-04	NA
2. P	Q58DG6	F-box/LRR-repeat protein 20	3.07e-08	1.83e-05	NA
2. P	H0Y7S4	Putative PRAME family member 26	2.60e-07	3.35e-05	NA
2. P	Q8BID8	F-box/LRR-repeat protein 14	5.72e-10	6.54e-03	NA
2. P	Q02821	Importin subunit alpha	6.48e-02	6.96e-03	NA
2. P	P08571	Monocyte differentiation antigen CD14	2.94e-04	4.87e-05	NA
2. P	Q8W104	F-box/LRR-repeat protein 17	4.26e-05	2.46e-03	NA
2. P	O49286	F-box protein SKP2B	4.83e-06	3.70e-03	NA
2. P	Q569B5	Leucine-rich repeat-containing protein 14	6.22e-06	1.01e-03	NA
2. P	B0W6M9	Leucine-rich repeat protein soc-2 homolog	3.22e-06	6.37e-07	NA
2. P	Q9Z0Z3	S-phase kinase-associated protein 2	3.37e-05	4.03e-04	NA
2. P	O46403	Biglycan	1.47e-04	8.69e-06	NA
2. P	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	1.69e-07	2.17e-06	NA
2. P	Q8C4V4	F-box/LRR-repeat protein 3	6.37e-05	6.89e-03	NA
2. P	A0JPI9	Leucine-rich repeat-containing protein 74A	1.47e-08	4.81e-05	NA
2. P	D3ZXS4	Leucine-rich repeat-containing protein 39	2.06e-04	1.97e-07	NA
2. P	Q9Z1S7	Osteomodulin	5.26e-06	6.03e-03	NA
2. P	Q9CRC8	Leucine-rich repeat-containing protein 40	6.09e-06	6.82e-03	NA
2. P	Q53EV4	Leucine-rich repeat-containing protein 23	7.49e-04	2.11e-02	NA
2. P	Q5QNV8	Protein HEATR9	1.10e-01	1.37e-03	NA
2. P	Q9TTE2	Decorin	4.74e-06	5.14e-04	NA
2. P	Q17R01	F-box/LRR-repeat protein 14	7.83e-10	6.54e-03	NA
2. P	Q54AX5	Leucine-rich repeat protein lrrA	9.38e-12	9.15e-10	NA
2. P	A1D6V7	Nucleolar protein 9	8.72e-02	3.59e-02	NA
2. P	C5P9D1	Nucleolar protein 9	7.73e-02	3.01e-02	NA
2. P	B3LWU3	Leucine-rich repeat protein soc-2 homolog	1.36e-05	5.22e-05	NA
2. P	Q6Y9P5	Coronatine-insensitive protein homolog 1a	3.94e-08	7.48e-03	NA
2. P	Q58A48	Tsukushi	4.00e-05	4.48e-02	NA
2. P	Q1L8Y7	Leucine-rich repeat protein SHOC-2	3.24e-07	1.00e-13	NA
2. P	B4QVR7	Leucine-rich repeat protein soc-2 homolog	1.05e-05	1.33e-04	NA
2. P	Q8NEE6	Dynein regulatory complex subunit 6	1.82e-06	7.71e-04	NA
2. P	Q8IZ02	Leucine-rich repeat-containing protein 34	1.14e-07	1.43e-13	NA
2. P	A2R3A7	Nucleolar protein 9	9.44e-02	1.06e-02	NA
2. P	Q5FVI3	Leucine-rich repeat-containing protein 57	5.47e-06	1.43e-02	NA
2. P	P10810	Monocyte differentiation antigen CD14	1.13e-05	4.23e-05	NA
2. P	Q4R3P6	Leucine-rich repeat-containing protein 40	3.80e-05	2.07e-02	NA
2. P	Q9SII7	Pentatricopeptide repeat-containing protein At2g17210	1.97e-02	7.87e-03	NA
2. P	Q99983	Osteomodulin	8.73e-06	1.30e-03	NA
2. P	Q6BTZ4	Vacuolar protein 8	2.47e-02	8.28e-03	NA
2. P	Q9D3W5	Leucine-rich repeat-containing protein 71	4.47e-03	2.89e-02	NA
2. P	A2XEV1	Coronatine-insensitive protein homolog 2	2.11e-07	2.31e-03	NA
2. P	Q96DD0	Leucine-rich repeat-containing protein 39	2.54e-04	1.19e-06	NA
2. P	Q5U201	Protein AMN1 homolog	1.51e-04	1.15e-05	NA
2. P	Q60EH4	Coronatine-insensitive protein homolog 1b	3.38e-07	1.42e-02	NA
2. P	O77742	Osteomodulin	1.68e-05	2.51e-03	NA
2. P	Q9LPL4	F-box protein SKP2A	1.64e-06	1.31e-02	NA
2. P	Q4KM95	Leucine-rich repeat-containing protein 42	1.69e-02	3.55e-02	NA
2. P	Q8BGI7	Leucine-rich repeat-containing protein 39	5.09e-05	1.80e-06	NA
2. P	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	9.10e-05	1.89e-02	NA
2. P	P51886	Lumican	5.02e-06	4.56e-03	NA
2. P	Q06828	Fibromodulin	4.47e-05	2.82e-03	NA
2. P	Q84WJ9	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	1.78e-12	3.90e-05	NA
2. P	Q6C5Y8	Vacuolar protein 8	1.14e-02	6.15e-03	NA
2. P	P52170	Importin subunit alpha-5	6.05e-02	2.05e-02	NA
2. P	Q8BH16	F-box/LRR-repeat protein 2	1.74e-09	2.94e-05	NA
2. P	Q55CN0	Tubulin-specific chaperone E	2.01e-03	1.78e-04	NA
2. P	Q8RWQ8	F-box protein FBX14	6.04e-07	8.32e-04	NA
2. P	Q2UKV0	Nucleolar protein 9	1.38e-01	1.15e-02	NA
2. P	A6QLV3	Leucine-rich repeat protein SHOC-2	7.54e-06	5.29e-13	NA
2. P	O35103	Osteomodulin	1.42e-06	3.07e-03	NA
2. P	A1CKL4	Nucleolar protein 9	7.37e-02	4.07e-02	NA
2. P	Q01129	Decorin	1.17e-05	6.28e-03	NA
2. P	P28675	Decorin	3.80e-06	1.55e-06	NA
2. P	Q38951	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform	1.88e-02	4.33e-03	NA
2. P	Q54JC0	Calmodulin-binding protein CmbB	2.85e-04	2.68e-06	NA
2. P	Q6P3Y9	Podocan-like protein 1	6.00e-08	2.45e-06	NA
2. P	Q14BP6	Leucine-rich repeat-containing protein 74B	3.41e-09	6.47e-16	NA
2. P	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	2.20e-05	6.75e-11	NA
2. P	O46390	Biglycan	2.69e-05	1.65e-06	NA
2. P	Q9DE66	Keratocan	2.84e-06	1.02e-02	NA
2. P	C8V4D4	SCF E3 ubiquitin ligase complex F-box protein grrA	2.04e-08	1.23e-06	NA
2. P	Q8RWS8	Pentatricopeptide repeat-containing protein At2g41720	4.86e-02	2.28e-03	NA
2. P	Q5F4C4	Leucine-rich repeat protein SHOC-2	1.05e-06	1.38e-08	NA
2. P	A6H779	F-box/LRR-repeat protein 2	9.12e-09	2.26e-04	NA
2. P	O60809	PRAME family member 10	1.02e-04	3.94e-03	NA
2. P	Q5EFZ4	Vacuolar protein 8	2.54e-02	1.13e-03	NA
2. P	Q8BNU0	Armadillo repeat-containing protein 6	5.69e-02	6.75e-03	NA
2. P	Q8L6Y3	Pentatricopeptide repeat-containing protein At5g24830	4.89e-02	8.45e-03	NA
2. P	A5PJJ5	Leucine-rich repeat-containing protein 14	4.80e-06	5.62e-04	NA
2. P	Q9S9X4	Putative F-box/LRR-repeat protein 8	5.23e-08	2.36e-04	NA
2. P	P21793	Decorin	4.33e-06	3.47e-05	NA
2. P	Q8VDB8	Leucine-rich repeat-containing protein 2	1.80e-04	1.20e-08	NA
3. B	C6FG12	Protein NLRC5	1.73e-05	NA	1.19e-07
3. B	Q9FZ59	Leucine-rich repeat receptor-like protein kinase PEPR2	5.45e-05	NA	0.004
3. B	F6R2G2	NLR family CARD domain-containing protein 4	1.01e-07	NA	2.51e-09
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	1.22e-04	NA	0.022
3. B	Q9R016	Baculoviral IAP repeat-containing protein 1e	1.19e-05	NA	0.046
3. B	Q66X19	NACHT, LRR and PYD domains-containing protein 4E	4.26e-07	NA	0.005
3. B	O48849	Receptor like protein 23	1.71e-05	NA	0.003
3. B	D9I2G3	NACHT, LRR and PYD domains-containing protein 1 allele 2	5.34e-02	NA	0.003
3. B	A6H639	Dynein regulatory complex subunit 5	1.59e-06	NA	0.003
3. B	Q86WI3	Protein NLRC5	4.05e-06	NA	2.98e-06
3. B	Q9QWK5	Baculoviral IAP repeat-containing protein 1a	1.52e-05	NA	0.003
3. B	Q93YT3	Receptor-like protein 50	4.33e-06	NA	2.54e-05
3. B	C0LGQ9	LRR receptor-like serine/threonine-protein kinase GHR1	2.38e-04	NA	0.035
3. B	Q9C000	NACHT, LRR and PYD domains-containing protein 1	5.72e-03	NA	3.28e-05
3. B	D9I2H0	NACHT, LRR and PYD domains-containing protein 1a allele 3	7.66e-02	NA	0.003
3. B	Q9SRL2	Receptor-like protein 34	3.38e-06	NA	0.018
3. B	Q5JU00	Dynein regulatory complex subunit 5	5.08e-06	NA	0.039
3. B	A7Z026	Protein phosphatase 1 regulatory subunit 37	2.42e-07	NA	0.020
3. B	P82963	Chaoptin (Fragment)	2.49e-05	NA	5.93e-04
3. B	C3VPR6	Protein NLRC5	6.48e-05	NA	2.05e-08
3. B	Q6B966	NACHT, LRR and PYD domains-containing protein 14	9.60e-09	NA	0.014
3. B	P59045	NACHT, LRR and PYD domains-containing protein 11	2.14e-06	NA	0.048
3. B	Q9R1M5	NACHT, LRR and PYD domains-containing protein 5	1.92e-07	NA	2.61e-04
3. B	D9I2G1	NACHT, LRR and PYD domains-containing protein 1a allele 4	6.25e-02	NA	0.003
3. B	Q7FZR1	Receptor-like protein 52	5.52e-05	NA	0.001
3. B	B2RYF1	Protein phosphatase 1 regulatory subunit 37	1.07e-08	NA	0.005
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	4.26e-05	NA	1.04e-04
3. B	P59047	NACHT, LRR and PYD domains-containing protein 5	2.62e-08	NA	0.003
3. B	Q86W25	NACHT, LRR and PYD domains-containing protein 13	3.67e-06	NA	1.09e-04
3. B	Q13045	Protein flightless-1 homolog	4.42e-06	NA	0.002
3. B	Q9M2Y3	Receptor-like protein 44	1.75e-02	NA	0.035
3. B	P08678	Adenylate cyclase	6.12e-02	NA	0.008
3. B	Q96MN2	NACHT, LRR and PYD domains-containing protein 4	4.16e-07	NA	5.74e-05
3. B	Q9SRL7	Receptor-like protein 35	2.22e-05	NA	0.009
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	6.27e-02	NA	0.010
3. B	D9I2F9	NACHT, LRR and PYD domains-containing protein 1a allele 1	2.09e-02	NA	0.003
3. B	P34342	Ran GTPase-activating protein 2	1.45e-09	NA	0.004
3. B	Q9C7S5	Tyrosine-sulfated glycopeptide receptor 1	6.57e-05	NA	0.023
3. B	Q9NPP4	NLR family CARD domain-containing protein 4	1.83e-06	NA	0.003
3. B	Q9JIB3	Baculoviral IAP repeat-containing protein 1g	3.20e-06	NA	0.002
3. B	Q7KRY7	Protein lap4	4.69e-04	NA	0.008
3. B	P46060	Ran GTPase-activating protein 1	2.34e-08	NA	1.85e-05
3. B	Q9FIZ3	LRR receptor-like serine/threonine-protein kinase GSO2	1.07e-04	NA	0.012
3. B	D9I2G4	NACHT, LRR and PYD domains-containing protein 1a allele 5	5.12e-02	NA	0.003
3. B	Q9SSD1	Protein TOO MANY MOUTHS	4.54e-05	NA	0.004
3. B	O13066	Ran GTPase-activating protein 1	2.86e-09	NA	7.03e-07
3. B	Q9SYQ8	Receptor protein kinase CLAVATA1	4.41e-05	NA	0.002
3. B	A0A1P8ATR9	Receptor-like protein 9b	6.32e-08	NA	0.012
3. B	Q8BKR5	Protein phosphatase 1 regulatory subunit 37	5.36e-07	NA	0.011
3. B	D4A615	Tonsoku-like protein	4.05e-04	NA	0.006
3. B	P46061	Ran GTPase-activating protein 1	8.38e-08	NA	9.95e-06
3. B	Q9FXF2	Probable LRR receptor-like serine/threonine-protein kinase RFK1	5.88e-03	NA	0.004
3. B	Q5JTW2	Centrosomal protein of 78 kDa	6.24e-04	NA	0.017
3. B	E9Q5R7	NACHT, LRR and PYD domains-containing protein 12	6.61e-08	NA	2.06e-09
3. B	P59046	NACHT, LRR and PYD domains-containing protein 12	7.49e-07	NA	6.55e-10
3. B	Q9LY03	Probable LRR receptor-like serine/threonine-protein kinase IRK	2.65e-05	NA	3.56e-05
3. B	Q9NR96	Toll-like receptor 9	3.82e-05	NA	0.017
3. B	F1MHT9	NLR family CARD domain-containing protein 4	1.74e-06	NA	3.60e-05
3. B	Q647I9	NACHT, LRR and PYD domains-containing protein 5	5.35e-09	NA	1.69e-05
3. B	F1M649	NLR family CARD domain-containing protein 4	1.67e-06	NA	1.86e-05
3. B	Q0P5G1	Tonsoku-like protein	1.38e-03	NA	5.79e-04
3. B	Q9LVN2	Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150	3.22e-04	NA	0.003
3. B	Q96HA7	Tonsoku-like protein	6.67e-04	NA	0.010
3. B	Q95VZ3	Protein CARMIL	1.90e-09	NA	0.002
3. B	Q9JJ28	Protein flightless-1 homolog	4.37e-05	NA	8.41e-04
3. B	Q3UP24	NLR family CARD domain-containing protein 4	1.04e-06	NA	2.61e-07
3. B	Q9QUK4	Baculoviral IAP repeat-containing protein 1b	2.22e-05	NA	0.003
3. B	Q9FN37	Phytosulfokine receptor 2	6.67e-05	NA	0.040
3. B	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	8.44e-06	NA	2.52e-05
3. B	Q13075	Baculoviral IAP repeat-containing protein 1	2.83e-04	NA	0.005
3. B	Q9JIB6	Baculoviral IAP repeat-containing protein 1f	2.04e-06	NA	0.001
3. B	Q9NX02	NACHT, LRR and PYD domains-containing protein 2	3.98e-06	NA	0.018
3. B	Q86W24	NACHT, LRR and PYD domains-containing protein 14	5.99e-09	NA	8.05e-05
3. B	F4K4T3	Receptor-like protein 56	1.34e-05	NA	0.040
3. B	Q6NZL6	Tonsoku-like protein	1.17e-03	NA	7.93e-04
3. B	D4A523	NACHT, LRR and PYD domains-containing protein 3	2.99e-06	NA	8.40e-04
3. B	O49328	Receptor like protein 26	3.61e-06	NA	0.010
3. B	Q8R4B8	NACHT, LRR and PYD domains-containing protein 3	5.04e-06	NA	0.004