Results | PROST

Summary

Q6ZMY6

Homolog: Q1DPU4.
Function: Eukaryotic translation initiation factor 3 subunit I.

Statistics

Total GO Annotation: 793
Unique PROST Go: 113
Unique BLAST Go: 489

Total Homologs: 1471
Unique PROST Homologs: 69
Unique BLAST Homologs: 1091

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q1DPU4 (Eukaryotic translation initiation factor 3 subunit I) with a FATCAT P-Value: 0.0 and RMSD of 2.33 angstrom. The sequence alignment identity is 16.6%.
Structural alignment shown in left. Query protein Q6ZMY6 colored as red in alignment, homolog Q1DPU4 colored as blue. Query protein Q6ZMY6 is also shown in right top, homolog Q1DPU4 showed in right bottom. They are colored based on secondary structures.

  Q6ZMY6 MASPPRCSPTAHDRECKLPPPSAPASEYCPGKLSWGTMARALGRFKLSIPHTHLLATLDPLALDREPPPHLLPEKHQVPEKLIWGDQDPLSKIPFKILSG 100
  Q1DPU4 --------------------------------------------------------------------------------------MRPI------LLQG 8

  Q6ZMY6 HEHAVSTCHFCVD-DTKLL-SGSYD---CTVKLWDPVDGSVVRDFE-HRPKAPVVECSITGDSSRVIA--ASYDKTVRAWDLETGKLLWKVRYD--TFIV 190
  Q1DPU4 HERSLNQIRFNHDGD--LLFSVAKDKILCA---WYSANGERLGTYHGHQGALWTVDVS-PG--TVLLATGAA-DNTVRLWNAKSGECV-KV-WDFPTAVK 97

  Q6ZMY6 SCKFSPDGKYVVS------G-------FDVDHGICIMDAE--NI--TTVSVIKDHHTRSITSCCFDPDSQRVASVS-L---------DRCIKIWDVTSQA 263
  Q1DPU4 RVEFSPDGSRLLAVTEKRMGYLGTIVVFDVRYG----DGEGNNLDDQT-----DEPSLKIT-C--EQSKATVAGWSFLGKYIIAGHEDGSVSQYDSKTGE 185

  Q6ZMY6 TLLTITKAH--SNAISNCCFTFS-GHFLCTSSWDKNLKIWNVHTGEFRNCGAC--VTLMQG--HEGSVSSCHFA--RDSSFLISGG----FDRTVAIWDV 350
  Q1DPU4 QLQNV-QAHEFDYQINDLQFSADRTYFI-TASKDKSAKI--I---------SCRDLQVMKTFVADTPLNTAAITPKKD--FVILGGGQAAMDVTTT--SA 268

  Q6ZMY6 AEG------YRKL------SLKGHNDWVMDVAISNNKKWILSASKDRTMRLWNIEEIDEIPLV-IKYKKAVGLKLKQCERCDRPFSIFKSDTSSEMFTQC 437
  Q1DPU4 RQGKFEARFYHKIFEDEIGRVRGHFGPLNTIAVHPAGTGYASGGEDGYVR---VHHFDK-PYFDFMYE----VEREKARR-------------------- 340

  Q6ZMY6 VFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD 472
  Q1DPU4 ----------------------------------- 340

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0006336	DNA replication-independent chromatin assembly
1. PB	GO:0008090	retrograde axonal transport
1. PB	GO:2000781	positive regulation of double-strand break repair
1. PB	GO:0005881	cytoplasmic microtubule
1. PB	GO:0007080	mitotic metaphase plate congression
1. PB	GO:0000122	negative regulation of transcription by RNA polymerase II
1. PB	GO:0005874	microtubule
1. PB	GO:0031465	Cul4B-RING E3 ubiquitin ligase complex
1. PB	GO:0000346	transcription export complex
1. PB	GO:0001934	positive regulation of protein phosphorylation
1. PB	GO:0008283	cell population proliferation
1. PB	GO:0035327
1. PB	GO:0070545	PeBoW complex
1. PB	GO:0042800	histone methyltransferase activity (H3-K4 specific)
1. PB	GO:0031497	chromatin assembly
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0047496	vesicle transport along microtubule
1. PB	GO:1902610	response to N-phenylthiourea
1. PB	GO:0006338	chromatin remodeling
1. PB	GO:0048705	skeletal system morphogenesis
1. PB	GO:2000543	positive regulation of gastrulation
1. PB	GO:0006325	chromatin organization
1. PB	GO:0006406	mRNA export from nucleus
1. PB	GO:0010026	trichome differentiation
1. PB	GO:0071870	cellular response to catecholamine stimulus
1. PB	GO:0000132	establishment of mitotic spindle orientation
1. PB	GO:0033186	CAF-1 complex
1. PB	GO:0043966	histone H3 acetylation
1. PB	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB	GO:1904851	positive regulation of establishment of protein localization to telomere
1. PB	GO:2001034	positive regulation of double-strand break repair via nonhomologous end joining
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:1903260	protein localization to mating projection tip
1. PB	GO:1903775	regulation of DNA double-strand break processing
1. PB	GO:1901386	negative regulation of voltage-gated calcium channel activity
1. PB	GO:0048545	response to steroid hormone
1. PB	GO:0044666	MLL3/4 complex
1. PB	GO:0044877	protein-containing complex binding
1. PB	GO:0005576	extracellular region
1. PB	GO:1905786	positive regulation of anaphase-promoting complex-dependent catabolic process
1. PB	GO:0031915	positive regulation of synaptic plasticity
1. PB	GO:0055087	Ski complex
1. PB	GO:0008017	microtubule binding
1. PB	GO:0001826	inner cell mass cell differentiation
1. PB	GO:0090666	scaRNA localization to Cajal body
1. PB	GO:1990757	ubiquitin ligase activator activity
1. PB	GO:0016558	protein import into peroxisome matrix
1. PB	GO:0007165	signal transduction
1. PB	GO:1904867	protein localization to Cajal body
1. PB	GO:0045722	positive regulation of gluconeogenesis
1. PB	GO:1904668	positive regulation of ubiquitin protein ligase activity
1. PB	GO:0007097	nuclear migration
1. PB	GO:0007059	chromosome segregation
1. PB	GO:0000012	single strand break repair
1. PB	GO:0006283	transcription-coupled nucleotide-excision repair
1. PB	GO:0110136	protein-RNA complex remodeling
1. PB	GO:0005815	microtubule organizing center
1. PB	GO:0051301	cell division
1. PB	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0043981	histone H4-K5 acetylation
1. PB	GO:0006333	chromatin assembly or disassembly
1. PB	GO:0048854	brain morphogenesis
1. PB	GO:0006335	DNA replication-dependent chromatin assembly
1. PB	GO:0030308	negative regulation of cell growth
1. PB	GO:0007634	optokinetic behavior
1. PB	GO:0034511	U3 snoRNA binding
1. PB	GO:0005782	peroxisomal matrix
1. PB	GO:0031023	microtubule organizing center organization
1. PB	GO:0060041	retina development in camera-type eye
1. PB	GO:0000922	spindle pole
1. PB	GO:0007219	Notch signaling pathway
1. PB	GO:0033597	mitotic checkpoint complex
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0010997	anaphase-promoting complex binding
1. PB	GO:0000109	nucleotide-excision repair complex
1. PB	GO:0042826	histone deacetylase binding
1. PB	GO:0070840	dynein complex binding
1. PB	GO:2001162	positive regulation of histone H3-K79 methylation
1. PB	GO:1905168	positive regulation of double-strand break repair via homologous recombination
1. PB	GO:0007212	dopamine receptor signaling pathway
1. PB	GO:0040035	hermaphrodite genitalia development
1. PB	GO:0005886	plasma membrane
1. PB	GO:0045879	negative regulation of smoothened signaling pathway
1. PB	GO:0009792	embryo development ending in birth or egg hatching
1. PB	GO:0043982	histone H4-K8 acetylation
1. PB	GO:0035098	ESC/E(Z) complex
1. PB	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
1. PB	GO:0071013	catalytic step 2 spliceosome
1. PB	GO:0031145	anaphase-promoting complex-dependent catabolic process
1. PB	GO:0090129	positive regulation of synapse maturation
1. PB	GO:0009845	seed germination
1. PB	GO:0090594	inflammatory response to wounding
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0044297	cell body
1. PB	GO:0051571	positive regulation of histone H3-K4 methylation
1. PB	GO:0090181	regulation of cholesterol metabolic process
1. PB	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
1. PB	GO:0005730	nucleolus
1. PB	GO:0045138	nematode male tail tip morphogenesis
1. PB	GO:2000582	obsolete positive regulation of microtubule motor activity, plus-end-directed
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0090671	telomerase RNA localization to Cajal body
1. PB	GO:0043984	histone H4-K16 acetylation
1. PB	GO:1902773	GTPase activator complex
1. PB	GO:0016589	NURF complex
1. PB	GO:0043547	positive regulation of GTPase activity
1. PB	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
1. PB	GO:0051010	microtubule plus-end binding
1. PB	GO:0098789	pre-mRNA cleavage required for polyadenylation
1. PB	GO:0051020	GTPase binding
1. PB	GO:0015030	Cajal body
1. PB	GO:0046662	regulation of oviposition
1. PB	GO:0032203	telomere formation via telomerase
1. PB	GO:0008611	ether lipid biosynthetic process
1. PB	GO:0005053	peroxisome matrix targeting signal-2 binding
1. PB	GO:0006378	mRNA polyadenylation
1. PB	GO:0010154	fruit development
1. PB	GO:0090660	cerebrospinal fluid circulation
1. PB	GO:0045292	mRNA cis splicing, via spliceosome
1. PB	GO:0072686	mitotic spindle
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:0000209	protein polyubiquitination
1. PB	GO:0035861	site of double-strand break
1. PB	GO:0050773	regulation of dendrite development
1. PB	GO:0005834	heterotrimeric G-protein complex
1. PB	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0030496	midbody
1. PB	GO:0031507	heterochromatin assembly
1. PB	GO:0000375	RNA splicing, via transesterification reactions
1. PB	GO:0005634	nucleus
1. PB	GO:0014909	smooth muscle cell migration
1. PB	GO:0000123	histone acetyltransferase complex
1. PB	GO:0030473	nuclear migration along microtubule
1. PB	GO:0031682	G-protein gamma-subunit binding
1. PB	GO:2001173	regulation of histone H2B conserved C-terminal lysine ubiquitination
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0000118	histone deacetylase complex
1. PB	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0000445	THO complex part of transcription export complex
1. PB	GO:0005681	spliceosomal complex
1. PB	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
1. PB	GO:0042393	histone binding
1. PB	GO:0003677	DNA binding
1. PB	GO:0031101	fin regeneration
1. PB	GO:0051012	microtubule sliding
1. PB	GO:0046784	viral mRNA export from host cell nucleus
1. PB	GO:0016593	Cdc73/Paf1 complex
1. PB	GO:1903725	regulation of phospholipid metabolic process
1. PB	GO:0097027	ubiquitin-protein transferase activator activity
1. PB	GO:0045598	regulation of fat cell differentiation
1. PB	GO:0051973	positive regulation of telomerase activity
1. PB	GO:0030507	spectrin binding
1. PB	GO:0000398	mRNA splicing, via spliceosome
1. PB	GO:0071339	MLL1 complex
1. PB	GO:0009908	flower development
1. PB	GO:0097680	double-strand break repair via classical nonhomologous end joining
1. PB	GO:0009411	response to UV
1. PB	GO:0032350	regulation of hormone metabolic process
1. PB	GO:2000574	obsolete regulation of microtubule motor activity
1. PB	GO:0040020	regulation of meiotic nuclear division
1. PB	GO:0016581	NuRD complex
1. PB	GO:0080182	histone H3-K4 trimethylation
1. PB	GO:0045739	positive regulation of DNA repair
1. PB	GO:0008380	RNA splicing
1. PB	GO:0000781	chromosome, telomeric region
1. PB	GO:0071007	U2-type catalytic step 2 spliceosome
1. PB	GO:0010659	cardiac muscle cell apoptotic process
1. PB	GO:0005875	microtubule associated complex
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0007004	telomere maintenance via telomerase
1. PB	GO:0030576	Cajal body organization
1. PB	GO:0070370	cellular heat acclimation
1. PB	GO:0015630	microtubule cytoskeleton
1. PB	GO:0007186	G protein-coupled receptor signaling pathway
1. PB	GO:0070034	telomerase RNA binding
1. PB	GO:0005829	cytosol
1. PB	GO:0005697	telomerase holoenzyme complex
1. PB	GO:0090207	regulation of triglyceride metabolic process
1. PB	GO:0005680	anaphase-promoting complex
1. PB	GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity
1. PB	GO:0034337	RNA folding
1. PB	GO:0000974	Prp19 complex
1. PB	GO:1903033	positive regulation of microtubule plus-end binding
1. PB	GO:0000776	kinetochore
1. PB	GO:0070176	DRM complex
1. PB	GO:0051572	negative regulation of histone H3-K4 methylation
1. PB	GO:0072344	rescue of stalled ribosome
1. PB	GO:0005635	nuclear envelope
1. PB	GO:0005654	nucleoplasm
1. PB	GO:0040013	negative regulation of locomotion
2. P	GO:0001708	cell fate specification
2. P	GO:0048364	root development
2. P	GO:1903665	negative regulation of asexual reproduction
2. P	GO:0043935	sexual sporulation resulting in formation of a cellular spore
2. P	GO:1903561	extracellular vesicle
2. P	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
2. P	GO:0010214	seed coat development
2. P	GO:0001958	endochondral ossification
2. P	GO:0032794	GTPase activating protein binding
2. P	GO:1902365	positive regulation of protein localization to spindle pole body
2. P	GO:0006884	cell volume homeostasis
2. P	GO:0070734	histone H3-K27 methylation
2. P	GO:0032995	regulation of fungal-type cell wall biogenesis
2. P	GO:0008047	enzyme activator activity
2. P	GO:0045013	carbon catabolite repression of transcription
2. P	GO:0036269	swimming behavior
2. P	GO:0071380	cellular response to prostaglandin E stimulus
2. P	GO:0043577	chemotropism
2. P	GO:0043519	regulation of myosin II filament organization
2. P	GO:0035046	pronuclear migration
2. P	GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
2. P	GO:0008340	determination of adult lifespan
2. P	GO:0010969	regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P	GO:0009793	embryo development ending in seed dormancy
2. P	GO:1901673	regulation of mitotic spindle assembly
2. P	GO:0005929	cilium
2. P	GO:0061484	hematopoietic stem cell homeostasis
2. P	GO:1903463	regulation of mitotic cell cycle DNA replication
2. P	GO:2000221	negative regulation of pseudohyphal growth
2. P	GO:0005246	calcium channel regulator activity
2. P	GO:0061186	negative regulation of silent mating-type cassette heterochromatin assembly
2. P	GO:0010595	positive regulation of endothelial cell migration
2. P	GO:0031519	PcG protein complex
2. P	GO:0005677	chromatin silencing complex
2. P	GO:0006342
2. P	GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
2. P	GO:0016571	histone methylation
2. P	GO:0043254	regulation of protein-containing complex assembly
2. P	GO:0030054	cell junction
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0010525	regulation of transposition, RNA-mediated
2. P	GO:0001403	invasive growth in response to glucose limitation
2. P	GO:2000011	regulation of adaxial/abaxial pattern formation
2. P	GO:0045930	negative regulation of mitotic cell cycle
2. P	GO:0001739	sex chromatin
2. P	GO:1901485	positive regulation of transcription factor catabolic process
2. P	GO:0071456	cellular response to hypoxia
2. P	GO:0042622	photoreceptor outer segment membrane
2. P	GO:0031139	positive regulation of conjugation with cellular fusion
2. P	GO:0006348
2. P	GO:0007064	mitotic sister chromatid cohesion
2. P	GO:0051649	establishment of localization in cell
2. P	GO:0031939	obsolete negative regulation of chromatin silencing at telomere
2. P	GO:0048794	swim bladder development
2. P	GO:0061343	cell adhesion involved in heart morphogenesis
2. P	GO:0001222	transcription corepressor binding
2. P	GO:0120171	Cdc24p-Far1p-Gbetagamma complex
2. P	GO:0001917	photoreceptor inner segment
2. P	GO:0050909	sensory perception of taste
2. P	GO:0051087	chaperone binding
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:0004402	histone acetyltransferase activity
2. P	GO:0005682	U5 snRNP
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0070914	UV-damage excision repair
2. P	GO:0009909	regulation of flower development
2. P	GO:0090696	post-embryonic plant organ development
2. P	GO:1905803	negative regulation of cellular response to manganese ion
2. P	GO:1904146	positive regulation of meiotic cell cycle process involved in oocyte maturation
2. P	GO:0043209	myelin sheath
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0016573	histone acetylation
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:0048920	posterior lateral line neuromast primordium migration
2. P	GO:0010165	response to X-ray
2. P	GO:0006260	DNA replication
2. P	GO:0048557	embryonic digestive tract morphogenesis
2. P	GO:0034514	mitochondrial unfolded protein response
2. P	GO:0016059	deactivation of rhodopsin mediated signaling
2. P	GO:0000226	microtubule cytoskeleton organization
2. P	GO:0048383	mesectoderm development
2. P	GO:0060465	pharynx development
2. P	GO:0090307	mitotic spindle assembly
2. P	GO:0031592	centrosomal corona
2. P	GO:0035064	methylated histone binding
2. P	GO:0007213	G protein-coupled acetylcholine receptor signaling pathway
2. P	GO:1905301	regulation of macropinocytosis
2. P	GO:1990498	mitotic spindle microtubule
2. P	GO:1903138	negative regulation of cell wall integrity MAPK cascade
2. P	GO:0019899	enzyme binding
2. P	GO:0009960	endosperm development
2. P	GO:0042054	histone methyltransferase activity
2. P	GO:0060027	convergent extension involved in gastrulation
2. P	GO:0005818	aster
2. P	GO:1902624	positive regulation of neutrophil migration
2. P	GO:0035518	histone H2A monoubiquitination
2. P	GO:0060290	transdifferentiation
2. P	GO:0007307	eggshell chorion gene amplification
2. P	GO:0006290	pyrimidine dimer repair
2. P	GO:0007368	determination of left/right symmetry
2. P	GO:0016243	regulation of autophagosome size
2. P	GO:0010224	response to UV-B
2. P	GO:0035556	intracellular signal transduction
2. P	GO:0098654	CENP-A recruiting complex
2. P	GO:0010906	regulation of glucose metabolic process
2. P	GO:0003400	regulation of COPII vesicle coating
2. P	GO:0010674	negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle
2. P	GO:0006349	regulation of gene expression by genomic imprinting
2. P	GO:0005937	mating projection
2. P	GO:0048366	leaf development
2. P	GO:2000653	regulation of genetic imprinting
2. P	GO:0048316	seed development
2. P	GO:0010231	maintenance of seed dormancy
3. B	GO:0021540	corpus callosum morphogenesis
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:1990147	talin binding
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0007094	mitotic spindle assembly checkpoint signaling
3. B	GO:0043614	multi-eIF complex
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:0071353	cellular response to interleukin-4
3. B	GO:1905861	intranuclear rod assembly
3. B	GO:0031965	nuclear membrane
3. B	GO:0032796	uropod organization
3. B	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
3. B	GO:1903673	mitotic cleavage furrow formation
3. B	GO:0007541	sex determination, primary response to X:A ratio
3. B	GO:0010267	primary ta-siRNA processing
3. B	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0009553	embryo sac development
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0120293	dynein axonemal particle
3. B	GO:0005615	extracellular space
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0032420	stereocilium
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0005869	dynactin complex
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0006337	nucleosome disassembly
3. B	GO:0005667	transcription regulator complex
3. B	GO:0016579	protein deubiquitination
3. B	GO:0016282	eukaryotic 43S preinitiation complex
3. B	GO:0090148	membrane fission
3. B	GO:0071217	cellular response to external biotic stimulus
3. B	GO:0003735	structural constituent of ribosome
3. B	GO:0017053	transcription repressor complex
3. B	GO:0043025	neuronal cell body
3. B	GO:0015935	small ribosomal subunit
3. B	GO:0061700	GATOR2 complex
3. B	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
3. B	GO:0097428	protein maturation by iron-sulfur cluster transfer
3. B	GO:0005198	structural molecule activity
3. B	GO:0019985	translesion synthesis
3. B	GO:0039023	pronephric duct morphogenesis
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0072520	seminiferous tubule development
3. B	GO:1904263	positive regulation of TORC1 signaling
3. B	GO:0040011	locomotion
3. B	GO:2000393	negative regulation of lamellipodium morphogenesis
3. B	GO:0090114	COPII-coated vesicle budding
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0051169	nuclear transport
3. B	GO:0050765	negative regulation of phagocytosis
3. B	GO:0051539	4 iron, 4 sulfur cluster binding
3. B	GO:0007015	actin filament organization
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0006334	nucleosome assembly
3. B	GO:0016477	cell migration
3. B	GO:0006886	intracellular protein transport
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0010632	regulation of epithelial cell migration
3. B	GO:0017145	stem cell division
3. B	GO:0043521	regulation of myosin II filament disassembly
3. B	GO:0071906	CRD domain binding
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0043130	ubiquitin binding
3. B	GO:0001667	ameboidal-type cell migration
3. B	GO:0031529	ruffle organization
3. B	GO:0048511	rhythmic process
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0031589	cell-substrate adhesion
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:1900024	regulation of substrate adhesion-dependent cell spreading
3. B	GO:0030425	dendrite
3. B	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B	GO:0036170	filamentous growth of a population of unicellular organisms in response to starvation
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:1902184	negative regulation of shoot apical meristem development
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0036064	ciliary basal body
3. B	GO:0048527	lateral root development
3. B	GO:0005930	axoneme
3. B	GO:0030515	snoRNA binding
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0009933	meristem structural organization
3. B	GO:0034504	protein localization to nucleus
3. B	GO:0043297	apical junction assembly
3. B	GO:0001764	neuron migration
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0030971	receptor tyrosine kinase binding
3. B	GO:0003682	chromatin binding
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:2000394	positive regulation of lamellipodium morphogenesis
3. B	GO:0030178	negative regulation of Wnt signaling pathway
3. B	GO:0030127	COPII vesicle coat
3. B	GO:0097750	endosome membrane tubulation
3. B	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B	GO:0005840	ribosome
3. B	GO:0098792	xenophagy
3. B	GO:0005525	GTP binding
3. B	GO:0010992	ubiquitin recycling
3. B	GO:1990266	neutrophil migration
3. B	GO:0007294	germarium-derived oocyte fate determination
3. B	GO:0030043	actin filament fragmentation
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:0030834	regulation of actin filament depolymerization
3. B	GO:0016575	histone deacetylation
3. B	GO:0006606	protein import into nucleus
3. B	GO:0008352	katanin complex
3. B	GO:0070121	Kupffer's vesicle development
3. B	GO:0051299	centrosome separation
3. B	GO:0034198	cellular response to amino acid starvation
3. B	GO:0035844	cloaca development
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0071817	MMXD complex
3. B	GO:0042304	regulation of fatty acid biosynthetic process
3. B	GO:0010697	negative regulation of mitotic spindle pole body separation
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0008013	beta-catenin binding
3. B	GO:2000024	regulation of leaf development
3. B	GO:1990907	beta-catenin-TCF complex
3. B	GO:2000728	regulation of mRNA export from nucleus in response to heat stress
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0051434	BH3 domain binding
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0051028	mRNA transport
3. B	GO:0071539	protein localization to centrosome
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0001738	morphogenesis of a polarized epithelium
3. B	GO:0038202	TORC1 signaling
3. B	GO:0140285	endosome fission
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0051082	unfolded protein binding
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0001675	acrosome assembly
3. B	GO:0061502	early endosome to recycling endosome transport
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0030687	preribosome, large subunit precursor
3. B	GO:0030723	ovarian fusome organization
3. B	GO:0007298	border follicle cell migration
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0005911	cell-cell junction
3. B	GO:0045542	positive regulation of cholesterol biosynthetic process
3. B	GO:0039008	pronephric nephron tubule morphogenesis
3. B	GO:0010272	response to silver ion
3. B	GO:0048713	regulation of oligodendrocyte differentiation
3. B	GO:0030838	positive regulation of actin filament polymerization
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0034399	nuclear periphery
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0006891	intra-Golgi vesicle-mediated transport
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1902525	regulation of protein monoubiquitination
3. B	GO:0050795	regulation of behavior
3. B	GO:0006310	DNA recombination
3. B	GO:0010044	response to aluminum ion
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:0005737	cytoplasm
3. B	GO:2001224	positive regulation of neuron migration
3. B	GO:0007281	germ cell development
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
3. B	GO:0051642	centrosome localization
3. B	GO:0005884	actin filament
3. B	GO:0009585	red, far-red light phototransduction
3. B	GO:0043005	neuron projection
3. B	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
3. B	GO:0031616	spindle pole centrosome
3. B	GO:0030595	leukocyte chemotaxis
3. B	GO:0000417	HIR complex
3. B	GO:0043560	insulin receptor substrate binding
3. B	GO:0009507	chloroplast
3. B	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0000421	autophagosome membrane
3. B	GO:0010073	meristem maintenance
3. B	GO:0005848	mRNA cleavage stimulating factor complex
3. B	GO:0001732	formation of cytoplasmic translation initiation complex
3. B	GO:0032933	SREBP signaling pathway
3. B	GO:0009663	plasmodesma organization
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0051664	nuclear pore localization
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0045159	myosin II binding
3. B	GO:0000380	alternative mRNA splicing, via spliceosome
3. B	GO:0031339	negative regulation of vesicle fusion
3. B	GO:0007095	mitotic G2 DNA damage checkpoint signaling
3. B	GO:0006999	nuclear pore organization
3. B	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:0051219	phosphoprotein binding
3. B	GO:1902183	regulation of shoot apical meristem development
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:0051225	spindle assembly
3. B	GO:0051983	regulation of chromosome segregation
3. B	GO:0050918	positive chemotaxis
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0032430	positive regulation of phospholipase A2 activity
3. B	GO:0002446	neutrophil mediated immunity
3. B	GO:0034501	protein localization to kinetochore
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0035973	aggrephagy
3. B	GO:1903003	positive regulation of protein deubiquitination
3. B	GO:0033137	negative regulation of peptidyl-serine phosphorylation
3. B	GO:0065001	specification of axis polarity
3. B	GO:1990630	IRE1-RACK1-PP2A complex
3. B	GO:0003700	DNA-binding transcription factor activity
3. B	GO:1990447	U2 snRNP binding
3. B	GO:0051126	negative regulation of actin nucleation
3. B	GO:0045309	protein phosphorylated amino acid binding
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0000266	mitochondrial fission
3. B	GO:0007099	centriole replication
3. B	GO:0046329	negative regulation of JNK cascade
3. B	GO:0140026	contractile vacuole dissociation from plasma membrane
3. B	GO:0006895	Golgi to endosome transport
3. B	GO:0071363	cellular response to growth factor stimulus
3. B	GO:0005765	lysosomal membrane
3. B	GO:0043548	phosphatidylinositol 3-kinase binding
3. B	GO:0006909	phagocytosis
3. B	GO:0030332	cyclin binding
3. B	GO:0034613	cellular protein localization
3. B	GO:0000347	THO complex
3. B	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
3. B	GO:0005828	kinetochore microtubule
3. B	GO:0016230	sphingomyelin phosphodiesterase activator activity
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0001961	positive regulation of cytokine-mediated signaling pathway
3. B	GO:0071599	otic vesicle development
3. B	GO:0038180	nerve growth factor signaling pathway
3. B	GO:0031334	positive regulation of protein-containing complex assembly
3. B	GO:0016021	integral component of membrane
3. B	GO:0031514	motile cilium
3. B	GO:0051276	chromosome organization
3. B	GO:0031929	TOR signaling
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0030968	endoplasmic reticulum unfolded protein response
3. B	GO:0005813	centrosome
3. B	GO:0035845	photoreceptor cell outer segment organization
3. B	GO:0097525	spliceosomal snRNP complex
3. B	GO:0030621	U4 snRNA binding
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0031124	mRNA 3'-end processing
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0002102	podosome
3. B	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:0031648	protein destabilization
3. B	GO:0090135	actin filament branching
3. B	GO:0042802	identical protein binding
3. B	GO:0005938	cell cortex
3. B	GO:0002188	translation reinitiation
3. B	GO:0031932	TORC2 complex
3. B	GO:0043029	T cell homeostasis
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:1905191	positive regulation of metaphase/anaphase transition of meiosis II
3. B	GO:0003743	translation initiation factor activity
3. B	GO:0051013	microtubule severing
3. B	GO:0005656	nuclear pre-replicative complex
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0006693	prostaglandin metabolic process
3. B	GO:0030426	growth cone
3. B	GO:0070986	left/right axis specification
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0048359	mucilage metabolic process involved in seed coat development
3. B	GO:0120095	vacuole-isolation membrane contact site
3. B	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B	GO:0016319	mushroom body development
3. B	GO:1900045	negative regulation of protein K63-linked ubiquitination
3. B	GO:0007405	neuroblast proliferation
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0006413	translational initiation
3. B	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
3. B	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B	GO:0005524	ATP binding
3. B	GO:0007303	cytoplasmic transport, nurse cell to oocyte
3. B	GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0001650	fibrillar center
3. B	GO:0030041	actin filament polymerization
3. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
3. B	GO:0010072	primary shoot apical meristem specification
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0061739	protein lipidation involved in autophagosome assembly
3. B	GO:0031931	TORC1 complex
3. B	GO:2001235	positive regulation of apoptotic signaling pathway
3. B	GO:0015031	protein transport
3. B	GO:0039689	negative stranded viral RNA replication
3. B	GO:0034141	positive regulation of toll-like receptor 3 signaling pathway
3. B	GO:0030864	cortical actin cytoskeleton
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0006412	translation
3. B	GO:0075296	positive regulation of ascospore formation
3. B	GO:1990298	bub1-bub3 complex
3. B	GO:0042753	positive regulation of circadian rhythm
3. B	GO:0031080	nuclear pore outer ring
3. B	GO:2000280	regulation of root development
3. B	GO:0044665	MLL1/2 complex
3. B	GO:0008298	intracellular mRNA localization
3. B	GO:0016005	phospholipase A2 activator activity
3. B	GO:0097361	CIA complex
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0051130	positive regulation of cellular component organization
3. B	GO:0030331	estrogen receptor binding
3. B	GO:0072357	PTW/PP1 phosphatase complex
3. B	GO:0051383	kinetochore organization
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0048142	germarium-derived cystoblast division
3. B	GO:0019827	stem cell population maintenance
3. B	GO:0051661	maintenance of centrosome location
3. B	GO:0032036	myosin heavy chain binding
3. B	GO:0090326	positive regulation of locomotion involved in locomotory behavior
3. B	GO:0045540	regulation of cholesterol biosynthetic process
3. B	GO:0042273	ribosomal large subunit biogenesis
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0032934	sterol binding
3. B	GO:0003720	telomerase activity
3. B	GO:0042052	rhabdomere development
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0043143	regulation of translation by machinery localization
3. B	GO:0001891	phagocytic cup
3. B	GO:0051660	establishment of centrosome localization
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0045014	carbon catabolite repression of transcription by glucose
3. B	GO:0080135	regulation of cellular response to stress
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0051015	actin filament binding
3. B	GO:0090724	central region of growth cone
3. B	GO:0120197	mucociliary clearance
3. B	GO:0008270	zinc ion binding
3. B	GO:0000775	chromosome, centromeric region
3. B	GO:0006907	pinocytosis
3. B	GO:1900091	regulation of raffinose biosynthetic process
3. B	GO:0030042	actin filament depolymerization
3. B	GO:0005814	centriole
3. B	GO:0045943	positive regulation of transcription by RNA polymerase I
3. B	GO:0034719	SMN-Sm protein complex
3. B	GO:0000235	astral microtubule
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0010826	negative regulation of centrosome duplication
3. B	GO:0046716	muscle cell cellular homeostasis
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1904115	axon cytoplasm
3. B	GO:0021987	cerebral cortex development
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:0032008	positive regulation of TOR signaling
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0010118	stomatal movement
3. B	GO:0006364	rRNA processing
3. B	GO:0032797	SMN complex
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0097344	Rix1 complex
3. B	GO:0016607	nuclear speck
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0001845	phagolysosome assembly
3. B	GO:0036180	filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0090110	COPII-coated vesicle cargo loading
3. B	GO:0030862	positive regulation of polarized epithelial cell differentiation
3. B	GO:0021819	layer formation in cerebral cortex
3. B	GO:0035591	signaling adaptor activity
3. B	GO:0007369	gastrulation
3. B	GO:0030174	regulation of DNA-dependent DNA replication initiation
3. B	GO:0005643	nuclear pore
3. B	GO:0030220	platelet formation
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:1902463	protein localization to cell leading edge
3. B	GO:0007399	nervous system development
3. B	GO:0033290	eukaryotic 48S preinitiation complex
3. B	GO:1903861	positive regulation of dendrite extension
3. B	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
3. B	GO:0009991	response to extracellular stimulus
3. B	GO:1900052	regulation of retinoic acid biosynthetic process
3. B	GO:0042247	establishment of planar polarity of follicular epithelium
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0016559	peroxisome fission
3. B	GO:0032781	positive regulation of ATP-dependent activity
3. B	GO:0008023	transcription elongation factor complex
3. B	GO:0045214	sarcomere organization
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0016226	iron-sulfur cluster assembly
3. B	GO:0009867	jasmonic acid mediated signaling pathway
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0006513	protein monoubiquitination
3. B	GO:0001895	retina homeostasis
3. B	GO:0043622	cortical microtubule organization
3. B	GO:0034145	positive regulation of toll-like receptor 4 signaling pathway
3. B	GO:0035859	Seh1-associated complex
3. B	GO:0120151	positive regulation of mitotic actomyosin contractile ring disassembly
3. B	GO:0006405	RNA export from nucleus
3. B	GO:0030277	maintenance of gastrointestinal epithelium
3. B	GO:0043320	natural killer cell degranulation
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:0032880	regulation of protein localization
3. B	GO:1903423	positive regulation of synaptic vesicle recycling
3. B	GO:0031252	cell leading edge
3. B	GO:1905392	plant organ morphogenesis
3. B	GO:0030030	cell projection organization
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:0031154	culmination involved in sorocarp development
3. B	GO:0002183	cytoplasmic translational initiation
3. B	GO:0060236	regulation of mitotic spindle organization
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:0045199	maintenance of epithelial cell apical/basal polarity
3. B	GO:0043021	ribonucleoprotein complex binding
3. B	GO:0021895	cerebral cortex neuron differentiation
3. B	GO:0030126	COPI vesicle coat
3. B	GO:0036035	osteoclast development
3. B	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0060117	auditory receptor cell development
3. B	GO:0032527	protein exit from endoplasmic reticulum
3. B	GO:0051721	protein phosphatase 2A binding
3. B	GO:0002098	tRNA wobble uridine modification
3. B	GO:0030027	lamellipodium
3. B	GO:0098532	histone H3-K27 trimethylation
3. B	GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017070	U6 snRNA binding
3. B	GO:0048135	female germ-line cyst formation
3. B	GO:0030686	90S preribosome
3. B	GO:0061966	establishment of left/right asymmetry
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0035767	endothelial cell chemotaxis
3. B	GO:0030286	dynein complex
3. B	GO:0036038	MKS complex
3. B	GO:1990939
3. B	GO:0005852	eukaryotic translation initiation factor 3 complex
3. B	GO:0071001	U4/U6 snRNP
3. B	GO:0010973	positive regulation of division septum assembly
3. B	GO:0080001	mucilage extrusion from seed coat
3. B	GO:0009723	response to ethylene
3. B	GO:0005871	kinesin complex
3. B	GO:0016480	negative regulation of transcription by RNA polymerase III
3. B	GO:0060271	cilium assembly
3. B	GO:0051302	regulation of cell division
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0034629
3. B	GO:0043293	apoptosome
3. B	GO:0030381	chorion-containing eggshell pattern formation
3. B	GO:0003777	microtubule motor activity
3. B	GO:0046872	metal ion binding
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
3. B	GO:0090102	cochlea development
3. B	GO:0009640	photomorphogenesis
3. B	GO:0031570	DNA integrity checkpoint signaling
3. B	GO:0071933	Arp2/3 complex binding
3. B	GO:0000139	Golgi membrane
3. B	GO:0042249	establishment of planar polarity of embryonic epithelium
3. B	GO:0033588	elongator holoenzyme complex
3. B	GO:0042169	SH2 domain binding
3. B	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
3. B	GO:0030292	protein tyrosine kinase inhibitor activity
3. B	GO:0090443	FAR/SIN/STRIPAK complex
3. B	GO:0120206	photoreceptor distal connecting cilium
3. B	GO:0010842	retina layer formation
3. B	GO:1904950	negative regulation of establishment of protein localization
3. B	GO:1901796	regulation of signal transduction by p53 class mediator
3. B	GO:1900088	regulation of inositol biosynthetic process
3. B	GO:0051279	regulation of release of sequestered calcium ion into cytosol
3. B	GO:0070016	armadillo repeat domain binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q5BE22	Pre-mRNA-splicing factor prp46	1.26e-10	4.47e-05	7.36e-12
1. PB	Q0IF90	WD repeat-containing protein 55 homolog	1.24e-08	1.89e-03	1.38e-04
1. PB	Q5R4T8	DDB1- and CUL4-associated factor 13	1.43e-14	6.06e-07	0.011
1. PB	G4MQX3	MST50-interacting protein 11	0.00e+00	2.28e-02	9.38e-17
1. PB	A1L271	Guanine nucleotide-binding protein subunit beta-5a	4.06e-10	4.31e-03	9.59e-11
1. PB	Q6DRF9	WD repeat-containing protein 55	2.21e-11	4.09e-02	2.31e-06
1. PB	Q9W1J3	Gastrulation defective protein 1 homolog	6.79e-07	2.32e-04	1.04e-04
1. PB	Q75AV4	Polyadenylation factor subunit 2	1.16e-10	2.17e-05	1.72e-10
1. PB	Q6PAC3	DDB1- and CUL4-associated factor 13	1.34e-14	8.16e-08	3.44e-05
1. PB	Q6C7Q4	Histone acetyltransferase type B subunit 2	6.00e-09	2.30e-02	5.78e-05
1. PB	O94244	Histone acetyltransferase type B subunit 2	2.89e-15	2.58e-02	3.52e-07
1. PB	Q17I16	WD repeat-containing protein on Y chromosome	6.14e-05	2.58e-04	1.66e-07
1. PB	B4LS78	Ribosome biogenesis protein WDR12 homolog	2.56e-11	4.36e-02	2.30e-09
1. PB	Q9NYS7	WD repeat and SOCS box-containing protein 2	2.19e-09	3.54e-05	1.15e-11
1. PB	Q5ZK69	Proteasomal ATPase-associated factor 1	1.25e-11	9.67e-04	5.02e-13
1. PB	Q75BY3	Pre-mRNA-splicing factor PRP46	6.94e-14	7.46e-06	1.36e-07
1. PB	P62881	Guanine nucleotide-binding protein subunit beta-5	2.55e-15	5.10e-05	3.32e-09
1. PB	A4R3M4	Nuclear distribution protein PAC1	2.93e-14	1.06e-02	4.79e-17
1. PB	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	1.32e-11	9.74e-03	1.87e-26
1. PB	C0NRC6	Nuclear distribution protein PAC1	6.33e-15	9.93e-03	1.85e-20
1. PB	F4K5R6	Cell division cycle 20.6, cofactor of APC complex	5.18e-07	3.58e-05	1.61e-04
1. PB	A0CH87	Lissencephaly-1 homolog 2	0.00e+00	5.77e-04	1.10e-18
1. PB	Q5M7K4	Histone-binding protein RBBP4	3.22e-15	4.82e-02	4.01e-05
1. PB	C5MJE8	Nuclear distribution protein PAC1	2.45e-12	1.79e-02	3.42e-11
1. PB	Q6ZMY6	WD repeat-containing protein 88	0	3.43e-148	0.0
1. PB	Q12021	Radiation-sensitive protein 28	2.44e-05	7.44e-03	1.27e-06
1. PB	A8X8C6	WD repeat-containing protein tag-125	4.60e-14	2.78e-07	2.66e-21
1. PB	C7Z6H2	Nuclear distribution protein PAC1	1.15e-14	1.61e-04	8.41e-18
1. PB	Q9BUR4	Telomerase Cajal body protein 1	9.90e-07	1.79e-02	3.82e-05
1. PB	P18851	Guanine nucleotide-binding protein subunit beta	3.04e-11	1.08e-02	1.97e-04
1. PB	Q498M4	WD repeat-containing protein 5	0.00e+00	1.76e-04	1.84e-27
1. PB	Q24572	Chromatin assembly factor 1 p55 subunit	2.44e-15	1.67e-03	4.89e-04
1. PB	A3LNI7	Nuclear distribution protein PAC1	1.78e-11	3.98e-02	6.04e-08
1. PB	Q03177	WD repeat-containing protein YMR102C	5.46e-03	6.74e-04	0.042
1. PB	Q7T2F6	WD repeat and SOCS box-containing protein 1	1.94e-12	3.62e-05	7.02e-15
1. PB	Q0U1B1	Nuclear distribution protein PAC1	4.02e-14	1.02e-03	6.65e-18
1. PB	Q5QP82	DDB1- and CUL4-associated factor 10	3.28e-08	1.72e-03	7.99e-04
1. PB	Q17963	WD repeat-containing protein wdr-5.1	1.19e-12	3.24e-05	1.93e-20
1. PB	B2VWG7	Nuclear distribution protein PAC1	3.33e-14	9.93e-05	1.73e-18
1. PB	C4R6H3	Nuclear distribution protein PAC1	1.90e-10	1.96e-05	5.51e-12
1. PB	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.44e-15	2.04e-04	5.78e-13
1. PB	Q94AD8	F-box/WD-40 repeat-containing protein At5g21040	2.47e-07	5.24e-03	5.90e-05
1. PB	Q4WLM7	Nuclear distribution protein nudF	2.80e-14	2.09e-03	1.42e-15
1. PB	P62882	Guanine nucleotide-binding protein subunit beta-5	1.38e-14	2.31e-03	4.08e-09
1. PB	Q9S7H3	Cell division cycle 20.3, cofactor of APC complex	1.64e-08	1.30e-04	1.25e-07
1. PB	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	2.44e-15	1.70e-04	1.20e-11
1. PB	Q8TEB1	DDB1- and CUL4-associated factor 11	2.02e-07	4.36e-09	0.009
1. PB	Q6DH44	WD repeat domain-containing protein 83	1.88e-14	1.13e-03	1.25e-09
1. PB	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.11e-15	1.46e-04	6.07e-14
1. PB	Q8AVH1	Histone-binding protein RBBP7	2.44e-15	4.44e-02	3.34e-06
1. PB	Q6FJZ9	Pre-mRNA-splicing factor PRP46	7.24e-10	7.81e-06	2.85e-08
1. PB	B6HP56	Nuclear distribution protein nudF 1	2.31e-14	5.71e-04	8.99e-16
1. PB	Q8VE80	THO complex subunit 3	9.77e-15	9.81e-07	5.39e-10
1. PB	A0A2R8RWN9	F-box and WD repeat domain-containing 11-B	1.10e-13	2.60e-02	1.57e-16
1. PB	Q29RH4	THO complex subunit 3	6.51e-14	1.50e-04	1.48e-09
1. PB	Q9NV06	DDB1- and CUL4-associated factor 13	6.30e-13	7.72e-07	0.001
1. PB	Q6CKE8	Pre-mRNA-splicing factor PRP46	3.05e-13	2.13e-08	1.90e-07
1. PB	Q12417	Pre-mRNA-splicing factor PRP46	1.24e-09	6.35e-06	1.72e-06
1. PB	Q4R304	Histone-binding protein RBBP7	5.44e-15	3.63e-02	9.75e-07
1. PB	Q8VC51	Telomerase Cajal body protein 1	9.11e-07	4.43e-06	1.26e-05
1. PB	Q42384	Protein pleiotropic regulatory locus 1	1.86e-10	3.25e-02	1.49e-11
1. PB	A0DB19	Lissencephaly-1 homolog 1	0.00e+00	6.21e-04	3.42e-20
1. PB	O48716	Protein JINGUBANG	2.45e-08	2.00e-02	1.87e-06
1. PB	O54929	WD repeat and SOCS box-containing protein 2	1.72e-10	1.16e-05	1.07e-12
1. PB	D4DG66	Nuclear distribution protein PAC1	4.90e-14	7.48e-04	3.30e-15
1. PB	Q8VZY6	Polycomb group protein FIE2	4.24e-10	1.83e-03	0.003
1. PB	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	4.00e-12	1.60e-06	1.28e-24
1. PB	Q5R9T6	WD repeat-containing protein 55	6.66e-13	3.46e-05	6.31e-04
1. PB	Q09150	Meiotic recombination protein rec14	0.00e+00	1.09e-02	3.78e-10
1. PB	Q13685	Angio-associated migratory cell protein	1.71e-08	2.51e-02	4.64e-05
1. PB	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	5.66e-15	2.65e-07	1.89e-28
1. PB	Q8W1K8	Protein Mut11	0.00e+00	4.87e-02	3.66e-20
1. PB	Q3E906	Cell division cycle 20.5, cofactor of APC complex	3.26e-09	5.75e-05	1.08e-09
1. PB	O54927	WD repeat and SOCS box-containing protein 1	1.54e-11	3.73e-07	1.53e-13
1. PB	P69104	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.30e-02	3.40e-14
1. PB	Q9D7H2	WD repeat-containing protein 5B	1.02e-13	1.04e-03	4.06e-27
1. PB	Q5R7H5	DDB1- and CUL4-associated factor 11	2.67e-07	8.07e-09	0.008
1. PB	Q8VEJ4	Notchless protein homolog 1	1.59e-09	1.33e-02	6.78e-16
1. PB	C5FWH1	Nuclear distribution protein PAC1	8.94e-14	2.69e-04	1.62e-15
1. PB	Q60525	Telomerase Cajal body protein 1	1.87e-07	7.82e-05	1.04e-06
1. PB	P54311	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.22e-15	6.78e-05	4.82e-13
1. PB	Q5R5W8	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.33e-15	1.45e-04	1.52e-13
1. PB	Q4WEI5	Histone acetyltransferase type B subunit 2	6.66e-16	4.09e-04	3.89e-09
1. PB	O16519	Gastrulation defective protein 1	1.21e-07	1.12e-03	4.65e-08
1. PB	B8P4B0	Nuclear distribution protein PAC1-1	6.66e-16	1.86e-02	9.56e-19
1. PB	P90917	Probable histone-binding protein rba-1	4.44e-16	1.08e-04	6.80e-05
1. PB	Q9NVX2	Notchless protein homolog 1	1.51e-09	3.05e-02	1.58e-16
1. PB	Q6P1V3	WD repeat and SOCS box-containing protein 1	2.80e-09	3.72e-06	9.10e-13
1. PB	Q6CU55	Nuclear distribution protein PAC1	2.98e-11	1.01e-04	5.40e-08
1. PB	Q13216	DNA excision repair protein ERCC-8	2.36e-13	1.66e-04	3.24e-08
1. PB	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	1.61e-12	1.05e-06	7.75e-28
1. PB	Q2UA71	Histone acetyltransferase type B subunit 2	0.00e+00	2.59e-05	5.32e-08
1. PB	O22467	Histone-binding protein MSI1	2.22e-16	8.19e-03	0.015
1. PB	P90916	Probable histone-binding protein lin-53	1.89e-15	5.72e-03	4.09e-06
1. PB	C5GVJ9	Nuclear distribution protein PAC1	3.71e-09	4.36e-04	4.10e-17
1. PB	Q9Y4P3	Transducin beta-like protein 2	7.63e-09	1.22e-07	1.49e-07
1. PB	Q6CGP9	Polyadenylation factor subunit 2	8.14e-09	5.06e-07	1.03e-08
1. PB	O18640	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.77e-02	8.51e-17
1. PB	C4JPW9	Nuclear distribution protein PAC1-2	0.00e+00	1.52e-07	5.33e-17
1. PB	Q0P593	Dynein assembly factor with WDR repeat domains 1	3.78e-11	2.35e-02	9.57e-33
1. PB	Q71UF4	Histone-binding protein RBBP7	1.78e-15	3.63e-02	9.75e-07
1. PB	Q7ZTY4	Histone-binding protein RBBP7	2.33e-15	1.58e-03	4.19e-05
1. PB	Q9SZA4	Cell division cycle 20.1, cofactor of APC complex	1.04e-08	8.37e-04	1.74e-11
1. PB	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	1.11e-16	4.36e-02	9.43e-05
1. PB	Q1JQD2	Glutamate-rich WD repeat-containing protein 1	5.06e-10	7.02e-03	2.92e-07
1. PB	O93377	Histone-binding protein RBBP4-A	3.11e-15	1.14e-02	4.94e-05
1. PB	Q5XII5	Telomerase Cajal body protein 1	1.51e-07	1.60e-05	6.53e-06
1. PB	Q9W5Z5	WD repeat and SOCS box-containing protein 1	2.09e-11	3.40e-03	1.86e-15
1. PB	Q9R099	Transducin beta-like protein 2	5.05e-09	7.48e-08	6.89e-08
1. PB	A1CF18	Nuclear distribution protein nudF 2	0.00e+00	1.12e-07	5.20e-17
1. PB	Q8N7N5	DDB1- and CUL4-associated factor 8	7.78e-09	2.11e-03	0.045
1. PB	Q08706	Guanine nucleotide-binding protein subunit beta	2.11e-15	1.85e-03	2.06e-09
1. PB	Q6BU94	Pre-mRNA-splicing factor PRP46	2.41e-10	4.82e-07	7.26e-11
1. PB	Q09028	Histone-binding protein RBBP4	0.00e+00	1.95e-02	3.13e-05
1. PB	Q5M786	WD repeat-containing protein 5	0.00e+00	2.29e-04	6.23e-26
1. PB	Q92466	DNA damage-binding protein 2	1.08e-08	3.17e-03	0.008
1. PB	Q54KL5	WD repeat-containing protein 5 homolog	6.66e-16	8.93e-03	9.07e-29
1. PB	Q6NWH1	DDB1- and CUL4-associated factor 10	1.70e-07	9.28e-03	0.010
1. PB	Q6BK34	Histone acetyltransferase type B subunit 2	6.05e-12	3.17e-03	0.010
1. PB	Q61Y48	Probable histone-binding protein lin-53	0.00e+00	8.19e-03	5.22e-05
1. PB	O24467	LEC14B homolog	4.05e-10	1.05e-03	9.50e-10
1. PB	P62872	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.44e-15	6.78e-05	4.82e-13
1. PB	Q58D20	Notchless protein homolog 1	2.87e-09	1.89e-02	7.25e-16
1. PB	Q5R654	Histone-binding protein RBBP7	6.11e-15	1.01e-02	6.61e-05
1. PB	Q6P3H7	Histone-binding protein RBBP4	2.66e-15	1.51e-02	7.01e-05
1. PB	Q2HBX6	Nuclear distribution protein PAC1-1	4.05e-14	6.02e-04	8.52e-16
1. PB	Q12834	Cell division cycle protein 20 homolog	4.39e-08	2.00e-02	2.00e-09
1. PB	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.37e-02	7.24e-19
1. PB	P49177	Guanine nucleotide-binding protein subunit beta	1.49e-14	8.85e-03	2.20e-11
1. PB	Q9FLX9	Notchless protein homolog	1.06e-08	1.02e-03	1.28e-17
1. PB	Q8R537	Peroxisomal targeting signal 2 receptor	0.00e+00	1.44e-02	3.52e-07
1. PB	O94394	Uncharacterized WD repeat-containing protein C126.01c	2.88e-13	4.02e-07	2.00e-05
1. PB	Q93847	WD repeat-containing protein wdr-5.2	3.39e-12	2.47e-06	1.42e-24
1. PB	Q5U2M6	DDB1- and CUL4-associated factor 8	3.11e-08	1.05e-03	0.043
1. PB	Q40153	LEC14B protein	5.17e-10	2.89e-07	7.90e-07
1. PB	P83774	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	4.94e-03	1.34e-11
1. PB	P26308	Guanine nucleotide-binding protein subunit beta-1	2.22e-15	6.27e-04	3.76e-12
1. PB	O94620	Pre-mRNA-splicing factor cwf17	4.77e-15	1.11e-06	7.62e-11
1. PB	Q9NDC9	Lissencephaly-1 homolog	0.00e+00	1.45e-03	1.13e-19
1. PB	Q1LV15	Dynein assembly factor with WDR repeat domains 1	2.11e-11	6.74e-04	5.03e-28
1. PB	Q4V7A0	WD repeat-containing protein 61	0.00e+00	2.24e-02	2.11e-12
1. PB	Q59WJ4	Polyadenylation factor subunit 2	2.77e-09	2.20e-07	7.73e-06
1. PB	Q6FXI8	Histone acetyltransferase type B subunit 2	3.64e-12	8.93e-03	1.16e-07
1. PB	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.11e-15	2.27e-04	1.80e-11
1. PB	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	2.24e-14	1.12e-03	5.69e-09
1. PB	Q5H7C0	Cell division cycle protein 20 homolog	3.74e-08	1.74e-02	3.90e-09
1. PB	Q7RY30	Nuclear distribution protein nudF-2	3.85e-14	1.83e-03	5.88e-17
1. PB	Q86VZ2	WD repeat-containing protein 5B	1.83e-10	4.14e-04	4.28e-25
1. PB	P90794	DDB1- and CUL4-associated factor 11 homolog	1.28e-07	5.06e-07	1.12e-04
1. PB	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	1.23e-14	1.41e-03	3.69e-09
1. PB	A9V790	Lissencephaly-1 homolog	0.00e+00	7.99e-05	1.01e-22
1. PB	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	1.41e-11	1.78e-03	3.38e-27
1. PB	P62874	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.44e-15	6.78e-05	4.82e-13
1. PB	C5JD40	Nuclear distribution protein PAC1	4.90e-09	4.36e-04	4.10e-17
1. PB	Q9LTJ6	WD repeat-containing protein RUP1	5.99e-09	1.50e-04	0.004
1. PB	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.33e-15	3.39e-04	3.49e-11
1. PB	Q62623	Cell division cycle protein 20 homolog	3.89e-08	4.32e-02	1.17e-09
1. PB	Q5RCG7	Angio-associated migratory cell protein	2.43e-08	2.10e-02	5.15e-05
1. PB	A1DP19	Nuclear distribution protein nudF	1.24e-14	1.91e-06	4.26e-15
1. PB	Q4WT34	Pre-mRNA-splicing factor prp46	2.35e-12	1.73e-05	6.07e-12
1. PB	Q20636	Guanine nucleotide-binding protein subunit beta-2	6.54e-11	5.72e-06	7.05e-08
1. PB	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	3.12e-09	2.07e-07	4.28e-28
1. PB	D1ZEM6	Nuclear distribution protein PAC1-2	2.24e-08	1.18e-02	7.11e-17
1. PB	Q9UTN4	Polyadenylation factor subunit 2	4.94e-09	1.81e-02	2.94e-07
1. PB	Q5BK30	Dynein assembly factor with WDR repeat domains 1	3.93e-11	8.37e-04	8.49e-32
1. PB	Q9H6Y2	WD repeat-containing protein 55	3.30e-11	2.65e-05	3.41e-04
1. PB	O22469	WD-40 repeat-containing protein MSI3	3.33e-16	2.72e-04	0.003
1. PB	Q6GPP0	WD repeat-containing protein 70	2.12e-07	1.87e-03	1.19e-05
1. PB	P23232	Guanine nucleotide-binding protein subunit beta	1.78e-15	1.53e-04	3.48e-10
1. PB	C6HTE8	Nuclear distribution protein PAC1	8.33e-15	9.93e-03	1.85e-20
1. PB	Q7S7L4	Nuclear distribution protein nudF-1	5.85e-09	2.47e-03	3.80e-18
1. PB	P61964	WD repeat-containing protein 5	0.00e+00	1.76e-04	1.84e-27
1. PB	P36408	Guanine nucleotide-binding protein subunit beta	6.66e-16	1.45e-07	2.01e-14
1. PB	Q5A7Q3	Pre-mRNA-splicing factor PRP46	5.65e-10	1.93e-06	1.36e-11
1. PB	Q9SU78	WD-40 repeat-containing protein MSI5	1.11e-09	1.81e-02	0.002
1. PB	P0CS42	Nuclear distribution protein PAC1	4.44e-16	5.37e-04	2.95e-20
1. PB	Q9JHB4	WD repeat-containing protein 31	5.87e-13	1.42e-06	2.07e-05
1. PB	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	1.06e-04	5.95e-13
1. PB	G0SC29	Ribosome assembly protein 4	9.19e-08	4.13e-02	1.07e-18
1. PB	Q54S59	WD repeat-containing protein 61 homolog	0.00e+00	3.02e-03	1.28e-06
1. PB	Q9DAJ4	WD repeat domain-containing protein 83	2.22e-16	1.93e-02	3.25e-11
1. PB	Q9Y1C1	77 kDa echinoderm microtubule-associated protein (Fragment)	7.29e-06	9.28e-03	0.001
1. PB	Q32P44	Echinoderm microtubule-associated protein-like 3	1.20e-04	2.47e-03	0.001
1. PB	P17343	Guanine nucleotide-binding protein subunit beta-1	2.55e-15	6.34e-04	4.67e-11
1. PB	Q39190	Protein pleiotropic regulator PRL2	9.04e-11	6.25e-03	1.36e-10
1. PB	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	2.26e-03	1.12e-16
1. PB	P61965	WD repeat-containing protein 5	0.00e+00	1.76e-04	1.84e-27
1. PB	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	4.41e-11	8.27e-03	5.23e-31
1. PB	Q8I0F4	Lissencephaly-1 homolog	0.00e+00	5.83e-04	3.48e-21
1. PB	B0XM00	Nuclear distribution protein nudF	5.08e-14	2.09e-03	1.42e-15
1. PB	Q96J01	THO complex subunit 3	3.66e-15	6.20e-06	1.55e-09
1. PB	P73594	WD repeat-containing protein slr1409	7.02e-10	3.80e-04	1.15e-11
1. PB	P29829	Guanine nucleotide-binding protein subunit beta-2	1.11e-16	8.06e-08	2.12e-17
1. PB	Q3TWF6	WD repeat-containing protein 70	4.95e-06	1.91e-03	0.042
1. PB	Q9S7I8	Cell division cycle 20.2, cofactor of APC complex	1.02e-08	2.29e-04	2.37e-11
1. PB	Q6FJS0	Polyadenylation factor subunit 2	1.24e-09	5.85e-06	1.39e-07
1. PB	Q0V8J1	WD repeat and SOCS box-containing protein 2	2.39e-11	1.08e-04	5.38e-12
1. PB	B7FNU7	Lissencephaly-1 homolog	3.33e-16	4.24e-02	4.26e-15
1. PB	C0S902	Nuclear distribution protein PAC1	4.35e-09	1.15e-05	4.99e-18
1. PB	Q8N136	Dynein assembly factor with WDR repeat domains 1	4.15e-11	2.46e-02	2.40e-34
1. PB	Q6BVZ3	Polyadenylation factor subunit 2	5.53e-10	1.05e-06	7.91e-08
1. PB	B6QC56	Nuclear distribution protein nudF 1	4.22e-15	1.31e-04	8.07e-18
1. PB	Q9W7I5	Histone-binding protein RBBP4	3.11e-15	3.22e-02	3.61e-05
1. PB	Q58DT8	WD repeat-containing protein 55	2.59e-11	5.90e-04	6.94e-04
1. PB	P0CS43	Nuclear distribution protein PAC1	8.88e-16	5.37e-04	2.95e-20
1. PB	A8XZJ9	Lissencephaly-1 homolog	0.00e+00	1.40e-02	1.23e-18
1. PB	A8XEN7	DDB1- and CUL4-associated factor 11 homolog	2.72e-07	4.18e-08	2.68e-06
1. PB	B6GZD3	Nuclear distribution protein nudF 2	9.51e-13	7.09e-03	6.14e-17
1. PB	Q5GIS3	Guanine nucleotide-binding protein subunit beta	0.00e+00	4.42e-05	1.39e-11
1. PB	D3BUN1	Lissencephaly-1 homolog	1.11e-16	5.40e-03	4.74e-19
1. PB	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	2.55e-15	6.34e-04	4.67e-11
1. PB	Q4ICM0	Nuclear distribution protein PAC1	3.12e-14	1.02e-02	1.56e-16
1. PB	Q0D0X6	Nuclear distribution protein nudF	2.49e-14	1.20e-02	1.77e-15
1. PB	A2AKB9	DDB1- and CUL4-associated factor 10	5.37e-07	2.68e-03	7.83e-04
1. PB	B2AEZ5	Nuclear distribution protein PAC1-1	1.08e-13	6.69e-03	3.48e-16
1. PB	P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.33e-15	6.78e-05	4.82e-13
1. PB	A7EKM8	Nuclear distribution protein PAC1	5.61e-11	2.17e-06	7.98e-19
1. PB	Q8CFD5	DNA excision repair protein ERCC-8	4.52e-12	2.13e-04	9.29e-09
1. PB	Q5RFF8	Notchless protein homolog 1	3.98e-09	3.73e-02	1.74e-16
1. PB	P46800	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.41e-02	5.76e-16
1. PB	O35353	Guanine nucleotide-binding protein subunit beta-4	2.44e-15	3.18e-04	2.81e-12
1. PB	Q6LA54	Uncharacterized WD repeat-containing protein C3H5.08c	2.93e-04	3.08e-03	0.002
1. PB	Q4I7L0	Histone acetyltransferase type B subunit 2	4.55e-15	1.03e-04	4.69e-10
1. PB	Q6INH0	Histone-binding protein RBBP4-B	4.66e-15	3.60e-02	4.65e-05
1. PB	O14775	Guanine nucleotide-binding protein subunit beta-5	4.66e-15	9.61e-05	4.65e-09
1. PB	Q60973	Histone-binding protein RBBP7	4.44e-15	4.40e-02	9.84e-07
1. PB	Q5BLX8	WD repeat domain-containing protein 83	1.11e-16	1.19e-02	2.28e-11
1. PB	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	1.41e-12	1.22e-07	2.28e-28
1. PB	O60136	Uncharacterized WD repeat-containing protein C18H10.05	9.92e-08	4.31e-03	1.04e-05
1. PB	P62871	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.44e-15	6.78e-05	4.82e-13
1. PB	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	6.42e-11	7.96e-08	6.85e-28
1. PB	Q7ZYQ6	DDB1- and CUL4-associated factor 13	1.37e-14	1.67e-08	2.65e-05
1. PB	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	9.33e-15	3.54e-03	5.95e-09
1. PB	Q3MHL3	Histone-binding protein RBBP4	4.22e-15	1.95e-02	3.13e-05
1. PB	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	3.47e-02	2.64e-16
1. PB	Q5XGI5	WD repeat domain-containing protein 83	3.33e-16	2.60e-03	2.04e-12
1. PB	Q2KIG2	WD repeat-containing protein 5	0.00e+00	2.58e-04	1.88e-27
1. PB	Q9CX97	WD repeat-containing protein 55	1.68e-11	1.36e-05	3.82e-05
1. PB	Q09990	F-box/WD repeat-containing protein lin-23	4.22e-10	5.34e-03	1.05e-19
1. PB	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.22e-15	1.46e-04	6.07e-14
1. PB	A1L112	WD repeat-containing protein 55	8.15e-14	1.13e-05	4.85e-05
1. PB	Q9LV28	Receptor for activated C kinase 1C	0.00e+00	3.77e-02	3.88e-19
1. PB	O43017	Set1 complex component swd3	5.06e-12	2.04e-04	3.50e-14
1. PB	Q9BRX9	WD repeat domain-containing protein 83	4.44e-16	2.33e-03	4.24e-11
1. PB	B2ZZS9	WD repeat-containing protein 55	5.86e-08	2.65e-06	7.19e-07
1. PB	O43818	U3 small nucleolar RNA-interacting protein 2	1.16e-11	3.77e-02	9.72e-12
1. PB	B8M0Q1	Nuclear distribution protein nudF	2.89e-15	3.32e-04	2.21e-17
1. PB	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.58e-03	3.18e-15
1. PB	Q60972	Histone-binding protein RBBP4	5.88e-15	1.95e-02	3.13e-05
1. PB	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	0.00e+00	5.31e-04	1.22e-14
1. PB	Q9I8G9	Histone-binding protein RBBP7	2.00e-15	2.04e-02	3.25e-06
1. PB	C1GB49	Nuclear distribution protein PAC1	7.53e-09	2.17e-05	3.76e-18
1. PB	O74340	Protein sof1	5.19e-12	5.10e-05	7.29e-14
1. PB	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	5.07e-06	2.52e-04	0.038
1. PB	Q39221	SEC12-like protein 2	9.66e-13	9.37e-03	0.020
1. PB	C5PFX0	Nuclear distribution protein PAC1	6.66e-08	7.82e-05	1.31e-13
1. PB	O14435	Guanine nucleotide-binding protein subunit beta	3.46e-11	9.70e-06	1.55e-08
1. PB	Q7KWL3	DDB1- and CUL4-associated factor 13	8.50e-13	9.14e-08	1.12e-10
1. PB	P53196	26S proteasome regulatory subunit RPN14	1.23e-09	2.90e-03	5.00e-05
1. PB	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	2.28e-14	2.35e-03	5.95e-09
1. PB	O43660	Pleiotropic regulator 1	1.86e-08	2.96e-02	5.73e-09
1. PB	Q4P9P9	Nuclear distribution protein PAC1	0.00e+00	3.91e-03	3.22e-23
1. PB	P25387	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.45e-03	2.33e-17
1. PB	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.11e-15	5.26e-04	2.54e-12
1. PB	Q8NA23	WD repeat-containing protein 31	2.21e-13	1.33e-07	3.16e-05
1. PB	B3MJV8	Ribosome biogenesis protein WDR12 homolog	5.31e-11	3.84e-02	4.93e-12
1. PB	Q8VC03	Echinoderm microtubule-associated protein-like 3	2.06e-04	3.27e-03	7.91e-04
1. PB	Q5TAQ9	DDB1- and CUL4-associated factor 8	3.44e-08	1.19e-02	0.043
1. PB	Q2UGU1	Nuclear distribution protein nudF	1.33e-14	6.49e-05	2.94e-19
1. PB	Q6P5M2	WD repeat-containing protein 61	0.00e+00	8.68e-03	3.14e-19
1. PB	Q7S7N3	Histone acetyltransferase type B subunit 2	7.67e-11	4.05e-04	1.31e-08
1. PB	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	0.00e+00	2.99e-04	2.60e-25
1. PB	Q803X4	DDB1- and CUL4-associated factor 13	1.30e-14	3.39e-07	7.78e-08
1. PB	O13615	Pre-mRNA-splicing factor prp5	5.02e-13	5.66e-04	5.87e-09
1. PB	Q5RF92	Histone-binding protein RBBP4	4.00e-15	1.16e-02	3.33e-05
1. PB	Q26613	77 kDa echinoderm microtubule-associated protein	3.04e-06	3.40e-02	9.00e-05
1. PB	Q16576	Histone-binding protein RBBP7	2.78e-15	3.63e-02	9.75e-07
1. PB	P42841	Polyadenylation factor subunit 2	3.16e-10	8.34e-05	8.68e-08
1. PB	D4AZ50	Nuclear distribution protein PAC1	5.23e-14	7.48e-04	3.30e-15
1. PB	Q3KQ62	WD repeat domain-containing protein 83	2.22e-16	1.59e-03	6.02e-09
1. PB	B8N9H4	Nuclear distribution protein nudF	0.00e+00	6.49e-05	2.94e-19
1. PB	Q5JTN6	WD repeat-containing protein 38	0.00e+00	8.51e-03	5.99e-28
1. PB	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.11e-15	1.46e-04	6.07e-14
1. PB	Q6CP71	Polyadenylation factor subunit 2	5.40e-09	1.37e-06	1.08e-06
1. PB	Q5E9I8	DDB1- and CUL4-associated factor 11	1.57e-07	3.82e-09	0.007
1. PB	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	1.28e-02	1.85e-15
1. PB	Q9Y6I7	WD repeat and SOCS box-containing protein 1	1.59e-11	1.85e-05	1.18e-14
1. PB	A1CUD6	Nuclear distribution protein nudF 1	4.73e-14	8.64e-04	8.43e-15
1. PB	P74598	Uncharacterized WD repeat-containing protein sll1491	2.44e-10	2.68e-02	1.27e-13
1. PB	Q5R448	DDB1- and CUL4-associated factor 8	9.51e-07	9.83e-03	0.033
1. PB	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.33e-15	6.49e-05	8.21e-14
1. PB	Q5RE95	WD repeat-containing protein 5B	2.42e-11	8.64e-04	9.49e-26
1. PB	O00628	Peroxisomal targeting signal 2 receptor	0.00e+00	1.37e-03	3.95e-06
1. PB	Q4V8C4	WD repeat-containing protein 5B	1.12e-13	3.28e-05	3.76e-26
1. PB	P97865	Peroxisomal targeting signal 2 receptor	0.00e+00	3.08e-03	1.91e-06
1. PB	P33750	Protein SOF1	1.07e-12	1.23e-05	2.05e-06
1. PB	Q9VPR4	Protein Notchless	3.34e-08	1.02e-03	3.15e-13
1. PB	P29387	Guanine nucleotide-binding protein subunit beta-4	2.55e-15	2.86e-04	2.78e-12
1. PB	Q54SD4	Probable histone-binding protein rbbD	0.00e+00	2.03e-03	1.59e-07
1. PB	P69103	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.30e-02	3.40e-14
1. PB	Q3SWZ7	Telomerase Cajal body protein 1	1.83e-06	1.45e-03	2.42e-06
1. PB	Q5BIM8	DNA excision repair protein ERCC-8	5.81e-12	2.32e-04	2.75e-07
1. PB	Q4PSE4	Cell division cycle 20.4, cofactor of APC complex	4.63e-10	1.27e-03	1.49e-07
1. PB	Q6C709	Pre-mRNA-splicing factor PRP46	1.46e-10	2.07e-03	6.86e-14
1. PB	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.11e-15	2.96e-04	2.94e-12
1. PB	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.22e-15	1.46e-04	6.07e-14
1. PB	Q91VU6	DDB1- and CUL4-associated factor 11	2.97e-07	7.76e-09	0.008
1. PB	Q00664	Nuclear distribution protein nudF	1.78e-14	6.74e-04	1.26e-17
1. PB	Q0VA16	WD repeat-containing protein 70	2.27e-05	1.74e-03	9.17e-06
1. PB	Q7YR70	Angio-associated migratory cell protein	3.10e-08	3.47e-02	1.88e-04
1. PB	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.00e-15	3.50e-04	1.74e-11
2. P	P0DOC0	Protein cortex	7.37e-08	4.22e-04	NA
2. P	Q99J79	DNA damage-binding protein 2	1.14e-06	9.00e-04	NA
2. P	Q0VBY8	DNA damage-binding protein 2	1.53e-08	1.50e-03	NA
2. P	Q8VZY7	Polycomb group protein FIE1	3.35e-08	3.50e-03	NA
2. P	Q32LB0	WD repeat-containing protein 70	2.63e-06	4.35e-03	NA
2. P	Q93VB2	Autophagy-related protein 18a	6.32e-07	1.72e-02	NA
2. P	O74763	Uncharacterized WD repeat-containing protein C17D11.08	1.28e-09	7.29e-03	NA
2. P	Q2UM42	Probable catabolite repression protein creC	2.30e-04	6.80e-06	NA
2. P	Q10G81	Histone-binding protein MSI1 homolog	3.11e-15	1.26e-02	NA
2. P	Q8BGW4	DDB1- and CUL4-associated factor 12-like protein 2	1.53e-06	4.31e-03	NA
2. P	O15213	WD repeat-containing protein 46	2.12e-07	5.09e-03	NA
2. P	Q28DT7	Polycomb protein eed	3.87e-08	3.40e-03	NA
2. P	P0DOB8	Protein cortex	2.70e-06	5.95e-05	NA
2. P	Q2YDS1	DNA damage-binding protein 2	9.87e-07	4.06e-03	NA
2. P	Q6ZJX0	Polycomb group protein FIE1	7.63e-12	1.48e-02	NA
2. P	Q5EB92	WD repeat-containing protein 70	8.37e-07	1.15e-03	NA
2. P	Q8UUP2	Polycomb protein eed-A	6.27e-09	8.12e-04	NA
2. P	Q9P4R5	Catabolite repression protein creC	7.04e-06	1.06e-02	NA
2. P	Q5ZKH3	Polycomb protein EED	9.96e-10	9.02e-03	NA
2. P	P40077	Protein DSE1	3.00e-05	3.73e-02	NA
2. P	Q3UMY5	Echinoderm microtubule-associated protein-like 4	7.76e-05	1.87e-03	NA
2. P	Q3SZ25	Polycomb protein EED	6.18e-09	2.75e-02	NA
2. P	P39984	Histone acetyltransferase type B subunit 2	1.13e-11	2.90e-03	NA
2. P	Q66JG1	DNA damage-binding protein 2	1.94e-07	1.09e-02	NA
2. P	Q59RH5	Histone acetyltransferase type B subunit 2	5.67e-13	4.27e-03	NA
2. P	Q4WN25	Probable catabolite repression protein creC	8.33e-05	1.32e-05	NA
2. P	Q9W351	Aladin	2.23e-12	4.27e-04	NA
2. P	Q6AZS2	Polycomb protein eed-B	1.57e-09	1.30e-03	NA
2. P	Q8N3Y1	F-box/WD repeat-containing protein 8	1.07e-05	4.31e-03	NA
2. P	A1DMI8	Probable catabolite repression protein creC	8.74e-05	8.82e-04	NA
2. P	B0Y7H6	Probable catabolite repression protein creC	1.00e-04	1.32e-05	NA
2. P	Q6CNC8	Protein DSE1	1.06e-05	2.50e-04	NA
2. P	O75530	Polycomb protein EED	5.06e-10	1.54e-02	NA
2. P	Q10990	Cell division cycle protein cdt2	3.80e-08	1.64e-02	NA
2. P	Q5VU92	DDB1- and CUL4-associated factor 12-like protein 1	2.27e-06	4.14e-03	NA
2. P	A6NGE4	DDB1- and CUL4-associated factor 8-like protein 1	1.67e-06	2.74e-04	NA
2. P	Q5M9G8	DDB1- and CUL4-associated factor 11	2.03e-07	2.43e-09	NA
2. P	P0DOB9	Protein cortex	8.95e-08	2.93e-03	NA
2. P	Q12206	Transcriptional modulator WTM2	2.35e-06	1.35e-02	NA
2. P	P32330	2-deoxy-glucose resistant protein 2	1.54e-04	8.29e-04	NA
2. P	P42000	U3 small nucleolar RNA-associated protein 18 homolog	5.78e-09	2.71e-05	NA
2. P	Q12363	Transcriptional modulator WTM1	3.15e-09	2.26e-03	NA
2. P	Q8NA75	DDB1- and CUL4-associated factor 4-like protein 2	1.50e-14	2.65e-02	NA
2. P	Q8GWR1	Aladin	1.56e-07	2.27e-04	NA
2. P	Q75AI1	Protein DSE1	1.13e-06	1.58e-04	NA
2. P	Q6ZJW8	Polycomb group protein FIE1	1.66e-09	1.47e-03	NA
2. P	Q5TJE7	WD repeat-containing protein 46	9.29e-06	2.99e-04	NA
2. P	Q28I90	DDB1- and CUL4-associated factor 8	1.12e-07	2.80e-02	NA
2. P	Q9Z0H1	WD repeat-containing protein 46	4.49e-07	1.45e-03	NA
2. P	Q6NRH1	DDB1- and CUL4-associated factor 8	1.10e-08	7.37e-03	NA
2. P	Q9FFA7	WD repeat-containing protein RUP2	2.27e-08	2.18e-02	NA
2. P	B8N4F5	Probable catabolite repression protein creC	4.37e-05	6.80e-06	NA
2. P	Q0CKB1	Probable catabolite repression protein creC	1.49e-05	4.74e-02	NA
2. P	Q6NVS5	DDB1- and CUL4-associated factor 13	1.41e-14	1.47e-08	NA
2. P	Q75C99	Histone acetyltransferase type B subunit 2	6.52e-10	1.01e-03	NA
2. P	Q9NW82	WD repeat-containing protein 70	1.90e-07	3.43e-02	NA
2. P	Q9HC35	Echinoderm microtubule-associated protein-like 4	4.67e-05	1.25e-02	NA
2. P	Q38960	WD repeat-containing protein LWD2	0.00e+00	2.46e-02	NA
2. P	Q5ZLK1	DDB1- and CUL4-associated factor 13	6.10e-13	2.15e-06	NA
2. P	Q9UKN8	General transcription factor 3C polypeptide 4	2.47e-03	3.80e-02	NA
2. P	Q9DAM1	Leucine-rich repeat-containing protein 34	9.88e-01	1.60e-02	NA
2. P	P53851	Protein TEX1	3.57e-08	1.20e-03	NA
2. P	Q8GYE0	SEC12-like protein 1	3.22e-15	3.54e-05	NA
2. P	Q2TAF3	Echinoderm microtubule-associated protein-like 4	3.28e-04	5.40e-06	NA
2. P	Q6DIP5	Echinoderm microtubule-associated protein-like 4	8.45e-05	8.53e-05	NA
2. P	Q566T0	Polycomb protein eed	6.13e-10	1.50e-03	NA
2. P	Q921E6	Polycomb protein EED	3.25e-10	1.54e-02	NA
2. P	A2QVV2	Probable catabolite repression protein creC	1.52e-04	1.40e-02	NA
2. P	A1CTE6	Probable catabolite repression protein creC	3.03e-05	6.65e-06	NA
3. B	Q9D994	WD repeat-containing protein 38	0.00e+00	NA	7.84e-27
3. B	B4KGX9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.17e-05
3. B	Q09406	Autophagic-related protein 16.2	2.79e-08	NA	0.005
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	1.69e-05	NA	6.96e-35
3. B	Q5R664	Coatomer subunit beta'	6.32e-07	NA	1.11e-09
3. B	Q8AVS9	DDB1- and CUL4-associated factor 10	3.83e-08	NA	0.001
3. B	B4JWA1	Lissencephaly-1 homolog	0.00e+00	NA	5.97e-20
3. B	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	9.94e-05
3. B	Q29HG9	Protein LST8 homolog	1.11e-16	NA	3.37e-18
3. B	A2R3Z3	Mitochondrial division protein 1	9.34e-09	NA	9.65e-07
3. B	Q05048	Cleavage stimulation factor subunit 1	1.36e-12	NA	5.37e-10
3. B	O00423	Echinoderm microtubule-associated protein-like 1	8.82e-06	NA	0.028
3. B	Q8SRK1	Histone acetyltransferase type B subunit 2	0.00e+00	NA	1.94e-05
3. B	O43172	U4/U6 small nuclear ribonucleoprotein Prp4	9.09e-11	NA	9.68e-15
3. B	P87177	Uncharacterized WD repeat-containing protein C3D6.12	1.63e-06	NA	6.02e-13
3. B	A8XL02	Ribosome biogenesis protein WDR12 homolog	2.07e-08	NA	2.09e-05
3. B	Q8BFQ4	WD repeat-containing protein 82	0.00e+00	NA	1.70e-05
3. B	P53197	APC/C activator protein CDH1	9.03e-07	NA	1.45e-05
3. B	B3NPW0	Lissencephaly-1 homolog	0.00e+00	NA	4.04e-20
3. B	Q6P0D9	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	5.26e-07
3. B	Q1DIW7	Mitochondrial division protein 1	3.28e-07	NA	8.91e-05
3. B	Q04305	U3 small nucleolar RNA-associated protein 15	6.72e-09	NA	0.026
3. B	Q9ULI1	NACHT and WD repeat domain-containing protein 2	3.37e-03	NA	0.029
3. B	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	6.78e-05
3. B	P35606	Coatomer subunit beta'	8.33e-07	NA	1.03e-09
3. B	B4MY77	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	7.22e-07
3. B	P0CS30	Probable cytosolic iron-sulfur protein assembly protein 1	1.22e-15	NA	6.12e-04
3. B	Q92636	Protein FAN	5.30e-07	NA	1.54e-10
3. B	Q6CEW7	Ribosome biogenesis protein YTM1	2.58e-07	NA	6.74e-04
3. B	Q12788	Transducin beta-like protein 3	3.03e-08	NA	3.27e-11
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.60e-09	NA	1.37e-18
3. B	B8PD53	Nuclear distribution protein PAC1-2	NA	NA	1.33e-19
3. B	Q86HX1	Protein HIRA	1.77e-06	NA	6.46e-09
3. B	Q8MYE8	Probable proteasomal ATPase-associated factor 1	2.45e-11	NA	5.79e-04
3. B	Q32LN7	WD repeat-containing protein 61	0.00e+00	NA	8.60e-13
3. B	P41318	Target of rapamycin complex subunit LST8	0.00e+00	NA	3.22e-15
3. B	Q6BZX5	Protein transport protein SEC13	2.44e-15	NA	1.85e-04
3. B	Q149M9	NACHT domain- and WD repeat-containing protein 1	1.00e-03	NA	0.004
3. B	Q6NZH4	Lissencephaly-1 homolog	0.00e+00	NA	5.20e-19
3. B	A8WVX8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.55e-05
3. B	Q8SQS4	Transcription initiation factor TFIID subunit 5	2.70e-08	NA	2.34e-05
3. B	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	7.75e-20
3. B	P49846	Transcription initiation factor TFIID subunit 5	1.71e-08	NA	2.68e-15
3. B	Q5FW06	DDB1- and CUL4-associated factor 10	2.32e-07	NA	0.001
3. B	Q9R1K5	Fizzy-related protein homolog	1.70e-07	NA	1.13e-06
3. B	A2QP30	Nuclear distribution protein nudF	0.00e+00	NA	1.59e-15
3. B	Q4I7X1	Polyadenylation factor subunit 2	2.08e-09	NA	4.87e-06
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	1.54e-08	NA	2.18e-35
3. B	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	1.34e-19
3. B	B9WN49	Restriction of telomere capping protein 1	8.31e-04	NA	0.009
3. B	Q9P775	Uncharacterized WD repeat-containing protein C17D11.16	2.06e-06	NA	0.007
3. B	Q80T85	DDB1- and CUL4-associated factor 5	3.99e-05	NA	4.77e-04
3. B	Q499N3	WD repeat-containing protein 18	5.19e-08	NA	2.10e-10
3. B	O43071	Pre-mRNA-processing factor 17	9.08e-09	NA	3.48e-13
3. B	Q0VC24	Ribosome biogenesis protein WDR12	1.28e-09	NA	5.65e-09
3. B	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.61e-05
3. B	Q05583	Cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	1.53e-10
3. B	P16371	Protein groucho	1.39e-08	NA	1.22e-06
3. B	Q9D0I6	WD repeat, SAM and U-box domain-containing protein 1	1.70e-12	NA	2.17e-16
3. B	Q86TI4	WD repeat-containing protein 86	2.68e-10	NA	1.36e-14
3. B	Q9FKT5	THO complex subunit 3	0.00e+00	NA	2.09e-13
3. B	Q4WVS4	Mitochondrial division protein 1	1.59e-05	NA	0.004
3. B	Q54MZ3	Anaphase-promoting complex subunit cdc20	2.67e-07	NA	1.92e-07
3. B	Q90ZL4	Lissencephaly-1 homolog	0.00e+00	NA	8.26e-19
3. B	A6ZPA6	Nuclear distribution protein PAC1	2.40e-11	NA	3.77e-04
3. B	P63245	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	A8QB65	Ribosome biogenesis protein WDR12 homolog	8.38e-12	NA	4.75e-08
3. B	Q9C270	Periodic tryptophan protein 2 homolog	4.70e-04	NA	2.24e-16
3. B	Q5R1S9	Chromatin assembly factor 1 subunit B	9.40e-12	NA	9.93e-08
3. B	Q54N86	F-box/WD repeat-containing protein A-like protein	4.46e-05	NA	9.40e-06
3. B	O17468	Protein HIRA homolog	1.43e-06	NA	1.11e-05
3. B	P61480	Ribosome biogenesis protein WDR12	1.14e-09	NA	5.17e-09
3. B	A5DGL8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.93e-04
3. B	P0CS54	Ribosome biogenesis protein YTM1	6.88e-08	NA	4.15e-04
3. B	Q6P1W0	Denticleless protein homolog	1.50e-08	NA	4.56e-06
3. B	Q3SWS8	mRNA export factor	2.33e-11	NA	0.003
3. B	Q99973	Telomerase protein component 1	3.63e-03	NA	5.47e-12
3. B	O75037	Kinesin-like protein KIF21B	7.42e-04	NA	0.005
3. B	Q54LT8	Serine-threonine kinase receptor-associated protein	0.00e+00	NA	4.06e-13
3. B	Q94A40	Coatomer subunit alpha-1	7.06e-10	NA	4.47e-11
3. B	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.59e-09
3. B	Q6C553	Protein HIR1	1.84e-06	NA	1.71e-08
3. B	O13286	WD repeat-containing protein srw1	4.97e-09	NA	8.25e-08
3. B	Q0J3D9	Coatomer subunit alpha-3	4.05e-10	NA	1.53e-11
3. B	Q8TAF3	WD repeat-containing protein 48	1.98e-07	NA	1.71e-12
3. B	O93277	WD repeat-containing protein 1	8.97e-06	NA	2.57e-07
3. B	Q9M3B4	Protein ROOT INITIATION DEFECTIVE 3	5.40e-09	NA	4.86e-06
3. B	Q7Z4S6	Kinesin-like protein KIF21A	6.28e-04	NA	1.11e-04
3. B	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	7.21e-11	NA	1.08e-06
3. B	Q6NLV4	Flowering time control protein FY	5.52e-08	NA	7.13e-13
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	4.65e-11	NA	2.11e-14
3. B	A7ETB3	Mitochondrial division protein 1	8.90e-07	NA	0.003
3. B	Q55FJ2	WD repeat-containing protein 91 homolog	1.01e-08	NA	1.18e-04
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	1.55e-07	NA	2.92e-17
3. B	Q9VU68	Actin-interacting protein 1	3.63e-08	NA	4.25e-07
3. B	Q86A97	EARP-interacting protein homolog	1.73e-14	NA	4.05e-04
3. B	O88879	Apoptotic protease-activating factor 1	2.21e-07	NA	5.34e-16
3. B	Q28I85	POC1 centriolar protein homolog A	1.84e-14	NA	5.99e-19
3. B	Q5U4D9	THO complex subunit 6 homolog	8.88e-15	NA	0.003
3. B	Q29KQ0	Ribosome biogenesis protein WDR12 homolog	6.42e-14	NA	2.01e-12
3. B	P25382	Ribosome assembly protein 4	1.69e-08	NA	3.36e-16
3. B	Q5I0B9	Autophagy-related protein 16	1.81e-10	NA	1.37e-10
3. B	Q921C3	Bromodomain and WD repeat-containing protein 1	4.35e-03	NA	1.03e-08
3. B	Q7RY68	Polyadenylation factor subunit 2	1.97e-09	NA	5.04e-07
3. B	F1MNN4	F-box/WD repeat-containing protein 7	1.16e-05	NA	1.06e-25
3. B	Q54Y96	WD40 repeat-containing protein smu1	1.18e-10	NA	2.36e-13
3. B	O42478	Transducin-like enhancer protein 4	6.43e-09	NA	4.84e-07
3. B	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	0.00e+00	NA	1.22e-24
3. B	Q6NNP0	Autophagy-related protein 16	2.11e-15	NA	2.35e-11
3. B	Q9GZL7	Ribosome biogenesis protein WDR12	1.34e-09	NA	4.90e-09
3. B	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	8.71e-08
3. B	O60336	Mitogen-activated protein kinase-binding protein 1	2.43e-03	NA	1.40e-08
3. B	P56094	General transcriptional corepressor TUP1	1.67e-07	NA	8.63e-25
3. B	Q91ZN1	Coronin-1A	6.83e-07	NA	4.24e-05
3. B	A2CEH0	POC1 centriolar protein homolog B	6.19e-13	NA	1.63e-20
3. B	Q58D00	F-box/WD repeat-containing protein 2	1.56e-12	NA	8.80e-07
3. B	Q9Y0T2	F-box/WD repeat-containing protein A	9.42e-05	NA	0.039
3. B	Q2GSJ9	Protein HIR1	2.93e-07	NA	3.54e-05
3. B	Q5A7Q6	Nuclear distribution protein PAC1	1.81e-12	NA	1.22e-12
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	2.49e-05	NA	8.57e-25
3. B	Q4X1Y0	Polyadenylation factor subunit 2	1.61e-10	NA	1.97e-07
3. B	P53622	Coatomer subunit alpha	4.81e-08	NA	6.04e-14
3. B	G5EFW7	Intraflagellar transport protein 122 homolog	2.86e-06	NA	0.007
3. B	O14301	Uncharacterized WD repeat-containing protein C9G1.05	6.84e-08	NA	4.22e-05
3. B	Q08E38	Pre-mRNA-processing factor 19	9.55e-11	NA	5.26e-15
3. B	Q9NSI6	Bromodomain and WD repeat-containing protein 1	4.64e-02	NA	1.07e-08
3. B	P0CS45	Mitochondrial division protein 1	1.21e-06	NA	1.46e-05
3. B	Q54YD8	Coatomer subunit beta'	1.86e-06	NA	3.44e-15
3. B	O60508	Pre-mRNA-processing factor 17	2.52e-09	NA	9.73e-14
3. B	Q5BDU4	Protein hir1	7.39e-06	NA	8.66e-08
3. B	Q54RP0	UDP-galactose:fucoside alpha-3-galactosyltransferase	1.08e-07	NA	6.26e-07
3. B	A8QBF3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.51e-06
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	5.85e-09	NA	2.92e-15
3. B	A5DHD9	Protein transport protein SEC13	5.55e-16	NA	0.050
3. B	Q8WWQ0	PH-interacting protein	4.23e-04	NA	4.04e-08
3. B	Q75C26	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	2.13e-10
3. B	Q94BM7	Protein SPA1-RELATED 4	8.35e-07	NA	1.39e-04
3. B	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	7.61e-20
3. B	B6K1G6	Probable cytosolic Fe-S cluster assembly factor SJAG_02895	4.91e-09	NA	5.44e-05
3. B	Q5FVA9	mRNA export factor	1.40e-11	NA	1.14e-04
3. B	Q8H594	Ribosome biogenesis protein WDR12 homolog	2.21e-08	NA	4.65e-05
3. B	A7RHG8	Ribosome biogenesis protein WDR12 homolog (Fragment)	1.26e-11	NA	3.71e-06
3. B	Q61666	Protein HIRA	2.70e-07	NA	2.14e-04
3. B	C3XVT5	Lissencephaly-1 homolog	0.00e+00	NA	1.18e-21
3. B	Q8HXL3	WD repeat-containing protein 62	8.02e-04	NA	1.08e-06
3. B	Q10NY2	Protein TPR3	7.11e-05	NA	0.002
3. B	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.62e-08	NA	6.66e-20
3. B	A8XJ40	Protein SEC13 homolog	4.89e-10	NA	0.011
3. B	Q9DCE5	p21-activated protein kinase-interacting protein 1	5.38e-09	NA	0.001
3. B	Q8BHD1	POC1 centriolar protein homolog B	9.67e-13	NA	5.86e-23
3. B	Q6CSI1	Histone acetyltransferase type B subunit 2	2.22e-11	NA	7.98e-05
3. B	A5DVY3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.031
3. B	A1CBP8	Mitochondrial division protein 1	9.09e-09	NA	0.001
3. B	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	1.11e-16	NA	3.35e-12
3. B	Q8VZS9	Protein FIZZY-RELATED 1	1.11e-09	NA	0.006
3. B	A1CGS0	Protein transport protein sec13	1.73e-14	NA	1.73e-04
3. B	Q9VKQ3	Ribosome biogenesis protein WDR12 homolog	4.01e-09	NA	1.80e-10
3. B	Q8VYZ5	Periodic tryptophan protein 2	8.89e-06	NA	8.31e-13
3. B	Q0CLJ4	Ribosome biogenesis protein ytm1	1.02e-08	NA	5.61e-05
3. B	P54686	Actin-interacting protein 1	4.37e-06	NA	1.73e-08
3. B	Q5XFW6	WD repeat-containing protein 6	2.18e-04	NA	2.03e-04
3. B	Q7ZVR1	WD repeat-containing protein 75	2.79e-05	NA	4.51e-04
3. B	A8NEG8	Nuclear distribution protein PAC1	0.00e+00	NA	5.31e-23
3. B	P58404	Striatin-4	9.14e-08	NA	3.27e-06
3. B	Q8C6G8	WD repeat-containing protein 26	2.58e-13	NA	2.24e-04
3. B	A8Q2R5	WD repeat-containing protein 48 homolog	6.65e-08	NA	6.21e-07
3. B	C5DY07	Nuclear distribution protein PAC1	5.43e-12	NA	8.28e-04
3. B	Q04727	Transducin-like enhancer protein 4	4.71e-07	NA	4.68e-07
3. B	P58405	Striatin-3	1.37e-08	NA	0.002
3. B	Q5BJ90	Ribosome biogenesis protein wdr12	1.42e-09	NA	1.77e-08
3. B	Q4R6D2	mRNA export factor	2.39e-11	NA	0.003
3. B	A2QI22	Ribosome biogenesis protein ytm1	3.54e-09	NA	4.70e-04
3. B	Q9DB94	WD repeat-containing protein 53	0.00e+00	NA	0.005
3. B	O82266	Protein SLOW WALKER 1	1.48e-08	NA	8.74e-05
3. B	Q68EI0	WD repeat-containing protein 18	1.28e-08	NA	3.52e-09
3. B	F4I1S7	Elongator complex protein 2	6.24e-06	NA	7.33e-04
3. B	A1D7I5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.82e-06
3. B	Q5TTP0	WD repeat-containing protein on Y chromosome	1.40e-03	NA	9.68e-06
3. B	O89046	Coronin-1B	3.45e-07	NA	4.76e-04
3. B	Q5XX13	F-box/WD repeat-containing protein 10	1.40e-04	NA	7.97e-07
3. B	B6QC06	Nuclear distribution protein nudF 2	2.90e-14	NA	2.43e-15
3. B	B4NW98	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.66e-05
3. B	Q2UFN8	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.84e-06	NA	9.18e-20
3. B	Q4WNK7	Protein transport protein sec13	4.46e-14	NA	1.29e-04
3. B	Q8LPL5	Protein FIZZY-RELATED 3	5.89e-09	NA	0.002
3. B	A4RD35	Protein transport protein SEC31	6.79e-05	NA	0.049
3. B	Q03897	Maintenance of telomere capping protein 5	9.33e-05	NA	7.17e-04
3. B	Q9ERG2	Striatin-3	3.47e-07	NA	0.004
3. B	Q62440	Transducin-like enhancer protein 1	9.07e-09	NA	4.75e-07
3. B	Q07141	Transducin-like enhancer protein 4	6.03e-09	NA	2.92e-07
3. B	Q5JSH3	WD repeat-containing protein 44	1.10e-04	NA	1.91e-04
3. B	Q148I1	Proteasomal ATPase-associated factor 1	7.79e-11	NA	9.40e-11
3. B	Q6CL75	Protein transport protein SEC31	1.49e-06	NA	0.009
3. B	Q10282	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	1.29e-08
3. B	Q5E959	Serine-threonine kinase receptor-associated protein	1.80e-14	NA	1.09e-07
3. B	Q5ZL33	Serine-threonine kinase receptor-associated protein	3.33e-16	NA	8.62e-07
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	8.23e-10	NA	2.81e-14
3. B	Q6BIR9	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	5.37e-05
3. B	Q9DCJ1	Target of rapamycin complex subunit LST8	2.22e-16	NA	2.03e-13
3. B	Q9VPH8	Retinoblastoma-binding protein 5 homolog	2.80e-09	NA	1.61e-04
3. B	B0DWM8	Ribosome biogenesis protein YTM1	3.02e-08	NA	0.007
3. B	Q8C5V5	WD repeat-containing protein 27	7.53e-08	NA	0.007
3. B	O22785	Pre-mRNA-processing factor 19 homolog 2	4.04e-11	NA	4.11e-12
3. B	Q8L4J2	Cleavage stimulation factor subunit 50	1.63e-11	NA	4.93e-05
3. B	Q1DR81	Probable cytosolic iron-sulfur protein assembly protein 1	2.22e-15	NA	0.003
3. B	P53699	Cell division control protein 4	5.63e-06	NA	5.09e-12
3. B	Q19124	Autophagic-related protein 16.1	3.63e-13	NA	4.30e-05
3. B	Q54W52	Ribosome biogenesis protein WDR12 homolog	2.72e-09	NA	5.82e-05
3. B	A6ZPA9	Ribosome biogenesis protein YTM1	5.59e-08	NA	1.63e-05
3. B	Q5EA99	p21-activated protein kinase-interacting protein 1	5.99e-11	NA	6.04e-04
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	6.72e-08	NA	5.68e-16
3. B	Q0CHM0	Protein transport protein sec13	2.54e-14	NA	8.32e-04
3. B	Q7ZV55	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.38e-05
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	4.55e-14	NA	2.27e-14
3. B	P93339	Guanine nucleotide-binding protein subunit beta	NA	NA	4.11e-12
3. B	Q6P5U7	NACHT and WD repeat domain-containing protein 2	9.16e-03	NA	0.027
3. B	O76734	General transcriptional corepressor tupA	8.73e-11	NA	3.56e-25
3. B	C8ZH19	Nuclear distribution protein PAC1	2.41e-11	NA	0.001
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	1.24e-10	NA	2.11e-14
3. B	P0CS44	Mitochondrial division protein 1	4.06e-03	NA	1.46e-05
3. B	Q6BRR2	Protein transport protein SEC31	1.38e-04	NA	0.015
3. B	Q1LZ08	WD repeat-containing protein 48 homolog	3.36e-07	NA	1.71e-11
3. B	Q5AG86	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	1.21e-04
3. B	Q9T014	Protein SPA1-RELATED 2	2.45e-05	NA	6.81e-08
3. B	P33215	Protein NEDD1	8.20e-13	NA	0.005
3. B	O43379	WD repeat-containing protein 62	1.28e-03	NA	9.92e-07
3. B	A7TNS8	CCR4-associated factor 4 homolog	7.53e-08	NA	1.60e-06
3. B	Q6DDF0	WD repeat-containing protein 37	2.47e-08	NA	2.62e-07
3. B	Q8QFR2	Protein HIRA	1.53e-06	NA	0.005
3. B	Q7K1Y4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.33e-11
3. B	Q8K3E5	Jouberin	1.59e-05	NA	0.012
3. B	Q9LV35	Actin-interacting protein 1-2	1.28e-05	NA	1.74e-06
3. B	Q4R8H1	F-box-like/WD repeat-containing protein TBL1X	3.36e-08	NA	3.67e-13
3. B	B5X3Z6	Lissencephaly-1 homolog A	0.00e+00	NA	8.89e-19
3. B	Q5RAN6	Nucleoporin SEH1	1.53e-09	NA	6.57e-04
3. B	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	6.76e-18
3. B	A5E2R6	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.001
3. B	D4AM37	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.62e-11	NA	3.10e-19
3. B	Q0V320	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.63e-07
3. B	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	1.11e-16	NA	5.24e-20
3. B	Q64LD2	WD repeat-containing protein 25	9.36e-11	NA	6.39e-07
3. B	O55106	Striatin	6.45e-07	NA	0.001
3. B	Q9JMJ2	F-box/WD repeat-containing protein 4	5.26e-10	NA	0.003
3. B	B4GMG4	WD repeat-containing protein 55 homolog	5.59e-10	NA	4.35e-08
3. B	A2QPW4	Probable cytosolic iron-sulfur protein assembly protein 1	5.71e-12	NA	2.13e-04
3. B	Q06078	U3 small nucleolar RNA-associated protein 21	1.94e-04	NA	9.82e-06
3. B	Q759U7	Nuclear distribution protein PAC1	6.78e-14	NA	5.52e-04
3. B	Q9UT57	Probable cytosolic Fe-S cluster assembly factor SPAC806.02c	1.44e-10	NA	1.12e-08
3. B	Q5B563	Protein transport protein sec13	2.20e-14	NA	0.001
3. B	Q5NVK4	Coronin-1B	1.74e-06	NA	0.001
3. B	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	0.00e+00	NA	4.05e-05
3. B	Q8VDD9	PH-interacting protein	1.84e-03	NA	3.40e-08
3. B	Q92176	Coronin-1A	5.29e-07	NA	1.06e-04
3. B	C4JZS6	Nuclear distribution protein PAC1-1	2.33e-14	NA	3.27e-15
3. B	Q6BLS5	Ribosome biogenesis protein YTM1	4.66e-12	NA	0.011
3. B	B4GAJ1	Lissencephaly-1 homolog	0.00e+00	NA	2.04e-19
3. B	Q9H1Z4	WD repeat-containing protein 13	4.92e-10	NA	0.002
3. B	P0CS39	Protein HIR1	3.06e-09	NA	5.66e-12
3. B	P42527	Myosin heavy chain kinase A	5.26e-05	NA	1.51e-10
3. B	P0CS55	Ribosome biogenesis protein YTM1	8.11e-08	NA	4.15e-04
3. B	Q5REE6	Ribosome biogenesis protein WDR12	1.40e-09	NA	3.47e-09
3. B	Q54JS5	GATOR complex protein WDR24	8.84e-06	NA	0.005
3. B	Q9SYX2	Protein SUPPRESSOR OF PHYA-105 1	4.97e-05	NA	4.78e-05
3. B	P0CS36	Histone acetyltransferase type B subunit 2	5.66e-15	NA	1.24e-04
3. B	Q969H0	F-box/WD repeat-containing protein 7	3.21e-05	NA	1.55e-25
3. B	Q6CKX3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.004
3. B	Q4P5F5	Probable cytosolic iron-sulfur protein assembly protein 1	3.00e-10	NA	7.83e-06
3. B	A7S338	Lissencephaly-1 homolog	0.00e+00	NA	7.20e-20
3. B	P78972	WD repeat-containing protein slp1	6.13e-07	NA	1.62e-05
3. B	Q676U5	Autophagy-related protein 16-1	2.40e-08	NA	1.38e-10
3. B	Q652L2	Protein HIRA	2.32e-08	NA	6.58e-08
3. B	B8NGT5	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.61e-09	NA	1.02e-19
3. B	Q40687	Guanine nucleotide-binding protein subunit beta	6.00e-15	NA	2.54e-12
3. B	A4RJA0	ASTRA-associated protein 1	2.05e-10	NA	0.004
3. B	Q6P315	Histone-binding protein RBBP7	2.44e-15	NA	3.78e-06
3. B	P36130	CCR4-associated factor 4	1.71e-07	NA	5.52e-07
3. B	Q6DFF9	Mitogen-activated protein kinase-binding protein 1	1.62e-03	NA	2.45e-05
3. B	Q9QXL2	Kinesin-like protein KIF21A	2.49e-04	NA	6.35e-04
3. B	Q6PFM9	WD repeat-containing protein 48	1.95e-07	NA	6.40e-13
3. B	Q9NNW5	WD repeat-containing protein 6	2.52e-04	NA	2.43e-04
3. B	Q9WUM3	Coronin-1B	7.99e-07	NA	0.002
3. B	O94423	Meiotic fizzy-related protein 1	1.06e-08	NA	0.009
3. B	Q9I9H8	Apoptotic protease-activating factor 1	2.98e-05	NA	1.83e-12
3. B	O13168	Transducin-like enhancer protein 3-B	7.53e-08	NA	3.86e-07
3. B	C7GWC1	Nuclear distribution protein PAC1	3.54e-08	NA	3.97e-04
3. B	B4LJT7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	2.59e-08
3. B	Q11176	Actin-interacting protein 1	3.29e-08	NA	7.70e-07
3. B	Q8W117	Suppressor of mec-8 and unc-52 protein homolog 1	8.82e-14	NA	2.32e-13
3. B	Q8N1V2	Cilia- and flagella-associated protein 52	8.44e-15	NA	2.90e-08
3. B	Q5DFU0	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	7.46e-06
3. B	Q810D6	Glutamate-rich WD repeat-containing protein 1	7.47e-10	NA	5.64e-07
3. B	Q9SXY1	Chromatin assembly factor 1 subunit FAS2	7.08e-13	NA	1.10e-10
3. B	O14170	WD repeat-containing protein pop2	2.35e-06	NA	1.16e-16
3. B	Q54R82	Mitogen-activated protein kinase kinase kinase A	4.40e-06	NA	8.96e-11
3. B	Q7K4B3	Probable elongator complex protein 2	8.29e-06	NA	0.005
3. B	B6H7A3	Probable cytosolic iron-sulfur protein assembly protein 1	3.22e-15	NA	0.002
3. B	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.85e-04
3. B	Q95JL5	Cilia- and flagella-associated protein 52	2.16e-07	NA	3.24e-06
3. B	O35142	Coatomer subunit beta'	5.44e-07	NA	1.15e-08
3. B	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	1.69e-08
3. B	Q9WVB2	Transducin-like enhancer protein 2	4.74e-09	NA	4.32e-06
3. B	A7EZJ5	Probable cytosolic iron-sulfur protein assembly protein 1	2.62e-14	NA	0.007
3. B	Q9QXE7	F-box-like/WD repeat-containing protein TBL1X	1.57e-08	NA	1.36e-14
3. B	P0CS47	Polyadenylation factor subunit 2	2.07e-07	NA	3.48e-06
3. B	Q9BZK7	F-box-like/WD repeat-containing protein TBL1XR1	4.54e-08	NA	4.20e-12
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	9.64e-11	NA	1.69e-11
3. B	P91341	Periodic tryptophan protein 2 homolog	6.03e-06	NA	1.05e-05
3. B	P90648	Myosin heavy chain kinase B	5.68e-08	NA	2.87e-18
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	1.58e-03	NA	4.32e-10
3. B	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	NA	1.55e-15
3. B	Q96EE3	Nucleoporin SEH1	1.28e-08	NA	6.28e-04
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	4.04e-08	NA	1.26e-16
3. B	P97260	Sterol regulatory element-binding protein cleavage-activating protein	1.47e-03	NA	5.11e-05
3. B	Q9WVB3	Transducin-like enhancer protein 6	1.27e-07	NA	0.003
3. B	A5D7H2	Striatin-3	5.19e-08	NA	6.62e-05
3. B	B4J8H6	WD repeat-containing protein 48 homolog	2.63e-07	NA	3.90e-11
3. B	A7THX0	Mitochondrial division protein 1	2.10e-08	NA	1.04e-07
3. B	P0CS50	Protein transport protein SEC13	1.35e-14	NA	0.042
3. B	B3RQN1	Ribosome biogenesis protein WDR12 homolog	2.38e-08	NA	4.96e-05
3. B	B7FF06	WD repeat-containing protein on Y chromosome	1.50e-04	NA	9.20e-05
3. B	Q26544	WD repeat-containing protein SL1-17	NA	NA	1.22e-14
3. B	Q28D01	WD repeat-containing protein 26	1.56e-13	NA	1.98e-04
3. B	O13923	Coronin-like protein crn1	3.95e-05	NA	0.015
3. B	Q9C1X1	Periodic tryptophan protein 2 homolog	2.20e-07	NA	4.72e-11
3. B	Q7Z5U6	WD repeat-containing protein 53	0.00e+00	NA	0.011
3. B	Q9VLN1	WD repeat-containing protein 82	0.00e+00	NA	0.003
3. B	Q4P8R5	Mitochondrial division protein 1	3.45e-06	NA	1.16e-04
3. B	F1DLK1	Protein DECREASED SIZE EXCLUSION LIMIT 1	0.00e+00	NA	0.001
3. B	B0R0D7	Coronin-1C-A	5.46e-07	NA	4.20e-04
3. B	A6ZQL5	Mitochondrial division protein 1	4.86e-07	NA	1.44e-07
3. B	O64740	Protein transport protein SEC13 homolog B	9.99e-16	NA	0.005
3. B	Q9BV38	WD repeat-containing protein 18	1.63e-07	NA	3.40e-09
3. B	Q17QU5	Target of rapamycin complex subunit LST8	0.00e+00	NA	4.00e-12
3. B	P49695	Probable serine/threonine-protein kinase PkwA	1.53e-11	NA	2.67e-29
3. B	Q95RJ9	F-box-like/WD repeat-containing protein ebi	3.93e-08	NA	5.11e-13
3. B	O74319	Transcription initiation factor TFIID subunit taf73	4.45e-11	NA	2.75e-12
3. B	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.27e-06
3. B	P41811	Coatomer subunit beta'	2.19e-07	NA	7.89e-05
3. B	Q6BUA6	Nuclear distribution protein PAC1	7.77e-16	NA	5.24e-06
3. B	A8JAN3	Centriole proteome protein 16	1.73e-02	NA	5.76e-04
3. B	Q3ULA2	F-box/WD repeat-containing protein 1A	1.30e-12	NA	1.39e-17
3. B	Q54MT0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.006
3. B	Q8BUB4	WD repeat and FYVE domain-containing protein 2	1.18e-09	NA	2.48e-10
3. B	B8MWR8	Probable cytosolic iron-sulfur protein assembly protein 1	6.66e-16	NA	1.27e-04
3. B	Q05B17	WD repeat-containing protein 48	3.09e-07	NA	6.58e-13
3. B	Q4VBE8	WD repeat-containing protein 18	1.07e-07	NA	4.46e-10
3. B	Q9XS70	Coronin-1B	6.72e-07	NA	0.002
3. B	Q6GL39	WD repeat-containing protein 82	0.00e+00	NA	8.16e-06
3. B	B4KRQ4	WD repeat-containing protein 48 homolog	3.16e-07	NA	5.36e-11
3. B	P49178	Guanine nucleotide-binding protein subunit beta	1.10e-14	NA	8.07e-13
3. B	Q5U2W5	Transducin beta-like protein 3	2.56e-09	NA	3.40e-12
3. B	Q32PG3	WD repeat-containing protein 48	2.36e-07	NA	1.78e-12
3. B	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	8.67e-20
3. B	Q6CSZ5	Protein transport protein SEC13	4.44e-15	NA	0.001
3. B	B4QTL6	WD repeat-containing protein 55 homolog	4.02e-09	NA	2.32e-08
3. B	Q5RF99	mRNA export factor	4.44e-12	NA	0.004
3. B	Q5ZJH5	WD repeat-containing protein 61	0.00e+00	NA	1.21e-12
3. B	Q00808	Vegetative incompatibility protein HET-E-1	3.15e-06	NA	3.81e-43
3. B	P63246	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	A0AUS0	WD repeat, SAM and U-box domain-containing protein 1	5.06e-13	NA	4.44e-22
3. B	B1ANS9	WD repeat-containing protein 64	4.45e-04	NA	4.16e-07
3. B	Q5U4Y8	Nucleoporin SEH1	1.56e-08	NA	0.001
3. B	A8IR43	Ribosome biogenesis protein WDR12 homolog	1.71e-09	NA	0.008
3. B	P78406	mRNA export factor	3.80e-12	NA	0.004
3. B	Q6NS57	Mitogen-activated protein kinase-binding protein 1	1.17e-03	NA	3.42e-09
3. B	P20484	Protein MAK11	2.73e-06	NA	6.13e-07
3. B	B2B5V0	Ribosome biogenesis protein YTM1	2.07e-09	NA	3.94e-04
3. B	A5GFN6	mRNA export factor	2.53e-11	NA	0.005
3. B	Q5RBW3	Coronin-7	2.17e-04	NA	4.62e-06
3. B	Q0UXP3	Ribosome biogenesis protein YTM1	4.08e-08	NA	0.025
3. B	Q8IWB7	WD repeat and FYVE domain-containing protein 1	1.31e-09	NA	2.80e-13
3. B	O75083	WD repeat-containing protein 1	7.82e-06	NA	7.95e-06
3. B	A7YY75	Nucleoporin SEH1	4.61e-10	NA	2.18e-04
3. B	Q0U2T3	Mitochondrial division protein 1	8.30e-07	NA	7.95e-05
3. B	Q2UQ34	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.23e-06
3. B	B4PU14	WD repeat-containing protein 55 homolog	8.83e-10	NA	2.89e-08
3. B	P87060	WD repeat-containing protein pop1	5.43e-05	NA	1.49e-12
3. B	B9WHJ2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	5.30e-05
3. B	Q4P4R3	Protein HIR1	7.87e-08	NA	1.32e-08
3. B	Q8N0X2	Sperm-associated antigen 16 protein	7.33e-15	NA	6.12e-17
3. B	P54319	Phospholipase A-2-activating protein	3.61e-10	NA	6.13e-07
3. B	P38262	SIR4-interacting protein SIF2	7.53e-07	NA	2.67e-04
3. B	Q6GMD2	WD repeat-containing protein 61	0.00e+00	NA	6.46e-13
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	9.06e-10
3. B	B3NQR5	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.17e-10
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	2.69e-11	NA	3.69e-11
3. B	P57737	Coronin-7	5.81e-04	NA	2.48e-06
3. B	Q8K450	Sperm-associated antigen 16 protein	2.29e-12	NA	3.66e-17
3. B	O60137	Set1 complex component swd2	3.59e-10	NA	0.028
3. B	B2RZ17	F-box/WD repeat-containing protein 2	3.02e-12	NA	1.48e-06
3. B	Q9USZ0	Uncharacterized WD repeat-containing protein C1306.02	2.66e-04	NA	0.007
3. B	Q9M0V4	U3 snoRNP-associated protein-like YAO	1.41e-09	NA	1.11e-10
3. B	Q6GNF1	Nucleoporin SEH1-B	1.45e-09	NA	0.003
3. B	Q54H44	WD repeat domain-containing protein 83 homolog	0.00e+00	NA	3.92e-07
3. B	Q54SA5	WD repeat-containing protein 55 homolog	1.63e-12	NA	1.91e-05
3. B	P70483	Striatin	2.51e-09	NA	0.002
3. B	Q9C701	Mitotic checkpoint protein BUB3.2	0.00e+00	NA	0.002
3. B	B0XFT7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	9.95e-06
3. B	Q08924	Regulator of Ty1 transposition protein 10	7.61e-07	NA	2.06e-04
3. B	Q5F3K4	WD repeat-containing protein 48	2.08e-07	NA	1.27e-12
3. B	Q3U821	WD repeat-containing protein 75	5.22e-05	NA	0.001
3. B	Q4V7Z1	POC1 centriolar protein homolog B	3.74e-13	NA	1.18e-20
3. B	B4HWV6	Ribosome biogenesis protein WDR12 homolog	1.51e-10	NA	8.92e-11
3. B	Q5SQM0	Echinoderm microtubule-associated protein-like 6	7.14e-03	NA	7.53e-08
3. B	B7FF08	WD repeat-containing protein on Y chromosome	1.19e-04	NA	2.75e-04
3. B	Q15542	Transcription initiation factor TFIID subunit 5	6.41e-08	NA	3.91e-20
3. B	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	4.12e-15
3. B	Q8N9V3	WD repeat, SAM and U-box domain-containing protein 1	1.46e-12	NA	7.44e-16
3. B	Q5IH81	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.32e-05
3. B	O22607	WD-40 repeat-containing protein MSI4	4.30e-10	NA	0.002
3. B	Q5ZMC3	WD repeat, SAM and U-box domain-containing protein 1	1.04e-11	NA	1.29e-19
3. B	Q86H45	Probable elongator complex protein 2	8.46e-04	NA	0.008
3. B	Q6H8D6	Putative coatomer subunit beta'-3	5.47e-07	NA	5.34e-09
3. B	Q6FKK3	Ribosome biogenesis protein YTM1	6.36e-08	NA	0.009
3. B	B3N534	Ribosome biogenesis protein WDR12 homolog	7.61e-10	NA	7.95e-11
3. B	Q9UKB1	F-box/WD repeat-containing protein 11	3.60e-08	NA	7.57e-18
3. B	C1BK83	Nucleoporin SEH1	2.46e-08	NA	0.010
3. B	Q2UGK1	Ribosome biogenesis protein ytm1	1.70e-09	NA	1.22e-04
3. B	Q54J37	Striatin homolog	8.49e-07	NA	5.79e-07
3. B	P87314	Protein hir1	8.52e-08	NA	4.51e-10
3. B	Q9YGY3	Mitotic checkpoint protein BUB3	0.00e+00	NA	0.005
3. B	Q8BH57	WD repeat-containing protein 48	2.70e-07	NA	1.40e-12
3. B	Q3MKM6	U3 snoRNP-associated protein-like EMB2271	7.92e-10	NA	8.45e-09
3. B	Q8C0P5	Coronin-2A	1.80e-06	NA	0.002
3. B	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.05e-06
3. B	B0XYC8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.99e-06
3. B	B9WD30	Nuclear distribution protein PAC1	2.07e-12	NA	3.93e-14
3. B	Q27GK7	Topless-related protein 4	9.73e-05	NA	5.43e-04
3. B	B8AP31	Guanine nucleotide-binding protein subunit beta	7.11e-15	NA	2.54e-12
3. B	Q12220	U3 small nucleolar RNA-associated protein 12	1.15e-05	NA	6.30e-14
3. B	Q5AXW3	Mitochondrial division protein 1	3.70e-07	NA	0.003
3. B	A5DJX5	Nuclear distribution protein PAC1	2.22e-16	NA	6.97e-07
3. B	Q0CXH9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.40e-06
3. B	O74184	Target of rapamycin complex subunit wat1	5.55e-16	NA	1.27e-16
3. B	Q8N157	Jouberin	1.32e-04	NA	0.042
3. B	Q06506	Ribosomal RNA-processing protein 9	1.19e-06	NA	0.012
3. B	A1C7E4	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.88e-06	NA	1.08e-20
3. B	O55029	Coatomer subunit beta'	5.67e-07	NA	8.14e-10
3. B	Q0V8F1	Coronin-7	4.23e-04	NA	8.07e-06
3. B	Q9W2E7	Protein Rae1	2.22e-16	NA	1.28e-04
3. B	O80775	WD repeat-containing protein 55	2.44e-14	NA	0.003
3. B	B4M4W4	WD repeat-containing protein 55 homolog	3.90e-09	NA	1.82e-05
3. B	Q8NI36	WD repeat-containing protein 36	8.98e-05	NA	0.005
3. B	Q5APF0	Ribosome biogenesis protein YTM1	3.79e-09	NA	0.004
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	4.40e-11	NA	2.11e-14
3. B	A3LX18	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.011
3. B	B6Q4Z5	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.69e-08	NA	1.59e-19
3. B	Q20168	Probable coatomer subunit beta'	1.78e-06	NA	1.28e-12
3. B	D4D8P3	Probable E3 ubiquitin ligase complex SCF subunit sconB	5.28e-11	NA	2.97e-19
3. B	Q75BS2	Protein transport protein SEC13	2.89e-15	NA	0.002
3. B	Q9Y297	F-box/WD repeat-containing protein 1A	5.38e-14	NA	4.62e-18
3. B	Q3SZD4	WD repeat-containing protein 18	9.08e-08	NA	1.21e-13
3. B	Q6NVE8	WD repeat-containing protein 44	3.08e-06	NA	2.57e-04
3. B	B4GT01	Ribosome biogenesis protein WDR12 homolog	1.06e-13	NA	4.08e-12
3. B	Q9NRL3	Striatin-4	6.57e-09	NA	2.32e-06
3. B	P57775	F-box/WD repeat-containing protein 4	3.65e-14	NA	0.049
3. B	Q5ZMV9	GATOR complex protein WDR24	1.21e-05	NA	0.005
3. B	Q38884	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.10e-11
3. B	Q1DHE1	Protein HIR1	3.85e-06	NA	9.02e-07
3. B	A2QCU8	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.92e-07	NA	1.10e-17
3. B	Q9C4Z6	Receptor for activated C kinase 1B	0.00e+00	NA	5.72e-19
3. B	O94527	WD repeat protein iqw1	5.13e-05	NA	2.23e-04
3. B	Q96KV7	WD repeat-containing protein 90	4.80e-03	NA	0.001
3. B	B4GDM7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	7.43e-10
3. B	Q498F0	WD repeat-containing protein 44	2.02e-06	NA	0.004
3. B	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	1.91e-12	NA	3.42e-04
3. B	Q229Z6	POC1 centriolar protein homolog	1.13e-08	NA	6.81e-12
3. B	O13982	Uncharacterized WD repeat-containing protein C25H1.08c	2.68e-11	NA	5.80e-04
3. B	P0DPA1	WD repeat-containing protein DDB_G0349043	9.55e-15	NA	6.11e-11
3. B	Q54MP8	Bromodomain and WD repeat-containing DDB_G0285837	3.85e-03	NA	0.001
3. B	Q9SJT9	Coatomer subunit alpha-2	4.48e-10	NA	1.53e-11
3. B	Q8BU03	Periodic tryptophan protein 2 homolog	6.36e-06	NA	1.28e-06
3. B	A1CJY4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.97e-06
3. B	P36037	Protein DOA1	7.05e-07	NA	5.47e-06
3. B	O13282	Transcription initiation factor TFIID subunit 5	2.43e-10	NA	4.90e-13
3. B	Q4WX90	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.99e-06
3. B	B4P6P9	Lissencephaly-1 homolog	0.00e+00	NA	4.04e-20
3. B	O94289	Ubiquitin homeostasis protein lub1	2.25e-06	NA	0.002
3. B	Q9D180	Cilia- and flagella-associated protein 57	7.54e-05	NA	2.59e-04
3. B	O94365	U3 small nucleolar RNA-associated protein 15	1.29e-09	NA	1.12e-05
3. B	Q3SZK1	Angio-associated migratory cell protein	2.32e-08	NA	1.12e-05
3. B	B6GZA1	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.52e-09	NA	7.38e-11
3. B	Q5RF24	WD repeat-containing protein 13	1.46e-08	NA	0.007
3. B	Q5RFQ3	Periodic tryptophan protein 2 homolog	4.56e-05	NA	2.36e-08
3. B	B4KKN1	Ribosome biogenesis protein WDR12 homolog	2.66e-08	NA	1.41e-08
3. B	Q20059	WD repeat-containing protein 48 homolog	8.89e-08	NA	6.03e-07
3. B	A0JP70	WD repeat-containing protein 90	3.58e-03	NA	0.002
3. B	O13046	WD repeat and HMG-box DNA-binding protein 1	4.91e-06	NA	0.005
3. B	Q9UKT8	F-box/WD repeat-containing protein 2	2.70e-12	NA	9.04e-07
3. B	A4R2Q6	Ribosome biogenesis protein YTM1	7.89e-09	NA	1.44e-07
3. B	Q94AI7	Protein TOPLESS	6.15e-05	NA	0.019
3. B	B3MET8	WD repeat-containing protein 48 homolog	2.60e-07	NA	1.10e-11
3. B	Q9LXN4	Protein HIRA	5.09e-08	NA	3.19e-07
3. B	Q6PAX7	WD repeat-containing protein 1-B	2.35e-05	NA	1.37e-06
3. B	Q8CFJ9	GATOR complex protein WDR24	8.80e-07	NA	9.99e-05
3. B	Q9Y2I8	WD repeat-containing protein 37	1.52e-08	NA	3.91e-05
3. B	B3LJT5	Nuclear distribution protein PAC1	1.34e-11	NA	3.77e-04
3. B	O42937	Probable coatomer subunit beta'	1.73e-07	NA	8.98e-12
3. B	Q8IZU2	WD repeat-containing protein 17	3.18e-05	NA	2.67e-10
3. B	Q5NBT9	Protein TPR1	7.14e-05	NA	7.02e-04
3. B	Q5ACW8	Protein HIR1	2.72e-07	NA	1.15e-08
3. B	Q16MY0	WD repeat-containing protein 48 homolog	4.32e-08	NA	1.44e-07
3. B	Q6ZPG2	WD repeat-containing protein 90	2.67e-03	NA	1.07e-06
3. B	P32479	Protein HIR1	3.73e-09	NA	8.90e-07
3. B	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	7.75e-20
3. B	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	7.92e-10
3. B	B4I195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.91e-05
3. B	Q54BI5	WD repeat-containing protein 53 homolog	5.33e-15	NA	2.90e-05
3. B	P93340	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	9.51e-18
3. B	Q93454	mRNA export factor rae-1	1.02e-12	NA	0.046
3. B	O60907	F-box-like/WD repeat-containing protein TBL1X	2.43e-08	NA	1.95e-13
3. B	Q8CIE6	Coatomer subunit alpha	6.71e-10	NA	6.73e-08
3. B	D1ZEB4	Nuclear distribution protein PAC1-1	3.41e-14	NA	3.83e-17
3. B	B3P4F8	WD repeat-containing protein 55 homolog	1.02e-09	NA	5.67e-08
3. B	Q5RD06	POC1 centriolar protein homolog B	1.56e-13	NA	4.68e-18
3. B	Q6TGU2	Nucleoporin SEH1	1.35e-08	NA	0.009
3. B	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	2.05e-14	NA	1.43e-07
3. B	Q2GSM6	Protein transport protein SEC13	4.94e-14	NA	1.05e-08
3. B	Q32PJ6	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	1.19e-09
3. B	O14021	RbAp48-related WD40 repeat-containing protein prw1	3.07e-12	NA	7.07e-07
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	1.06e-04	NA	4.59e-28
3. B	B0XAF3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	3.32e-10
3. B	Q2H139	Mitochondrial division protein 1	3.10e-07	NA	8.39e-07
3. B	D3ZW91	POC1 centriolar protein homolog B	1.28e-10	NA	8.29e-17
3. B	O62621	Coatomer subunit beta'	6.50e-07	NA	3.09e-08
3. B	Q0UNC6	Protein HIR1	3.08e-07	NA	7.12e-08
3. B	Q9H2Y7	Zinc finger protein 106	3.15e-03	NA	2.13e-05
3. B	A2QEV8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	9.78e-07
3. B	O62471	Protein qui-1	1.59e-04	NA	6.86e-13
3. B	P68040	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	A6ZZZ8	CCR4-associated factor 4	8.35e-09	NA	7.37e-07
3. B	Q7K0L4	WD repeat-containing protein 26 homolog	1.75e-10	NA	1.15e-05
3. B	Q9WUC8	Pleiotropic regulator 1	2.67e-10	NA	1.98e-09
3. B	Q5RKI0	WD repeat-containing protein 1	7.96e-06	NA	1.07e-07
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	2.99e-10	NA	2.69e-15
3. B	B2VZH2	Ribosome biogenesis protein ytm1	3.34e-08	NA	1.45e-04
3. B	Q5EBE8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.92e-06
3. B	P42935	Elongator complex protein 2	5.21e-06	NA	0.003
3. B	Q8WQ85	Villidin	1.31e-02	NA	0.002
3. B	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.018
3. B	P93397	Guanine nucleotide-binding protein subunit beta-1	3.11e-15	NA	5.24e-12
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	1.22e-08	NA	1.91e-14
3. B	Q17BB0	Ribosome biogenesis protein WDR12 homolog	5.39e-11	NA	1.92e-07
3. B	B5FZ19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.02e-05
3. B	B0W517	Ribosome biogenesis protein WDR12 homolog	3.97e-13	NA	2.02e-06
3. B	Q06440	Coronin-like protein	1.17e-05	NA	1.50e-08
3. B	Q5MNU5	Sterol regulatory element-binding protein cleavage-activating protein	1.46e-03	NA	1.15e-04
3. B	Q5RBZ2	Methylosome protein 50	6.99e-13	NA	0.031
3. B	Q6PBD6	WD repeat-containing protein 61	0.00e+00	NA	5.27e-13
3. B	Q17N69	Lissencephaly-1 homolog	0.00e+00	NA	6.50e-20
3. B	B4P7H8	WD repeat-containing protein 48 homolog	2.44e-07	NA	4.63e-11
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	8.77e-09	NA	1.95e-14
3. B	Q6CXX3	Protein HIR1	5.31e-07	NA	1.14e-11
3. B	Q05BC3	Echinoderm microtubule-associated protein-like 1	7.15e-06	NA	0.029
3. B	Q758R7	Mitochondrial division protein 1	1.95e-07	NA	7.41e-05
3. B	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	7.68e-20
3. B	P27612	Phospholipase A-2-activating protein	6.81e-07	NA	1.60e-06
3. B	B4P7Q3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.56e-11
3. B	A1DDL6	Mitochondrial division protein 1	1.58e-08	NA	7.99e-04
3. B	Q6FT96	Mitochondrial division protein 1	1.70e-08	NA	2.13e-07
3. B	Q9UT85	Uncharacterized WD repeat-containing protein C343.04c	0.00e+00	NA	4.01e-08
3. B	Q9FE91	Zinc finger CCCH domain-containing protein 62	6.10e-08	NA	2.69e-05
3. B	A8PTE4	Mitochondrial division protein 1	3.67e-07	NA	7.71e-10
3. B	Q9VAT2	DDB1- and CUL4-associated factor 10 homolog	5.15e-04	NA	5.79e-08
3. B	Q9UQ03	Coronin-2B	7.65e-07	NA	0.047
3. B	Q640J6	WD repeat-containing protein 82-A	0.00e+00	NA	2.11e-05
3. B	Q8L828	Coatomer subunit beta'-3	5.28e-07	NA	2.04e-10
3. B	B3MEY6	Lissencephaly-1 homolog	0.00e+00	NA	2.11e-19
3. B	A4REK3	Protein transport protein SEC13	6.05e-14	NA	1.28e-06
3. B	A1DHW6	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.97e-08	NA	1.49e-19
3. B	O14727	Apoptotic protease-activating factor 1	5.08e-07	NA	2.45e-18
3. B	A7UWE6	ASTRA-associated protein 1	6.27e-08	NA	0.001
3. B	Q2U5Z8	Mitochondrial division protein 1	2.79e-07	NA	5.83e-04
3. B	A6S0T8	Ribosome biogenesis protein ytm1	4.62e-13	NA	0.018
3. B	B2B766	Nuclear distribution protein PAC1-2	5.90e-14	NA	8.98e-17
3. B	Q2KJH4	WD repeat-containing protein 1	7.63e-06	NA	1.02e-06
3. B	G8SD34	NAD(+) hydrolase ApTIR	1.14e-13	NA	1.99e-21
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	2.39e-09	NA	1.35e-10
3. B	Q756D0	Ribosome biogenesis protein YTM1	2.14e-09	NA	0.002
3. B	Q58E77	WD repeat-containing protein 82-B	0.00e+00	NA	8.77e-06
3. B	O42469	Transducin-like enhancer protein 1	7.37e-09	NA	1.81e-07
3. B	Q5RFQ4	WD repeat-containing protein 72	1.30e-03	NA	0.035
3. B	Q9W7F2	WD repeat-containing protein 1-A	6.92e-07	NA	1.25e-06
3. B	B0BNA7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.05e-05
3. B	D5GBI7	Nuclear distribution protein PAC1	1.98e-14	NA	4.54e-20
3. B	Q9XWH0	Mitotic checkpoint protein bub-3	1.11e-16	NA	0.001
3. B	Q9BQA1	Methylosome protein 50	2.66e-14	NA	0.046
3. B	P0CS51	Protein transport protein SEC13	5.18e-13	NA	0.042
3. B	Q13033	Striatin-3	2.75e-08	NA	2.69e-05
3. B	Q4WP10	Ribosome biogenesis protein ytm1	3.82e-07	NA	4.58e-05
3. B	O89053	Coronin-1A	6.45e-07	NA	7.22e-05
3. B	P0CS49	Pre-mRNA-splicing factor PRP46	2.04e-11	NA	2.78e-14
3. B	Q5RHI5	Denticleless protein homolog	5.91e-08	NA	1.14e-06
3. B	O74855	Ribosome assembly protein 4	4.32e-09	NA	2.30e-26
3. B	O43815	Striatin	7.92e-08	NA	8.85e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	1.03e-07	NA	3.37e-17
3. B	P93563	Guanine nucleotide-binding protein subunit beta	6.33e-15	NA	2.57e-12
3. B	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	8.55e-15	NA	4.56e-04
3. B	Q9C827	Coatomer subunit beta'-2	7.90e-07	NA	8.29e-09
3. B	Q2UBU2	Protein HIR1	4.79e-05	NA	3.17e-08
3. B	B4Q9T6	Ribosome biogenesis protein WDR12 homolog	3.78e-11	NA	1.40e-10
3. B	Q7PP77	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.14e-05
3. B	Q6FWT9	Nuclear distribution protein PAC1	2.18e-11	NA	5.09e-04
3. B	A6QM06	Sterol regulatory element-binding protein cleavage-activating protein	7.06e-03	NA	1.16e-04
3. B	Q9LJN8	Mitotic checkpoint protein BUB3.1	0.00e+00	NA	3.81e-04
3. B	P0CS32	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.03e-05
3. B	Q4IBR4	Protein HIR1	1.38e-07	NA	8.41e-06
3. B	Q3MHE2	U4/U6 small nuclear ribonucleoprotein Prp4	3.11e-10	NA	4.99e-15
3. B	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	1.17e-08
3. B	Q1DZQ0	Protein transport protein SEC13	4.00e-15	NA	0.003
3. B	Q6FNV4	Protein transport protein SEC13-1	4.55e-15	NA	0.001
3. B	Q7T0P4	POC1 centriolar protein homolog A	7.01e-12	NA	4.07e-19
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	3.18e-09	NA	1.39e-12
3. B	Q9BVC4	Target of rapamycin complex subunit LST8	3.33e-14	NA	2.05e-12
3. B	P91343	Ribosome biogenesis protein WDR12 homolog	8.86e-10	NA	2.29e-06
3. B	Q40507	Guanine nucleotide-binding protein subunit beta	2.11e-15	NA	8.06e-12
3. B	Q9C2I5	Ribosome biogenesis protein ytm1	4.12e-09	NA	4.98e-04
3. B	B0WYR6	WD repeat-containing protein on Y chromosome	1.99e-05	NA	4.34e-08
3. B	P47025	Mitochondrial division protein 1	1.70e-07	NA	2.06e-07
3. B	Q9UTC7	Uncharacterized WD repeat-containing protein C227.12	5.61e-11	NA	8.63e-21
3. B	C5DF48	Nuclear distribution protein PAC1	4.49e-12	NA	0.009
3. B	Q9NWT1	p21-activated protein kinase-interacting protein 1	3.63e-09	NA	1.12e-04
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	7.92e-07	NA	1.35e-18
3. B	Q99ME2	WD repeat-containing protein 6	3.19e-05	NA	4.37e-04
3. B	Q6UXN9	WD repeat-containing protein 82	0.00e+00	NA	1.70e-05
3. B	P39014	F-box protein MET30	7.81e-07	NA	6.00e-11
3. B	Q9P7I3	Mitochondrial division protein 1	4.08e-07	NA	4.83e-07
3. B	P0CS48	Pre-mRNA-splicing factor PRP46	5.67e-11	NA	6.68e-14
3. B	Q6CB13	Mitochondrial division protein 1	7.79e-11	NA	1.04e-08
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	6.12e-08	NA	4.29e-05
3. B	Q6CI08	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	6.89e-05
3. B	F1LTR1	WD repeat-containing protein 26	1.05e-14	NA	0.001
3. B	Q9P7C0	Uncharacterized WD repeat-containing protein C2E1P5.05	2.96e-08	NA	4.89e-05
3. B	Q17GR9	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	4.00e-09
3. B	Q54PP7	BEACH domain-containing protein lvsF	6.55e-06	NA	2.29e-05
3. B	Q9UM11	Fizzy-related protein homolog	3.06e-07	NA	1.22e-06
3. B	Q8TC44	POC1 centriolar protein homolog B	1.60e-13	NA	2.05e-18
3. B	Q6FQU6	Protein transport protein SEC13-2	1.33e-15	NA	0.004
3. B	Q12770	Sterol regulatory element-binding protein cleavage-activating protein	3.71e-03	NA	3.06e-04
3. B	B3RNR8	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	8.43e-07
3. B	P53024	Protein transport protein SEC13	1.22e-15	NA	9.50e-08
3. B	P0CS38	Protein HIR1	1.32e-08	NA	5.66e-12
3. B	P25635	Periodic tryptophan protein 2	2.43e-06	NA	5.76e-13
3. B	P63244	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	Q6DTM3	Jouberin	6.93e-05	NA	0.006
3. B	B4QHG6	Lissencephaly-1 homolog	0.00e+00	NA	4.35e-20
3. B	Q9D2V7	Coronin-7	1.14e-04	NA	2.17e-08
3. B	B7PY76	Ribosome biogenesis protein WDR12 homolog	1.40e-09	NA	3.13e-07
3. B	Q9DC48	Pre-mRNA-processing factor 17	3.09e-08	NA	4.08e-14
3. B	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.57e-05
3. B	Q23256	WD repeat-containing protein wdr-5.3	3.93e-11	NA	3.68e-21
3. B	Q4R2Z6	WD repeat-containing protein 48	1.54e-08	NA	1.56e-12
3. B	C4YFX2	Transcriptional repressor TUP1	9.44e-12	NA	1.88e-22
3. B	Q6FVD3	Protein HIR1	7.26e-10	NA	7.33e-12
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	3.69e-06	NA	4.35e-35
3. B	Q8T088	WD repeat-containing protein 55 homolog	3.11e-09	NA	3.29e-08
3. B	Q9DAW6	U4/U6 small nuclear ribonucleoprotein Prp4	3.78e-10	NA	5.17e-15
3. B	Q965S8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.31e-04
3. B	A7Z052	WD repeat-containing protein 6	3.67e-04	NA	2.54e-04
3. B	P07834	Cell division control protein 4	4.05e-05	NA	5.36e-10
3. B	Q55E54	Coronin-B	9.01e-05	NA	0.001
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	2.42e-09	NA	2.22e-15
3. B	P43254	E3 ubiquitin-protein ligase COP1	6.38e-06	NA	0.002
3. B	Q9CAA0	Coatomer subunit beta'-1	8.25e-07	NA	1.59e-08
3. B	P0CS46	Polyadenylation factor subunit 2	1.63e-07	NA	3.54e-06
3. B	Q04725	Transducin-like enhancer protein 2	1.35e-08	NA	9.33e-06
3. B	P78706	Transcriptional repressor rco-1	2.11e-10	NA	5.65e-25
3. B	Q6RI45	Bromodomain and WD repeat-containing protein 3	9.70e-04	NA	5.19e-07
3. B	Q4R4I8	Coatomer subunit beta'	6.05e-07	NA	9.61e-10
3. B	B4KT48	Lissencephaly-1 homolog	0.00e+00	NA	1.71e-19
3. B	A5DL92	Ribosome biogenesis protein YTM1	7.01e-10	NA	0.029
3. B	Q21215	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	NA	1.36e-20
3. B	Q4R4J2	Coronin-1A	3.90e-07	NA	6.81e-06
3. B	Q9EPV5	Apoptotic protease-activating factor 1	5.83e-06	NA	1.17e-16
3. B	Q96P53	WD repeat and FYVE domain-containing protein 2	2.69e-10	NA	7.30e-11
3. B	D9N129	WD repeat-containing protein 20 homolog	2.06e-03	NA	0.023
3. B	O35242	Protein FAN	7.62e-08	NA	2.07e-10
3. B	B0FXQ5	WD repeat-containing protein on Y chromosome	1.59e-04	NA	1.38e-04
3. B	O13985	Uncharacterized WD repeat-containing protein C26H5.03	2.27e-11	NA	4.77e-04
3. B	Q9PTR5	Lissencephaly-1 homolog	0.00e+00	NA	8.27e-20
3. B	O24456	Receptor for activated C kinase 1A	0.00e+00	NA	2.03e-19
3. B	Q9EQ15	Guanine nucleotide-binding protein subunit beta-like protein 1	0.00e+00	NA	0.003
3. B	P0CS37	Histone acetyltransferase type B subunit 2	4.55e-15	NA	1.24e-04
3. B	Q3TLR7	Denticleless protein homolog	2.94e-07	NA	1.80e-05
3. B	P62883	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.73e-12
3. B	Q6H8D5	Coatomer subunit beta'-2	6.44e-07	NA	2.34e-08
3. B	Q6CJ50	Mitochondrial division protein 1	1.40e-06	NA	3.50e-08
3. B	Q0CQ54	Protein hir1	9.30e-05	NA	3.58e-07
3. B	Q9AUR7	Coatomer subunit alpha-2	9.21e-10	NA	5.10e-12
3. B	Q8CBE3	WD repeat-containing protein 37	3.39e-09	NA	4.75e-05
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	2.06e-10	NA	3.44e-15
3. B	Q9UMS4	Pre-mRNA-processing factor 19	3.85e-12	NA	1.15e-14
3. B	P16649	General transcriptional corepressor TUP1	9.93e-09	NA	2.96e-23
3. B	Q9QZD9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.10e-05
3. B	Q55FR9	Coatomer subunit alpha	3.41e-10	NA	6.13e-10
3. B	Q96S15	GATOR complex protein WDR24	5.20e-06	NA	8.34e-05
3. B	Q8RXA7	DENN domain and WD repeat-containing protein SCD1	9.51e-05	NA	8.04e-14
3. B	B7FF09	WD repeat-containing protein on Y chromosome	1.37e-05	NA	0.001
3. B	O80990	Protein CIA1	0.00e+00	NA	1.38e-11
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	1.57e-07	NA	7.80e-05
3. B	Q0CJD8	Mitochondrial division protein 1	8.60e-06	NA	5.26e-08
3. B	Q04726	Transducin-like enhancer protein 3	9.32e-08	NA	3.63e-07
3. B	O88466	Zinc finger protein 106	3.85e-03	NA	4.89e-06
3. B	Q5SUS0	F-box/WD repeat-containing protein 10	1.29e-03	NA	2.65e-07
3. B	Q9H7D7	WD repeat-containing protein 26	7.65e-13	NA	4.40e-04
3. B	Q9BQ87	F-box-like/WD repeat-containing protein TBL1Y	8.32e-08	NA	3.40e-16
3. B	Q5ZJW8	Denticleless protein homolog	1.55e-08	NA	1.50e-07
3. B	P38011	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	2.44e-16
3. B	A8XSW2	WD repeat-containing protein 48 homolog	2.09e-07	NA	1.67e-06
3. B	Q54DS4	WD repeat-containing protein DDB_G0292056	3.00e-03	NA	2.65e-05
3. B	Q9JIT3	Transducin-like enhancer protein 3	4.62e-08	NA	3.10e-07
3. B	A4IIX9	WD repeat-containing protein 37	2.62e-09	NA	8.35e-05
3. B	A0JPH4	Sterol regulatory element-binding protein cleavage-activating protein	2.65e-03	NA	0.005
3. B	O35828	Coronin-7	1.20e-04	NA	1.84e-08
3. B	P63247	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	Q9SZQ5	WD repeat-containing protein VIP3	0.00e+00	NA	1.07e-09
3. B	Q4X0A9	Probable E3 ubiquitin ligase complex SCF subunit sconB	8.40e-08	NA	1.31e-19
3. B	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	9.17e-08
3. B	Q99KP6	Pre-mRNA-processing factor 19	8.44e-15	NA	2.27e-14
3. B	P93398	Guanine nucleotide-binding protein subunit beta-2	3.44e-15	NA	4.37e-12
3. B	Q27954	Coatomer subunit alpha	8.12e-08	NA	7.53e-08
3. B	Q5RAW8	WD repeat-containing protein 48	2.63e-07	NA	1.82e-12
3. B	Q5BJQ6	Cleavage stimulation factor subunit 1	1.32e-12	NA	4.19e-11
3. B	B5DG67	Ribosome biogenesis protein wdr12	1.58e-10	NA	1.45e-07
3. B	Q24371	Protein lethal(2)denticleless	4.56e-06	NA	2.63e-04
3. B	Q5XIG8	Serine-threonine kinase receptor-associated protein	2.89e-15	NA	1.40e-07
3. B	Q5XI13	Glutamate-rich WD repeat-containing protein 1	8.61e-10	NA	4.25e-07
3. B	P14197	WD repeat-containing protein AAC3	8.98e-11	NA	3.59e-07
3. B	Q6GM65	Phospholipase A-2-activating protein	3.01e-06	NA	1.13e-04
3. B	Q16K15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.93e-06
3. B	Q9FNN2	WD repeat-containing protein 26 homolog	4.85e-14	NA	1.30e-15
3. B	Q7KNS3	Lissencephaly-1 homolog	0.00e+00	NA	4.35e-20
3. B	A2RRU4	Sterol regulatory element-binding protein cleavage-activating protein	9.19e-04	NA	6.34e-05
3. B	Q9V3J8	Protein will die slowly	4.36e-12	NA	6.83e-27
3. B	Q9FN19	WD40 repeat-containing protein HOS15	5.52e-08	NA	5.48e-11
3. B	Q6GPC6	F-box-like/WD repeat-containing protein TBL1XR1-B	1.46e-08	NA	3.94e-12
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	1.15e-08	NA	1.30e-16
3. B	B4HRQ6	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.76e-11
3. B	Q7RZF5	Protein transport protein sec13	3.89e-15	NA	2.28e-06
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	1.19e-09	NA	7.69e-15
3. B	Q6KAU8	Protein Atg16l2	3.97e-09	NA	5.54e-09
3. B	Q7PS24	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	2.13e-11
3. B	Q28YY2	WD repeat-containing protein 48 homolog	3.63e-07	NA	1.48e-10
3. B	Q6FLI3	CCR4-associated factor 4 homolog	1.29e-08	NA	6.40e-08
3. B	Q86W42	THO complex subunit 6 homolog	2.73e-12	NA	0.004
3. B	Q2TZG4	Polyadenylation factor subunit 2	8.29e-09	NA	1.65e-06
3. B	Q9XSC3	WD repeat-containing protein 44	2.10e-06	NA	2.54e-04
3. B	O48847	Transcriptional corepressor LEUNIG_HOMOLOG	4.10e-08	NA	2.62e-12
3. B	Q9ULV4	Coronin-1C	2.39e-06	NA	1.45e-04
3. B	Q6CG48	Nuclear distribution protein PAC1	1.03e-12	NA	1.33e-11
3. B	P39946	Nuclear distribution protein PAC1	2.27e-11	NA	3.77e-04
3. B	Q5E9A4	mRNA export factor	2.37e-11	NA	0.004
3. B	A4RJV3	Mitochondrial division protein 1	1.13e-07	NA	4.21e-05
3. B	B0Y5V6	Ribosome biogenesis protein ytm1	5.53e-07	NA	4.58e-05
3. B	A7TH19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.37e-05
3. B	Q29L19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.57e-05
3. B	P79083	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.21e-06
3. B	Q5R8K2	Cleavage stimulation factor subunit 1	1.27e-12	NA	6.53e-10
3. B	Q5SP67	WD repeat-containing protein 26	5.37e-10	NA	1.02e-04
3. B	Q32LP9	Coronin-2A	2.51e-06	NA	0.001
3. B	P62884	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.73e-12
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	1.80e-12	NA	7.06e-14
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	2.62e-07	NA	1.48e-13
3. B	Q54IY5	Component of gems protein 5	9.89e-04	NA	0.009
3. B	Q9SRI1	Protein transport protein SEC13 homolog A	3.33e-16	NA	0.027
3. B	C4Q0P6	Lissencephaly-1 homolog	1.11e-14	NA	1.04e-20
3. B	O22212	U4/U6 small nuclear ribonucleoprotein PRP4-like protein	8.23e-10	NA	2.39e-21
3. B	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.72e-04
3. B	Q6Q0C0	E3 ubiquitin-protein ligase TRAF7	1.35e-10	NA	1.84e-09
3. B	O43684	Mitotic checkpoint protein BUB3	0.00e+00	NA	3.98e-04
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	9.69e-07	NA	5.38e-09
3. B	O95170	CMT1A duplicated region transcript 1 protein	4.79e-05	NA	1.33e-06
3. B	B0X2V9	WD repeat-containing protein 48 homolog	2.17e-07	NA	3.30e-08
3. B	Q32KQ2	WD repeat-containing protein 53	0.00e+00	NA	0.002
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	3.07e-05	NA	3.47e-10
3. B	Q6BYU4	Protein HIR1	1.01e-07	NA	7.45e-08
3. B	B4MU54	Ribosome biogenesis protein WDR12 homolog	1.06e-09	NA	7.35e-10
3. B	P41838	Poly(A)+ RNA export protein	3.60e-13	NA	4.46e-06
3. B	Q6GQT6	Sterol regulatory element-binding protein cleavage-activating protein	2.74e-03	NA	1.75e-04
3. B	Q4V837	Denticleless protein homolog A	2.73e-07	NA	8.71e-06
3. B	Q9Y263	Phospholipase A-2-activating protein	3.88e-08	NA	9.01e-08
3. B	Q09731	UBP9-binding protein bun107	2.19e-06	NA	6.87e-10
3. B	O88342	WD repeat-containing protein 1	7.93e-06	NA	9.31e-08
3. B	Q759L2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.35e-05
3. B	Q0CY32	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.65e-08	NA	4.35e-19
3. B	Q4PCB8	Protein transport protein SEC13	8.58e-10	NA	1.80e-04
3. B	Q28DW0	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	2.25e-06
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	6.15e-08	NA	3.27e-20
3. B	Q9GZS3	WD repeat-containing protein 61	0.00e+00	NA	9.52e-13
3. B	Q8NHV4	Protein NEDD1	2.14e-10	NA	1.17e-05
3. B	Q6CU59	Ribosome biogenesis protein YTM1	2.92e-09	NA	2.89e-05
3. B	Q9URY0	Ribosome biogenesis protein ytm1	9.89e-10	NA	0.041
3. B	Q922V4	Pleiotropic regulator 1	3.18e-10	NA	5.38e-09
3. B	Q5ZMV7	WD repeat-containing protein 82	0.00e+00	NA	5.60e-06
3. B	Q9Z2K5	Target of rapamycin complex subunit LST8	0.00e+00	NA	7.50e-11
3. B	P40066	mRNA export factor GLE2	1.67e-12	NA	5.53e-05
3. B	Q6GPU3	Denticleless protein homolog B	3.98e-07	NA	2.13e-05
3. B	Q05AM5	Elongator complex protein 2	1.17e-05	NA	0.001
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	6.00e-12	NA	5.20e-14
3. B	Q75LV5	U3 snoRNP-associated protein-like YAOH	2.70e-09	NA	3.00e-13
3. B	Q13112	Chromatin assembly factor 1 subunit B	2.93e-12	NA	1.06e-08
3. B	P79987	Protein HIRA	3.87e-06	NA	0.002
3. B	P93107	Flagellar WD repeat-containing protein Pf20	1.11e-10	NA	4.25e-13
3. B	A6R3K5	Ribosome biogenesis protein YTM1	1.72e-09	NA	1.18e-04
3. B	Q04724	Transducin-like enhancer protein 1	8.99e-09	NA	5.00e-07
3. B	Q54QU5	WD repeat-containing protein 89 homolog	3.00e-10	NA	2.18e-04
3. B	Q1JQB2	Mitotic checkpoint protein BUB3	0.00e+00	NA	3.96e-04
3. B	Q7T394	Lissencephaly-1 homolog A	0.00e+00	NA	5.76e-20
3. B	Q7ZXK9	Notchless protein homolog 1	1.32e-08	NA	2.12e-18
3. B	Q5RAC9	Autophagy-related protein 16-1	7.88e-12	NA	1.24e-10
3. B	D3Z902	F-box/WD repeat-containing protein 7	4.29e-06	NA	7.93e-25
3. B	O08653	Telomerase protein component 1	7.23e-04	NA	2.88e-08
3. B	Q09715	Transcriptional repressor tup11	1.34e-09	NA	3.25e-24
3. B	Q1HPW4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.06e-04
3. B	Q9R037	WD repeat-containing protein 44	1.51e-06	NA	1.64e-04
3. B	Q7S8R5	Mitochondrial division protein 1	1.27e-07	NA	1.69e-05
3. B	Q9LV27	Target of rapamycin complex subunit LST8-1	0.00e+00	NA	4.30e-16
3. B	Q9FND4	WD repeat-containing protein WDS homolog	2.78e-15	NA	1.01e-13
3. B	A2QHM1	Protein transport protein sec13	1.93e-14	NA	5.82e-05
3. B	B4MY65	Lissencephaly-1 homolog	0.00e+00	NA	3.11e-20
3. B	Q7SZM9	F-box-like/WD repeat-containing protein TBL1XR1-A	6.99e-09	NA	3.31e-12
3. B	Q93ZG3	WD repeat-containing protein ATCSA-1	1.21e-12	NA	3.23e-05
3. B	Q2HHH2	DNA damage-binding protein CMR1	7.15e-08	NA	9.81e-05
3. B	Q08122	Transducin-like enhancer protein 3	5.96e-08	NA	3.51e-07
3. B	A4R7U3	Probable cytosolic iron-sulfur protein assembly protein 1	1.55e-15	NA	1.49e-05
3. B	Q62441	Transducin-like enhancer protein 4	1.11e-08	NA	4.25e-07
3. B	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	0.00e+00	NA	4.60e-16
3. B	Q91WM3	U3 small nucleolar RNA-interacting protein 2	1.84e-09	NA	1.65e-12
3. B	B4Q354	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.69e-05
3. B	P26309	APC/C activator protein CDC20	1.44e-06	NA	0.025
3. B	Q7RZI0	Protein hir-1	4.68e-06	NA	1.38e-06
3. B	Q4P553	Histone acetyltransferase type B subunit 2	3.00e-15	NA	5.76e-05
3. B	Q5AZX0	Polyadenylation factor subunit 2	8.23e-08	NA	5.07e-06
3. B	Q0CCS0	Probable cytosolic iron-sulfur protein assembly protein 1	1.82e-11	NA	1.28e-07
3. B	Q9AV81	Pre-mRNA-processing factor 19	8.26e-11	NA	8.44e-11
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	1.87e-10	NA	7.74e-15
3. B	Q8BHB4	WD repeat-containing protein 3	8.24e-06	NA	2.25e-16
3. B	P87053	F-box/WD repeat-containing protein pof1	7.02e-08	NA	4.64e-15
3. B	Q8C4J7	Transducin beta-like protein 3	1.19e-06	NA	8.69e-12
3. B	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.49e-18
3. B	Q6ZMW3	Echinoderm microtubule-associated protein-like 6	5.09e-04	NA	2.78e-09
3. B	Q9JJ66	Cell division cycle protein 20 homolog	3.45e-08	NA	3.56e-10
3. B	Q9W328	Protein LST8 homolog	2.44e-15	NA	3.74e-17
3. B	O13166	Transducin-like enhancer protein 3-A	6.14e-09	NA	2.99e-07
3. B	A0A2R8QFQ6	F-box and WD repeat domain-containing 11-A	3.79e-08	NA	1.02e-16
3. B	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	1.59e-19
3. B	Q6PA72	Target of rapamycin complex subunit lst8	0.00e+00	NA	1.04e-12
3. B	Q9XW12	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	7.88e-06
3. B	Q0DYP5	Zinc finger CCCH domain-containing protein 17	1.06e-07	NA	0.020
3. B	C5MIB1	Restriction of telomere capping protein 1	8.32e-05	NA	0.017
3. B	Q5RB58	Mitotic checkpoint protein BUB3	0.00e+00	NA	5.58e-04
3. B	Q7ZX22	GATOR complex protein WDR24	3.45e-06	NA	2.93e-04
3. B	A9VDW7	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	1.98e-08	NA	6.15e-04
3. B	Q9ZU34	Actin-interacting protein 1-1	1.17e-05	NA	1.42e-06
3. B	P38129	Transcription initiation factor TFIID subunit 5	4.21e-09	NA	1.28e-14
3. B	P27133	Coronin-A	2.87e-06	NA	1.36e-06
3. B	P0CY34	Transcriptional repressor TUP1	5.67e-12	NA	1.89e-22
3. B	Q2GXT0	Ribosome biogenesis protein YTM1	4.94e-13	NA	8.98e-04
3. B	B0XTS1	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.83e-08	NA	1.31e-19
3. B	Q8CGF6	WD repeat-containing protein 47	4.17e-08	NA	1.10e-04
3. B	Q6S003	Kinesin-related protein 8	7.71e-03	NA	5.19e-04
3. B	O14053	U3 small nucleolar RNA-associated protein 21 homolog	9.85e-06	NA	0.003
3. B	B3MVL6	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.18e-05
3. B	B4KTK4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.62e-08
3. B	E3LB80	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.74e-07
3. B	Q920M5	Coronin-6	3.83e-07	NA	1.38e-05
3. B	Q75BS7	DNA damage-binding protein CMR1	6.66e-07	NA	9.54e-05
3. B	Q5F201	Cilia- and flagella-associated protein 52	1.09e-14	NA	2.38e-08
3. B	Q5NVD0	U4/U6 small nuclear ribonucleoprotein Prp4	2.18e-10	NA	7.19e-15
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	1.10e-06	NA	1.10e-13
3. B	O94319	Protein transport protein sec13	7.77e-16	NA	3.86e-04
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	1.49e-07	NA	5.75e-14
3. B	Q66J51	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.77e-06
3. B	P93471	E3 ubiquitin-protein ligase COP1	2.06e-07	NA	3.00e-04
3. B	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	4.98e-07
3. B	B4F7L9	WD repeat-containing protein on Y chromosome	3.16e-04	NA	2.29e-04
3. B	Q803D2	Lissencephaly-1 homolog B	0.00e+00	NA	5.78e-18
3. B	E9Q4P1	WD repeat and FYVE domain-containing protein 1	1.67e-09	NA	2.32e-12
3. B	Q9UNX4	WD repeat-containing protein 3	2.42e-06	NA	5.47e-16
3. B	Q54WA3	Peroxisomal targeting signal 2 receptor	0.00e+00	NA	1.42e-08
3. B	Q9AUR8	Coatomer subunit alpha-1	4.89e-10	NA	9.31e-12
3. B	A6H603	NACHT domain- and WD repeat-containing protein 1	1.56e-04	NA	0.005
3. B	Q8IV35	WD repeat-containing protein 49	3.04e-06	NA	0.001
3. B	Q8JZX3	POC1 centriolar protein homolog A	1.11e-16	NA	9.19e-19
3. B	Q9QXL1	Kinesin-like protein KIF21B	3.89e-04	NA	0.005
3. B	Q09589	Protein HIRA	3.21e-06	NA	0.042
3. B	Q6ED65	Echinoderm microtubule-associated protein-like 5	2.97e-03	NA	2.68e-08
3. B	P40968	Pre-mRNA-processing factor 17	4.23e-10	NA	1.19e-12
3. B	Q2KIY3	WD repeat and FYVE domain-containing protein 1	4.04e-10	NA	3.54e-13
3. B	Q12024	Ribosome biogenesis protein YTM1	7.35e-08	NA	1.63e-05
3. B	A8PD13	Ribosome biogenesis protein YTM1	1.90e-09	NA	7.88e-06
3. B	O24076	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.86e-18
3. B	Q8NBT0	POC1 centriolar protein homolog A	1.55e-15	NA	1.10e-17
3. B	Q3B7M6	Protein NEDD1	2.17e-09	NA	1.31e-05
3. B	Q294Y7	WD repeat-containing protein 55 homolog	9.50e-09	NA	3.88e-08
3. B	Q3U3T8	WD repeat-containing protein 62	2.56e-03	NA	5.06e-07
3. B	Q9WUM4	Coronin-1C	5.13e-07	NA	8.15e-05
3. B	Q3SWX8	Histone-binding protein RBBP7	1.89e-15	NA	8.40e-07
3. B	A7RM20	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.82e-05
3. B	F1M5N7	Kinesin-like protein KIF21B	6.78e-04	NA	0.004
3. B	Q8C570	mRNA export factor	2.36e-11	NA	0.004
3. B	F6ZT52	POC1 centriolar protein homolog B	1.75e-11	NA	2.54e-22
3. B	Q9XF57	Peroxisome biogenesis protein 7	0.00e+00	NA	3.83e-05
3. B	Q76B40	WD40 repeat-containing protein SMU1	5.45e-11	NA	2.11e-14
3. B	Q9BRP4	Proteasomal ATPase-associated factor 1	8.68e-11	NA	4.23e-13
3. B	Q9LJR3	Protein SPA1-RELATED 3	4.14e-06	NA	6.04e-07
3. B	Q54HW5	Guanine nucleotide-binding protein subunit beta-like protein 1 homolog	1.02e-12	NA	0.010
3. B	Q8C0J2	Autophagy-related protein 16-1	2.22e-08	NA	3.24e-11
3. B	P35605	Coatomer subunit beta'	5.40e-07	NA	1.17e-09
3. B	Q5B4R1	Ribosome biogenesis protein ytm1	1.77e-09	NA	5.52e-04
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	2.34e-03	NA	3.21e-24
3. B	A2AHJ4	Bromodomain and WD repeat-containing protein 3	1.79e-03	NA	3.23e-07
3. B	B4JW81	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	2.23e-07
3. B	B5DHW4	WD repeat-containing protein on Y chromosome	4.15e-05	NA	0.003
3. B	B3NSK1	WD repeat-containing protein 48 homolog	2.58e-09	NA	3.53e-11
3. B	Q0J7U6	Protein TOPLESS-RELATED PROTEIN 2	4.19e-05	NA	0.028
3. B	Q7ZVF0	POC1 centriolar protein homolog A	0.00e+00	NA	1.57e-21
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	9.21e-09	NA	4.28e-17
3. B	Q5XUX1	F-box/WD repeat-containing protein 9	1.39e-09	NA	0.009
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	0.030
3. B	C4YPI7	Nuclear distribution protein PAC1	1.93e-12	NA	1.22e-12
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	1.55e-10	NA	2.40e-15
3. B	B4HND9	WD repeat-containing protein 48 homolog	1.88e-08	NA	6.83e-12
3. B	Q2T9T9	F-box/WD repeat-containing protein 9	1.33e-08	NA	0.005
3. B	Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1	1.29e-08	NA	4.20e-12
3. B	Q922B6	E3 ubiquitin-protein ligase TRAF7	1.55e-11	NA	2.82e-09
3. B	Q5EBD9	Elongator complex protein 2	2.95e-05	NA	0.025
3. B	Q8R2U0	Nucleoporin SEH1	5.01e-10	NA	5.75e-04
3. B	Q5B8Y3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.06e-06
3. B	Q7ZWF0	mRNA export factor	5.41e-12	NA	1.41e-04
3. B	Q9FNZ1	Zinc finger CCCH domain-containing protein 63	1.00e-08	NA	0.004
3. B	Q6DIF4	WD repeat-containing protein 1	2.15e-05	NA	2.26e-06
3. B	Q803V5	Target of rapamycin complex subunit lst8	1.11e-16	NA	7.90e-13
3. B	O02195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.91e-05
3. B	Q9NZJ0	Denticleless protein homolog	4.94e-07	NA	7.93e-05
3. B	Q99LC2	Cleavage stimulation factor subunit 1	5.58e-13	NA	4.19e-11
3. B	P31146	Coronin-1A	4.16e-07	NA	1.61e-04
3. B	Q54DM1	Mitotic checkpoint protein bub3	0.00e+00	NA	0.005
3. B	A0A1L8HX76	WD repeat-containing protein 18	1.17e-08	NA	8.91e-09
3. B	P0CS31	Probable cytosolic iron-sulfur protein assembly protein 1	1.22e-15	NA	6.12e-04
3. B	Q9BR76	Coronin-1B	3.63e-07	NA	0.001
3. B	Q6ZD63	Chromatin assembly factor 1 subunit FAS2 homolog	8.48e-13	NA	2.94e-11
3. B	O02482	Transcription factor unc-37	5.45e-10	NA	0.001
3. B	Q5FVN8	WD repeat, SAM and U-box domain-containing protein 1	3.11e-15	NA	1.68e-16
3. B	B4GIJ0	WD repeat-containing protein 48 homolog	3.07e-08	NA	1.48e-10
3. B	Q6QEF8	Coronin-6	6.09e-07	NA	4.79e-06
3. B	Q54SF9	Myosin heavy chain kinase D	1.25e-06	NA	1.75e-11
3. B	Q1DJF7	Ribosome biogenesis protein YTM1	5.60e-07	NA	1.62e-04
3. B	G0SA60	Protein transport protein SEC13	9.99e-15	NA	3.03e-06
3. B	Q2UG43	Protein transport protein sec13	5.34e-14	NA	3.16e-04
3. B	Q291L9	Lissencephaly-1 homolog	0.00e+00	NA	2.04e-19
3. B	Q96WV5	Putative coatomer subunit alpha	4.55e-08	NA	1.89e-09
3. B	P49026	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	8.70e-17
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	3.92e-09	NA	7.50e-11
3. B	B7FF12	WD repeat-containing protein on Y chromosome	3.45e-04	NA	2.25e-04
3. B	Q9N4A7	Protein SEC13 homolog	4.23e-08	NA	2.45e-04
3. B	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	7.54e-11	NA	7.74e-08
3. B	A7ECP3	Ribosome biogenesis protein ytm1	5.98e-12	NA	0.001
3. B	Q6DJD8	Coronin-2B	1.34e-06	NA	0.015
3. B	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	7.75e-20
3. B	G5EEG7	Smu-1 suppressor of mec-8 and unc-52 protein	1.21e-13	NA	2.55e-11
3. B	Q8L3Z8	Protein FIZZY-RELATED 2	2.87e-07	NA	2.65e-04
3. B	P90587	66 kDa stress protein	6.92e-06	NA	8.67e-12
3. B	Q38942	Protein RAE1	0.00e+00	NA	0.001
3. B	G0SEA3	mRNA export factor GLE2	8.09e-13	NA	6.29e-04
3. B	Q5I0B4	Target of rapamycin complex subunit lst8	0.00e+00	NA	9.85e-13
3. B	Q2GT28	Nuclear distribution protein PAC1-2	4.50e-14	NA	3.38e-16
3. B	Q8MY12	Myosin heavy chain kinase C	3.15e-07	NA	1.30e-13
3. B	A7EF03	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	7.89e-04
3. B	P97499	Telomerase protein component 1	8.46e-03	NA	1.03e-08
3. B	Q94BR4	Pre-mRNA-processing factor 19 homolog 1	2.65e-11	NA	4.73e-11
3. B	A7TMF9	Ribosome biogenesis protein YTM1	3.95e-08	NA	4.20e-04
3. B	Q21624	Coronin-like protein cor-1	2.26e-05	NA	8.62e-04
3. B	Q92828	Coronin-2A	1.98e-06	NA	0.010
3. B	B4QB64	WD repeat-containing protein 48 homolog	1.38e-08	NA	5.06e-12
3. B	Q9D5R2	WD repeat-containing protein 20	7.87e-06	NA	0.013
3. B	Q3MV14	Protein DECREASED SIZE EXCLUSION LIMIT 1	7.31e-12	NA	2.90e-04
3. B	Q8L4M1	THO complex subunit 6	2.56e-14	NA	0.004
3. B	B5X3C4	Lissencephaly-1 homolog B	0.00e+00	NA	5.69e-17
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	1.14e-13	NA	2.50e-14
3. B	Q9WVA3	Mitotic checkpoint protein BUB3	0.00e+00	NA	3.96e-04
3. B	Q2UPI0	Probable cytosolic iron-sulfur protein assembly protein 1	6.66e-16	NA	1.27e-04
3. B	Q5RB07	WD repeat-containing protein 6	4.59e-05	NA	2.54e-04
3. B	Q96JK2	DDB1- and CUL4-associated factor 5	2.86e-06	NA	3.62e-04
3. B	E9Q349	WD repeat-containing protein 25	1.77e-10	NA	1.82e-04
3. B	Q4WTC4	Protein hir1	5.14e-07	NA	1.46e-04
3. B	O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	2.82e-10
3. B	Q10051	Pre-mRNA-processing factor 19	5.87e-11	NA	1.62e-11
3. B	A7RWD2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	3.84e-09
3. B	Q2KJJ5	Transducin beta-like protein 3	9.52e-08	NA	3.40e-12
3. B	Q1DPU4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.53e-05
3. B	Q54D08	Protein LST8 homolog	0.00e+00	NA	1.56e-14
3. B	A1CXL0	Ribosome biogenesis protein ytm1	5.16e-09	NA	8.58e-05
3. B	Q9LF27	Ribosome biogenesis protein WDR12 homolog	2.13e-08	NA	7.81e-06
3. B	Q2KID6	Pleiotropic regulator 1	9.63e-11	NA	4.06e-09
3. B	P38123	COMPASS component SWD3	0.00e+00	NA	2.71e-13
3. B	Q99M63	WD40 repeat-containing protein SMU1	1.54e-08	NA	2.19e-14
3. B	Q6NX08	Ribosome biogenesis protein wdr12	2.74e-09	NA	1.91e-08
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	1.71e-10	NA	3.03e-15
3. B	Q13347	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.89e-05
3. B	Q0UNA9	Protein transport protein SEC13	7.68e-14	NA	0.003
3. B	B3S4I5	Lissencephaly-1 homolog	0.00e+00	NA	1.93e-21
3. B	B4LQ21	Lissencephaly-1 homolog	0.00e+00	NA	1.79e-19
3. B	A8PWQ8	Probable cytosolic iron-sulfur protein assembly protein 1	1.51e-12	NA	2.81e-04
3. B	Q9FKR9	Zinc finger CCCH domain-containing protein 59	1.85e-07	NA	0.023
3. B	Q5XJS5	THO complex subunit 6 homolog	1.05e-14	NA	0.007
3. B	Q9D0N7	Chromatin assembly factor 1 subunit B	4.09e-12	NA	4.57e-09
3. B	Q9UUG8	Transcriptional repressor tup12	1.28e-10	NA	1.46e-29
3. B	B4JPT9	Ribosome biogenesis protein WDR12 homolog	9.91e-14	NA	1.61e-09
3. B	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	1.15e-12
3. B	Q8BQM8	Echinoderm microtubule-associated protein-like 5	4.59e-03	NA	2.10e-08
3. B	P53621	Coatomer subunit alpha	6.62e-10	NA	1.04e-07
3. B	B4MFM2	WD repeat-containing protein 48 homolog	2.39e-07	NA	4.78e-11
3. B	Q552R1	DDB1- and CUL4-associated factor 7 homolog	0.00e+00	NA	0.005
3. B	A5DXE2	Protein transport protein SEC13	1.33e-15	NA	0.005
3. B	Q9VU65	POC1 centriolar protein homolog	1.55e-15	NA	3.37e-15
3. B	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	4.28e-08	NA	7.63e-22
3. B	Q32SG6	Protein HIRA	1.61e-08	NA	9.56e-05
3. B	Q91854	Beta-TrCP	1.78e-07	NA	3.71e-18
3. B	Q6DKP5	WD repeat-containing protein 13	1.46e-08	NA	0.005
3. B	P78798	Peroxisomal targeting signal 2 receptor	0.00e+00	NA	0.015
3. B	Q7ZVL2	GATOR complex protein WDR24	2.13e-06	NA	0.001
3. B	B5X212	Probable cytosolic iron-sulfur protein assembly protein ciao1-B	0.00e+00	NA	1.35e-07
3. B	B4GQJ7	WD repeat-containing protein on Y chromosome	1.66e-05	NA	0.004
3. B	P0CS33	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.03e-05
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	1.41e-08	NA	2.04e-13
3. B	Q96MR6	Cilia- and flagella-associated protein 57	1.19e-04	NA	3.97e-05
3. B	Q74ZN0	Protein HIR1	1.76e-07	NA	5.64e-07
3. B	Q5VQ78	Coatomer subunit beta'-1	6.47e-07	NA	2.14e-13
3. B	A6NE52	WD repeat-containing protein 97	1.41e-02	NA	0.043
3. B	A3LQ86	Ribosome biogenesis protein YTM1	7.91e-08	NA	2.16e-06
3. B	Q15269	Periodic tryptophan protein 2 homolog	9.31e-06	NA	8.71e-09
3. B	Q54S79	WD repeat-containing protein 3 homolog	5.89e-06	NA	2.73e-11
3. B	Q99KN2	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	6.36e-10
3. B	Q54PE0	Periodic tryptophan protein 2 homolog	1.27e-04	NA	1.75e-10
3. B	Q4FZW5	Nucleoporin SEH1-A	1.77e-09	NA	0.002
3. B	Q04491	Protein transport protein SEC13	4.88e-15	NA	7.15e-04
3. B	Q9AYE4	Target of rapamycin complex subunit LST8	0.00e+00	NA	2.01e-18
3. B	B4HSL3	Lissencephaly-1 homolog	0.00e+00	NA	4.35e-20
3. B	P63243	Receptor of activated protein C kinase 1	0.00e+00	NA	1.55e-15
3. B	Q5R7R2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.58e-05
3. B	Q09855	F-box/WD repeat-containing protein pof11	1.15e-07	NA	3.47e-14
3. B	Q9FUY2	Transcriptional corepressor LEUNIG	2.46e-06	NA	1.63e-16
3. B	A6ZYM0	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	1.63e-10
3. B	A3LVM1	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	3.19e-05
3. B	Q5E966	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.89e-05
3. B	Q60584	F-box/WD repeat-containing protein 2	1.89e-08	NA	9.77e-07
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	8.77e-08	NA	4.00e-21
3. B	Q9ERF3	WD repeat-containing protein 61	0.00e+00	NA	2.29e-12
3. B	Q5R650	WD repeat-containing protein 37	1.29e-08	NA	5.64e-05
3. B	B4P116	Ribosome biogenesis protein WDR12 homolog	9.02e-14	NA	8.38e-11
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	1.31e-11	NA	2.00e-14
3. B	Q5M7T1	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	6.59e-10
3. B	Q5BDJ5	Probable cytosolic iron-sulfur protein assembly protein 1	5.32e-13	NA	3.13e-06
3. B	Q7KWK5	Pre-mRNA-processing factor 19	1.34e-10	NA	0.001
3. B	Q6NV31	WD repeat-containing protein 82	0.00e+00	NA	3.73e-05
3. B	Q7QJ33	Ribosome biogenesis protein WDR12 homolog	1.95e-11	NA	9.81e-06
3. B	Q9BQ67	Glutamate-rich WD repeat-containing protein 1	1.77e-09	NA	1.88e-07
3. B	O22468	WD-40 repeat-containing protein MSI2	3.33e-16	NA	8.74e-07
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	4.03e-06	NA	3.29e-10
3. B	Q6CMA2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	1.19e-09
3. B	D3TLL6	Lissencephaly-1 homolog	0.00e+00	NA	1.35e-18
3. B	A8ILK1	Cilia- and flagella-associated protein 52	2.52e-14	NA	7.69e-10
3. B	O94967	WD repeat-containing protein 47	3.41e-07	NA	1.09e-04
3. B	Q2TBP4	POC1 centriolar protein homolog A	1.11e-16	NA	8.10e-18
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	0.00e+00	NA	8.66e-14
3. B	Q55DM1	BEACH domain-containing protein lvsA	NA	NA	0.018
3. B	Q9Y3F4	Serine-threonine kinase receptor-associated protein	1.71e-14	NA	2.07e-07
3. B	Q5SRY7	F-box/WD repeat-containing protein 11	9.94e-14	NA	1.35e-17
3. B	B3N4C7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.16e-05
3. B	G0SFB5	Ribosome biogenesis protein YTM1	2.92e-09	NA	0.007
3. B	P54198	Protein HIRA	4.44e-07	NA	1.72e-04
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	1.58e-10	NA	4.30e-17
3. B	B7PS00	Lissencephaly-1 homolog	0.00e+00	NA	4.39e-23
3. B	B4QFZ8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.16e-11
3. B	A7TLU2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	5.47e-06
3. B	B4JB43	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.98e-06
3. B	Q93794	F-box/WD repeat-containing protein sel-10	2.11e-06	NA	1.19e-20
3. B	Q05BV3	Echinoderm microtubule-associated protein-like 5	2.87e-04	NA	7.67e-08
3. B	Q8NAA4	Protein Atg16l2	1.20e-08	NA	5.44e-08
3. B	Q5AEF2	Protein transport protein SEC13	7.77e-16	NA	0.035
3. B	Q4P2E9	Ribosome biogenesis protein ERB1	3.41e-06	NA	0.022
3. B	Q920J3	Coronin-6	2.11e-06	NA	4.57e-04
3. B	B5X9P2	Probable cytosolic iron-sulfur protein assembly protein ciao1-A	0.00e+00	NA	5.19e-08
3. B	O15736	Protein tipD	3.63e-08	NA	3.30e-14
3. B	Q6C953	Pre-rRNA-processing protein IPI3	1.91e-09	NA	0.045
3. B	P73595	Uncharacterized WD repeat-containing protein slr1410	4.92e-12	NA	1.25e-16
3. B	Q9JJA4	Ribosome biogenesis protein WDR12	1.23e-09	NA	1.71e-08
3. B	Q4RJN5	Lissencephaly-1 homolog	0.00e+00	NA	4.00e-18
3. B	Q6AY87	THO complex subunit 6 homolog	1.01e-14	NA	0.002
3. B	A1CH75	Ribosome biogenesis protein ytm1	1.54e-09	NA	7.07e-04