Summary

Q6ZMV7

Homolog: Q9CQU5.
Function: ZW10 interactor.

Statistics

Total GO Annotation: 132
Unique PROST Go: 87
Unique BLAST Go: 44

Total Homologs: 59
Unique PROST Homologs: 55
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9CQU5 (ZW10 interactor) with a FATCAT P-Value: 1.04e-12 and RMSD of 1.94 angstrom. The sequence alignment identity is 20.4%.
Structural alignment shown in left. Query protein Q6ZMV7 colored as red in alignment, homolog Q9CQU5 colored as blue. Query protein Q6ZMV7 is also shown in right top, homolog Q9CQU5 showed in right bottom. They are colored based on secondary structures. 

  Q6ZMV7 MLLKEKEDSLMTCQQIYKALQEELTVKEKQEEDIKRRIN-LAE--NELEITKTLLNQTREEVL---TLKNERELMLISHQKSIEQLQETLRQKLLSDDNW 94
  Q9CQU5 ------------------------------MADAEK--NAVAEKNNAVA-TKEVLAEA-AAILEPVGLQEEAEL----PAKIMEEFMRNSRKK---D--- 56

  Q6ZMV7 KEKIEAELAKERAQHLVEFEEQALLFKEETKLQLD-IEKEKHQDVIQKYK----KEQEELQMKIS-----DLITGATRDLRQEVTTLKEKLHKSHIRYTE 184
  Q9CQU5 --KL---LCS-QLQ-VVNF-LQTFLAQEDTEQSPDALASE---DA-SRQKATETKEQWK-DMKATYMDHVDVIKCA---LSEALPQVKE----AHRKYTE 136

  Q6ZMV7 ESNSKEKEIENL---KNLVAEFESRL----KKEIDSNDSVSENLRKEMEQKSDELKRVMLAQTQLIEQFNQSQEENTFLQETVRREC-EERFELTEALSQ 276
  Q9CQU5 ----LQKAFEQLEAKKRVLEE---KLQLAQKQWVLQQKRL-QNLTK-I---SAEVKR---RRKRALEKLDGSHQE---L-ETLKQQAGQEQ----EKL-Q 212

  Q6ZMV7 AREQLLELSKLRGSLPFSPCSLSKGSLTSPAAAVSNHGERSLARLNSEKGIQIPNLRGVSKPTTFPTSDKPKRVRSGVPILPQPHPPRGGASSANETRQR 376
  Q9CQU5 RNQSYLQL--L--------CSL-QNKL------VISEGK---AEDKDVKG------RALTAKSKSP---------------------------------- 252

  Q6ZMV7 LAAILRRRRSQQ 388
  Q9CQU5 ------------ 252

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:2001256 regulation of store-operated calcium entry
2. P GO:0005902 microvillus
2. P GO:0032258 cytoplasm to vacuole transport by the Cvt pathway
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0060122 inner ear receptor cell stereocilium organization
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0031083 BLOC-1 complex
2. P GO:0099078 BORC complex
2. P GO:0061908 phagophore
2. P GO:0061512 protein localization to cilium
2. P GO:0055007 cardiac muscle cell differentiation
2. P GO:0006501 C-terminal protein lipidation
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0030992 intraciliary transport particle B
2. P GO:0061635 regulation of protein complex stability
2. P GO:0097546 ciliary base
2. P GO:0001736 establishment of planar polarity
2. P GO:0034727 piecemeal microautophagy of the nucleus
2. P GO:0140059 dendrite arborization
2. P GO:0002046 opsin binding
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0019776 Atg8 ligase activity
2. P GO:0005929 cilium
2. P GO:0016079 synaptic vesicle exocytosis
2. P GO:0032420 stereocilium
2. P GO:0036372 opsin transport
2. P GO:0042592 homeostatic process
2. P GO:0061351 neural precursor cell proliferation
2. P GO:1905037 autophagosome organization
2. P GO:0034067 protein localization to Golgi apparatus
2. P GO:0008585 female gonad development
2. P GO:0034613 cellular protein localization
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0034045 phagophore assembly site membrane
2. P GO:0007269 neurotransmitter secretion
2. P GO:0007040 lysosome organization
2. P GO:0051642 centrosome localization
2. P GO:0030154 cell differentiation
2. P GO:0010569 regulation of double-strand break repair via homologous recombination
2. P GO:0001750 photoreceptor outer segment
2. P GO:0030674 protein-macromolecule adaptor activity
2. P GO:0005814 centriole
2. P GO:0061909 autophagosome-lysosome fusion
2. P GO:0016082 synaptic vesicle priming
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:0002115 store-operated calcium entry
2. P GO:0001822 kidney development
2. P GO:0007283 spermatogenesis
2. P GO:1902441 protein localization to meiotic spindle pole body
2. P GO:0030437 ascospore formation
2. P GO:0035974 meiotic spindle pole body
2. P GO:0031267 small GTPase binding
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0060271 cilium assembly
2. P GO:0008542 visual learning
2. P GO:0072659 protein localization to plasma membrane
2. P GO:1902636 kinociliary basal body
2. P GO:0031514 motile cilium
2. P GO:0032418 lysosome localization
2. P GO:0000930 gamma-tubulin complex
2. P GO:0005813 centrosome
2. P GO:0035845 photoreceptor cell outer segment organization
2. P GO:0043015 gamma-tubulin binding
2. P GO:0042073 intraciliary transport
2. P GO:0090102 cochlea development
2. P GO:0045198 establishment of epithelial cell apical/basal polarity
2. P GO:0051649 establishment of localization in cell
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0044805 late nucleophagy
2. P GO:0070319 Golgi to plasma membrane transport vesicle
2. P GO:0044292 dendrite terminus
2. P GO:0005801 cis-Golgi network
2. P GO:0008333 endosome to lysosome transport
2. P GO:0007224 smoothened signaling pathway
2. P GO:0034274 Atg12-Atg5-Atg16 complex
2. P GO:0097542 ciliary tip
2. P GO:0046806 viral scaffold
2. P GO:1902017 regulation of cilium assembly
2. P GO:0060828 regulation of canonical Wnt signaling pathway
2. P GO:2000583 regulation of platelet-derived growth factor receptor-alpha signaling pathway
2. P GO:0005730 nucleolus
2. P GO:0031322 ascospore-type prospore-specific spindle pole body remodeling
2. P GO:0048714 positive regulation of oligodendrocyte differentiation
2. P GO:2000785 regulation of autophagosome assembly
2. P GO:0006914 autophagy
2. P GO:0005654 nucleoplasm
3. B GO:0051928 positive regulation of calcium ion transport
3. B GO:0098978 glutamatergic synapse
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0019252 starch biosynthetic process
3. B GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
3. B GO:0043198 dendritic shaft
3. B GO:0098794 postsynapse
3. B GO:0005982 starch metabolic process
3. B GO:0060090 molecular adaptor activity
3. B GO:0007216 G protein-coupled glutamate receptor signaling pathway
3. B GO:2001257 regulation of cation channel activity
3. B GO:0031802 type 5 metabotropic glutamate receptor binding
3. B GO:0045177 apical part of cell
3. B GO:0035256 G protein-coupled glutamate receptor binding
3. B GO:0043034 costamere
3. B GO:0043197 dendritic spine
3. B GO:0098962 regulation of postsynaptic neurotransmitter receptor activity
3. B GO:0071482 cellular response to light stimulus
3. B GO:0048741 skeletal muscle fiber development
3. B GO:0030424 axon
3. B GO:0003009 skeletal muscle contraction
3. B GO:0043169 cation binding
3. B GO:0099186 structural constituent of postsynapse
3. B GO:0044309 neuron spine
3. B GO:0051262 protein tetramerization
3. B GO:0035418 protein localization to synapse
3. B GO:0044325 transmembrane transporter binding
3. B GO:0048148 behavioral response to cocaine
3. B GO:0030425 dendrite
3. B GO:0099524 postsynaptic cytosol
3. B GO:0051592 response to calcium ion
3. B GO:0014069 postsynaptic density
3. B GO:1902950 regulation of dendritic spine maintenance
3. B GO:0071329 cellular response to sucrose stimulus
3. B GO:0003844 1,4-alpha-glucan branching enzyme activity
3. B GO:0071332 cellular response to fructose stimulus
3. B GO:0051966 regulation of synaptic transmission, glutamatergic
3. B GO:0030018 Z disc
3. B GO:0097110 scaffold protein binding
3. B GO:0090279 regulation of calcium ion import
3. B GO:0009501 amyloplast
3. B GO:0102752 1,4-alpha-glucan branching enzyme activity (using a glucosylated glycogenin as primer for glycogen synthesis)
3. B GO:0010021 amylopectin biosynthetic process
3. B GO:0048875 chemical homeostasis within a tissue

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZMV7 Protein LEKR1 0 1.31e-144 9.42e-93
2. P P07533 Capsid assembly scaffolding protein NA 1.34e-04 NA
2. P P0CU25 Uncharacterized protein SPAC29A4.23 1.00e-04 4.89e-04 NA
2. P Q08BG7 Short coiled-coil protein A 1.03e-04 4.72e-03 NA
2. P Q2NKS9 Bublin coiled-coil protein 1.89e-03 3.24e-02 NA
2. P Q65I80 Cell cycle protein GpsB 1.92e-03 4.23e-02 NA
2. P B0BNK9 EF-hand calcium-binding domain-containing protein 4A 7.13e-06 4.58e-03 NA
2. P Q5PQS2 Protein ZNF365 3.24e-06 3.15e-02 NA
2. P A7TIN2 Autophagy-related protein 16 1.12e-04 3.07e-03 NA
2. P C5DGT3 Biogenesis of lysosome-related organelles complex 1 subunit BLI1 1.07e-06 6.89e-04 NA
2. P P02539 Keratin, type II microfibrillar (Fragment) 6.12e-06 7.96e-06 NA
2. P B4YNF4 Uncharacterized protein V14 NA 2.68e-02 NA
2. P C5DJH5 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 4.55e-05 4.04e-02 NA
2. P B5X9S3 Protein MIX23 3.21e-04 9.08e-04 NA
2. P Q8IY31 Intraflagellar transport protein 20 homolog 1.71e-11 4.52e-02 NA
2. P A4IN56 Cell cycle protein GpsB 2.81e-03 5.60e-03 NA
2. P A6ZML8 Autophagy-related protein 16 7.55e-06 9.33e-03 NA
2. P Q6P926 Spermatogenesis-associated protein 24 5.50e-11 3.17e-03 NA
2. P C7GMH9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 4.61e-09 6.58e-03 NA
2. P B3LFU5 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 2.52e-09 6.58e-03 NA
2. P Q4PJT6 Spermatogenesis-associated protein 24 7.30e-11 3.06e-02 NA
2. P Q6PBK1 Protein MIX23 4.16e-04 2.13e-02 NA
2. P Q6GPT7 Protein MIX23 1.01e-04 1.51e-02 NA
2. P Q9PQX9 Uncharacterized protein UU165 6.12e-05 8.04e-03 NA
2. P P29582 Uncharacterized protein ORF7 5.67e-05 2.64e-03 NA
2. P A6ZYV6 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.08e-06 6.58e-03 NA
2. P P13848 Capsid assembly scaffolding protein NA 2.63e-02 NA
2. P C6Y4C9 Sporulation-specific protein 13 1.76e-08 5.34e-08 NA
2. P Q9VQF9 SNAPIN protein homolog 1.59e-05 3.03e-02 NA
2. P Q86W54 Spermatogenesis-associated protein 24 1.77e-08 5.95e-03 NA
2. P E7KB73 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 5.43e-07 6.58e-03 NA
2. P B4YNF1 Uncharacterized protein V11 NA 4.36e-02 NA
2. P P34606 Uncharacterized protein ZK1098.6 3.90e-10 6.89e-04 NA
2. P E7KM17 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 NA 3.66e-03 NA
2. P Q6CT76 Mediator of RNA polymerase II transcription subunit 21 4.14e-05 1.73e-02 NA
2. P P32512 Major immediate early protein NA 1.85e-03 NA
2. P Q4R7I4 Spermatogenesis-associated protein 24 2.05e-10 3.67e-02 NA
2. P P0CT51 Blood-induced peptide 1 2.85e-04 3.81e-02 NA
2. P Q61025 Intraflagellar transport protein 20 homolog 1.53e-08 2.34e-02 NA
2. P P58686 Bublin coiled-coil protein 1.28e-03 1.09e-02 NA
2. P Q8N4Y2 EF-hand calcium-binding domain-containing protein 4A 1.06e-04 2.95e-02 NA
2. P E7QDA1 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.21e-06 6.58e-03 NA
2. P Q9D9C6 Coiled-coil domain-containing protein 182 2.03e-06 3.75e-06 NA
2. P Q06333 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.07e-06 4.67e-03 NA
2. P C5DMF2 Biogenesis of lysosome-related organelles complex 1 subunit SNN1 3.95e-05 4.72e-03 NA
2. P A6NF36 Coiled-coil domain-containing protein 182 1.05e-04 7.25e-05 NA
2. P C8Z5R9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 9.56e-08 6.58e-03 NA
2. P O32265 Uncharacterized protein YvzA 2.65e-03 2.32e-02 NA
2. P E7NG53 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 9.37e-08 6.58e-03 NA
2. P Q3UYG1 Coiled-coil domain-containing protein 160 2.75e-09 2.21e-02 NA
2. P E7Q2L9 Biogenesis of lysosome-related organelles complex 1 subunit CNL1 1.82e-07 4.44e-02 NA
2. P Q9VTE0 Biogenesis of lysosome-related organelles complex 1 subunit 2 8.70e-07 4.62e-03 NA
2. P Q8GWU7 Protein SKIP34 5.11e-04 4.97e-02 NA
2. P Q03818 Autophagy protein 16 3.15e-06 9.33e-03 NA
2. P Q9CQU5 ZW10 interactor 1.04e-12 1.27e-02 NA
2. P Q80ZJ8 EF-hand calcium-binding domain-containing protein 4A 2.88e-06 3.97e-03 NA
3. B Q9Z2Y3 Homer protein homolog 1 1.74e-08 NA 0.023
3. B O23647 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic 7.11e-01 NA 0.045
3. B Q2KJ56 Homer protein homolog 1 9.67e-10 NA 0.021