Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q1DPU4
(Eukaryotic translation initiation factor 3 subunit I) with a FATCAT P-Value: 0.0 and RMSD of 2.33 angstrom. The sequence alignment identity is 16.6%.
Structural alignment shown in left. Query protein Q6ZMY6 colored as red in alignment, homolog Q1DPU4 colored as blue.
Query protein Q6ZMY6 is also shown in right top, homolog Q1DPU4 showed in right bottom. They are colored based on secondary structures.
Q6ZMY6 MASPPRCSPTAHDRECKLPPPSAPASEYCPGKLSWGTMARALGRFKLSIPHTHLLATLDPLALDREPPPHLLPEKHQVPEKLIWGDQDPLSKIPFKILSG 100 Q1DPU4 --------------------------------------------------------------------------------------MRPI------LLQG 8 Q6ZMY6 HEHAVSTCHFCVD-DTKLL-SGSYD---CTVKLWDPVDGSVVRDFE-HRPKAPVVECSITGDSSRVIA--ASYDKTVRAWDLETGKLLWKVRYD--TFIV 190 Q1DPU4 HERSLNQIRFNHDGD--LLFSVAKDKILCA---WYSANGERLGTYHGHQGALWTVDVS-PG--TVLLATGAA-DNTVRLWNAKSGECV-KV-WDFPTAVK 97 Q6ZMY6 SCKFSPDGKYVVS------G-------FDVDHGICIMDAE--NI--TTVSVIKDHHTRSITSCCFDPDSQRVASVS-L---------DRCIKIWDVTSQA 263 Q1DPU4 RVEFSPDGSRLLAVTEKRMGYLGTIVVFDVRYG----DGEGNNLDDQT-----DEPSLKIT-C--EQSKATVAGWSFLGKYIIAGHEDGSVSQYDSKTGE 185 Q6ZMY6 TLLTITKAH--SNAISNCCFTFS-GHFLCTSSWDKNLKIWNVHTGEFRNCGAC--VTLMQG--HEGSVSSCHFA--RDSSFLISGG----FDRTVAIWDV 350 Q1DPU4 QLQNV-QAHEFDYQINDLQFSADRTYFI-TASKDKSAKI--I---------SCRDLQVMKTFVADTPLNTAAITPKKD--FVILGGGQAAMDVTTT--SA 268 Q6ZMY6 AEG------YRKL------SLKGHNDWVMDVAISNNKKWILSASKDRTMRLWNIEEIDEIPLV-IKYKKAVGLKLKQCERCDRPFSIFKSDTSSEMFTQC 437 Q1DPU4 RQGKFEARFYHKIFEDEIGRVRGHFGPLNTIAVHPAGTGYASGGEDGYVR---VHHFDK-PYFDFMYE----VEREKARR-------------------- 340 Q6ZMY6 VFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD 472 Q1DPU4 ----------------------------------- 340
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006336 | DNA replication-independent chromatin assembly |
| 1. PB | GO:0008090 | retrograde axonal transport |
| 1. PB | GO:2000781 | positive regulation of double-strand break repair |
| 1. PB | GO:0005881 | cytoplasmic microtubule |
| 1. PB | GO:0007080 | mitotic metaphase plate congression |
| 1. PB | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 1. PB | GO:0005874 | microtubule |
| 1. PB | GO:0031465 | Cul4B-RING E3 ubiquitin ligase complex |
| 1. PB | GO:0000346 | transcription export complex |
| 1. PB | GO:0001934 | positive regulation of protein phosphorylation |
| 1. PB | GO:0008283 | cell population proliferation |
| 1. PB | GO:0035327 | |
| 1. PB | GO:0070545 | PeBoW complex |
| 1. PB | GO:0042800 | histone methyltransferase activity (H3-K4 specific) |
| 1. PB | GO:0031497 | chromatin assembly |
| 1. PB | GO:0005080 | protein kinase C binding |
| 1. PB | GO:0047496 | vesicle transport along microtubule |
| 1. PB | GO:1902610 | response to N-phenylthiourea |
| 1. PB | GO:0006338 | chromatin remodeling |
| 1. PB | GO:0048705 | skeletal system morphogenesis |
| 1. PB | GO:2000543 | positive regulation of gastrulation |
| 1. PB | GO:0006325 | chromatin organization |
| 1. PB | GO:0006406 | mRNA export from nucleus |
| 1. PB | GO:0010026 | trichome differentiation |
| 1. PB | GO:0071870 | cellular response to catecholamine stimulus |
| 1. PB | GO:0000132 | establishment of mitotic spindle orientation |
| 1. PB | GO:0033186 | CAF-1 complex |
| 1. PB | GO:0043966 | histone H3 acetylation |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:1904851 | positive regulation of establishment of protein localization to telomere |
| 1. PB | GO:2001034 | positive regulation of double-strand break repair via nonhomologous end joining |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:1903260 | protein localization to mating projection tip |
| 1. PB | GO:1903775 | regulation of DNA double-strand break processing |
| 1. PB | GO:1901386 | negative regulation of voltage-gated calcium channel activity |
| 1. PB | GO:0048545 | response to steroid hormone |
| 1. PB | GO:0044666 | MLL3/4 complex |
| 1. PB | GO:0044877 | protein-containing complex binding |
| 1. PB | GO:0005576 | extracellular region |
| 1. PB | GO:1905786 | positive regulation of anaphase-promoting complex-dependent catabolic process |
| 1. PB | GO:0031915 | positive regulation of synaptic plasticity |
| 1. PB | GO:0055087 | Ski complex |
| 1. PB | GO:0008017 | microtubule binding |
| 1. PB | GO:0001826 | inner cell mass cell differentiation |
| 1. PB | GO:0090666 | scaRNA localization to Cajal body |
| 1. PB | GO:1990757 | ubiquitin ligase activator activity |
| 1. PB | GO:0016558 | protein import into peroxisome matrix |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:1904867 | protein localization to Cajal body |
| 1. PB | GO:0045722 | positive regulation of gluconeogenesis |
| 1. PB | GO:1904668 | positive regulation of ubiquitin protein ligase activity |
| 1. PB | GO:0007097 | nuclear migration |
| 1. PB | GO:0007059 | chromosome segregation |
| 1. PB | GO:0000012 | single strand break repair |
| 1. PB | GO:0006283 | transcription-coupled nucleotide-excision repair |
| 1. PB | GO:0110136 | protein-RNA complex remodeling |
| 1. PB | GO:0005815 | microtubule organizing center |
| 1. PB | GO:0051301 | cell division |
| 1. PB | GO:0005847 | mRNA cleavage and polyadenylation specificity factor complex |
| 1. PB | GO:0032040 | small-subunit processome |
| 1. PB | GO:0043981 | histone H4-K5 acetylation |
| 1. PB | GO:0006333 | chromatin assembly or disassembly |
| 1. PB | GO:0048854 | brain morphogenesis |
| 1. PB | GO:0006335 | DNA replication-dependent chromatin assembly |
| 1. PB | GO:0030308 | negative regulation of cell growth |
| 1. PB | GO:0007634 | optokinetic behavior |
| 1. PB | GO:0034511 | U3 snoRNA binding |
| 1. PB | GO:0005782 | peroxisomal matrix |
| 1. PB | GO:0031023 | microtubule organizing center organization |
| 1. PB | GO:0060041 | retina development in camera-type eye |
| 1. PB | GO:0000922 | spindle pole |
| 1. PB | GO:0007219 | Notch signaling pathway |
| 1. PB | GO:0033597 | mitotic checkpoint complex |
| 1. PB | GO:2000114 | regulation of establishment of cell polarity |
| 1. PB | GO:0010997 | anaphase-promoting complex binding |
| 1. PB | GO:0000109 | nucleotide-excision repair complex |
| 1. PB | GO:0042826 | histone deacetylase binding |
| 1. PB | GO:0070840 | dynein complex binding |
| 1. PB | GO:2001162 | positive regulation of histone H3-K79 methylation |
| 1. PB | GO:1905168 | positive regulation of double-strand break repair via homologous recombination |
| 1. PB | GO:0007212 | dopamine receptor signaling pathway |
| 1. PB | GO:0040035 | hermaphrodite genitalia development |
| 1. PB | GO:0005886 | plasma membrane |
| 1. PB | GO:0045879 | negative regulation of smoothened signaling pathway |
| 1. PB | GO:0009792 | embryo development ending in birth or egg hatching |
| 1. PB | GO:0043982 | histone H4-K8 acetylation |
| 1. PB | GO:0035098 | ESC/E(Z) complex |
| 1. PB | GO:2001268 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway |
| 1. PB | GO:0071013 | catalytic step 2 spliceosome |
| 1. PB | GO:0031145 | anaphase-promoting complex-dependent catabolic process |
| 1. PB | GO:0090129 | positive regulation of synapse maturation |
| 1. PB | GO:0009845 | seed germination |
| 1. PB | GO:0090594 | inflammatory response to wounding |
| 1. PB | GO:0048188 | Set1C/COMPASS complex |
| 1. PB | GO:0044297 | cell body |
| 1. PB | GO:0051571 | positive regulation of histone H3-K4 methylation |
| 1. PB | GO:0090181 | regulation of cholesterol metabolic process |
| 1. PB | GO:0005671 | obsolete Ada2/Gcn5/Ada3 transcription activator complex |
| 1. PB | GO:0005730 | nucleolus |
| 1. PB | GO:0045138 | nematode male tail tip morphogenesis |
| 1. PB | GO:2000582 | obsolete positive regulation of microtubule motor activity, plus-end-directed |
| 1. PB | GO:0035097 | histone methyltransferase complex |
| 1. PB | GO:0090671 | telomerase RNA localization to Cajal body |
| 1. PB | GO:0043984 | histone H4-K16 acetylation |
| 1. PB | GO:1902773 | GTPase activator complex |
| 1. PB | GO:0016589 | NURF complex |
| 1. PB | GO:0043547 | positive regulation of GTPase activity |
| 1. PB | GO:0140582 | adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway |
| 1. PB | GO:0051010 | microtubule plus-end binding |
| 1. PB | GO:0098789 | pre-mRNA cleavage required for polyadenylation |
| 1. PB | GO:0051020 | GTPase binding |
| 1. PB | GO:0015030 | Cajal body |
| 1. PB | GO:0046662 | regulation of oviposition |
| 1. PB | GO:0032203 | telomere formation via telomerase |
| 1. PB | GO:0008611 | ether lipid biosynthetic process |
| 1. PB | GO:0005053 | peroxisome matrix targeting signal-2 binding |
| 1. PB | GO:0006378 | mRNA polyadenylation |
| 1. PB | GO:0010154 | fruit development |
| 1. PB | GO:0090660 | cerebrospinal fluid circulation |
| 1. PB | GO:0045292 | mRNA cis splicing, via spliceosome |
| 1. PB | GO:0072686 | mitotic spindle |
| 1. PB | GO:0051568 | histone H3-K4 methylation |
| 1. PB | GO:0000209 | protein polyubiquitination |
| 1. PB | GO:0035861 | site of double-strand break |
| 1. PB | GO:0050773 | regulation of dendrite development |
| 1. PB | GO:0005834 | heterotrimeric G-protein complex |
| 1. PB | GO:0000462 | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0031507 | heterochromatin assembly |
| 1. PB | GO:0000375 | RNA splicing, via transesterification reactions |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0014909 | smooth muscle cell migration |
| 1. PB | GO:0000123 | histone acetyltransferase complex |
| 1. PB | GO:0030473 | nuclear migration along microtubule |
| 1. PB | GO:0031682 | G-protein gamma-subunit binding |
| 1. PB | GO:2001173 | regulation of histone H2B conserved C-terminal lysine ubiquitination |
| 1. PB | GO:0080008 | Cul4-RING E3 ubiquitin ligase complex |
| 1. PB | GO:0000118 | histone deacetylase complex |
| 1. PB | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0000445 | THO complex part of transcription export complex |
| 1. PB | GO:0005681 | spliceosomal complex |
| 1. PB | GO:0031464 | Cul4A-RING E3 ubiquitin ligase complex |
| 1. PB | GO:0042393 | histone binding |
| 1. PB | GO:0003677 | DNA binding |
| 1. PB | GO:0031101 | fin regeneration |
| 1. PB | GO:0051012 | microtubule sliding |
| 1. PB | GO:0046784 | viral mRNA export from host cell nucleus |
| 1. PB | GO:0016593 | Cdc73/Paf1 complex |
| 1. PB | GO:1903725 | regulation of phospholipid metabolic process |
| 1. PB | GO:0097027 | ubiquitin-protein transferase activator activity |
| 1. PB | GO:0045598 | regulation of fat cell differentiation |
| 1. PB | GO:0051973 | positive regulation of telomerase activity |
| 1. PB | GO:0030507 | spectrin binding |
| 1. PB | GO:0000398 | mRNA splicing, via spliceosome |
| 1. PB | GO:0071339 | MLL1 complex |
| 1. PB | GO:0009908 | flower development |
| 1. PB | GO:0097680 | double-strand break repair via classical nonhomologous end joining |
| 1. PB | GO:0009411 | response to UV |
| 1. PB | GO:0032350 | regulation of hormone metabolic process |
| 1. PB | GO:2000574 | obsolete regulation of microtubule motor activity |
| 1. PB | GO:0040020 | regulation of meiotic nuclear division |
| 1. PB | GO:0016581 | NuRD complex |
| 1. PB | GO:0080182 | histone H3-K4 trimethylation |
| 1. PB | GO:0045739 | positive regulation of DNA repair |
| 1. PB | GO:0008380 | RNA splicing |
| 1. PB | GO:0000781 | chromosome, telomeric region |
| 1. PB | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 1. PB | GO:0010659 | cardiac muscle cell apoptotic process |
| 1. PB | GO:0005875 | microtubule associated complex |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0007004 | telomere maintenance via telomerase |
| 1. PB | GO:0030576 | Cajal body organization |
| 1. PB | GO:0070370 | cellular heat acclimation |
| 1. PB | GO:0015630 | microtubule cytoskeleton |
| 1. PB | GO:0007186 | G protein-coupled receptor signaling pathway |
| 1. PB | GO:0070034 | telomerase RNA binding |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0005697 | telomerase holoenzyme complex |
| 1. PB | GO:0090207 | regulation of triglyceride metabolic process |
| 1. PB | GO:0005680 | anaphase-promoting complex |
| 1. PB | GO:0047391 | alkylglycerophosphoethanolamine phosphodiesterase activity |
| 1. PB | GO:0034337 | RNA folding |
| 1. PB | GO:0000974 | Prp19 complex |
| 1. PB | GO:1903033 | positive regulation of microtubule plus-end binding |
| 1. PB | GO:0000776 | kinetochore |
| 1. PB | GO:0070176 | DRM complex |
| 1. PB | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 1. PB | GO:0072344 | rescue of stalled ribosome |
| 1. PB | GO:0005635 | nuclear envelope |
| 1. PB | GO:0005654 | nucleoplasm |
| 1. PB | GO:0040013 | negative regulation of locomotion |
| 2. P | GO:0001708 | cell fate specification |
| 2. P | GO:0048364 | root development |
| 2. P | GO:1903665 | negative regulation of asexual reproduction |
| 2. P | GO:0043935 | sexual sporulation resulting in formation of a cellular spore |
| 2. P | GO:1903561 | extracellular vesicle |
| 2. P | GO:0003380 | establishment or maintenance of cytoskeleton polarity involved in gastrulation |
| 2. P | GO:0010214 | seed coat development |
| 2. P | GO:0001958 | endochondral ossification |
| 2. P | GO:0032794 | GTPase activating protein binding |
| 2. P | GO:1902365 | positive regulation of protein localization to spindle pole body |
| 2. P | GO:0006884 | cell volume homeostasis |
| 2. P | GO:0070734 | histone H3-K27 methylation |
| 2. P | GO:0032995 | regulation of fungal-type cell wall biogenesis |
| 2. P | GO:0008047 | enzyme activator activity |
| 2. P | GO:0045013 | carbon catabolite repression of transcription |
| 2. P | GO:0036269 | swimming behavior |
| 2. P | GO:0071380 | cellular response to prostaglandin E stimulus |
| 2. P | GO:0043577 | chemotropism |
| 2. P | GO:0043519 | regulation of myosin II filament organization |
| 2. P | GO:0035046 | pronuclear migration |
| 2. P | GO:0007191 | adenylate cyclase-activating dopamine receptor signaling pathway |
| 2. P | GO:0008340 | determination of adult lifespan |
| 2. P | GO:0010969 | regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 2. P | GO:0009793 | embryo development ending in seed dormancy |
| 2. P | GO:1901673 | regulation of mitotic spindle assembly |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0061484 | hematopoietic stem cell homeostasis |
| 2. P | GO:1903463 | regulation of mitotic cell cycle DNA replication |
| 2. P | GO:2000221 | negative regulation of pseudohyphal growth |
| 2. P | GO:0005246 | calcium channel regulator activity |
| 2. P | GO:0061186 | negative regulation of silent mating-type cassette heterochromatin assembly |
| 2. P | GO:0010595 | positive regulation of endothelial cell migration |
| 2. P | GO:0031519 | PcG protein complex |
| 2. P | GO:0005677 | chromatin silencing complex |
| 2. P | GO:0006342 | |
| 2. P | GO:0007200 | phospholipase C-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0016571 | histone methylation |
| 2. P | GO:0043254 | regulation of protein-containing complex assembly |
| 2. P | GO:0030054 | cell junction |
| 2. P | GO:0001750 | photoreceptor outer segment |
| 2. P | GO:0010525 | regulation of transposition, RNA-mediated |
| 2. P | GO:0001403 | invasive growth in response to glucose limitation |
| 2. P | GO:2000011 | regulation of adaxial/abaxial pattern formation |
| 2. P | GO:0045930 | negative regulation of mitotic cell cycle |
| 2. P | GO:0001739 | sex chromatin |
| 2. P | GO:1901485 | positive regulation of transcription factor catabolic process |
| 2. P | GO:0071456 | cellular response to hypoxia |
| 2. P | GO:0042622 | photoreceptor outer segment membrane |
| 2. P | GO:0031139 | positive regulation of conjugation with cellular fusion |
| 2. P | GO:0006348 | |
| 2. P | GO:0007064 | mitotic sister chromatid cohesion |
| 2. P | GO:0051649 | establishment of localization in cell |
| 2. P | GO:0031939 | obsolete negative regulation of chromatin silencing at telomere |
| 2. P | GO:0048794 | swim bladder development |
| 2. P | GO:0061343 | cell adhesion involved in heart morphogenesis |
| 2. P | GO:0001222 | transcription corepressor binding |
| 2. P | GO:0120171 | Cdc24p-Far1p-Gbetagamma complex |
| 2. P | GO:0001917 | photoreceptor inner segment |
| 2. P | GO:0050909 | sensory perception of taste |
| 2. P | GO:0051087 | chaperone binding |
| 2. P | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 2. P | GO:0004402 | histone acetyltransferase activity |
| 2. P | GO:0005682 | U5 snRNP |
| 2. P | GO:0036158 | outer dynein arm assembly |
| 2. P | GO:0070914 | UV-damage excision repair |
| 2. P | GO:0009909 | regulation of flower development |
| 2. P | GO:0090696 | post-embryonic plant organ development |
| 2. P | GO:1905803 | negative regulation of cellular response to manganese ion |
| 2. P | GO:1904146 | positive regulation of meiotic cell cycle process involved in oocyte maturation |
| 2. P | GO:0043209 | myelin sheath |
| 2. P | GO:0051865 | protein autoubiquitination |
| 2. P | GO:0016573 | histone acetylation |
| 2. P | GO:0071014 | post-mRNA release spliceosomal complex |
| 2. P | GO:0048920 | posterior lateral line neuromast primordium migration |
| 2. P | GO:0010165 | response to X-ray |
| 2. P | GO:0006260 | DNA replication |
| 2. P | GO:0048557 | embryonic digestive tract morphogenesis |
| 2. P | GO:0034514 | mitochondrial unfolded protein response |
| 2. P | GO:0016059 | deactivation of rhodopsin mediated signaling |
| 2. P | GO:0000226 | microtubule cytoskeleton organization |
| 2. P | GO:0048383 | mesectoderm development |
| 2. P | GO:0060465 | pharynx development |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:0031592 | centrosomal corona |
| 2. P | GO:0035064 | methylated histone binding |
| 2. P | GO:0007213 | G protein-coupled acetylcholine receptor signaling pathway |
| 2. P | GO:1905301 | regulation of macropinocytosis |
| 2. P | GO:1990498 | mitotic spindle microtubule |
| 2. P | GO:1903138 | negative regulation of cell wall integrity MAPK cascade |
| 2. P | GO:0019899 | enzyme binding |
| 2. P | GO:0009960 | endosperm development |
| 2. P | GO:0042054 | histone methyltransferase activity |
| 2. P | GO:0060027 | convergent extension involved in gastrulation |
| 2. P | GO:0005818 | aster |
| 2. P | GO:1902624 | positive regulation of neutrophil migration |
| 2. P | GO:0035518 | histone H2A monoubiquitination |
| 2. P | GO:0060290 | transdifferentiation |
| 2. P | GO:0007307 | eggshell chorion gene amplification |
| 2. P | GO:0006290 | pyrimidine dimer repair |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0016243 | regulation of autophagosome size |
| 2. P | GO:0010224 | response to UV-B |
| 2. P | GO:0035556 | intracellular signal transduction |
| 2. P | GO:0098654 | CENP-A recruiting complex |
| 2. P | GO:0010906 | regulation of glucose metabolic process |
| 2. P | GO:0003400 | regulation of COPII vesicle coating |
| 2. P | GO:0010674 | negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle |
| 2. P | GO:0006349 | regulation of gene expression by genomic imprinting |
| 2. P | GO:0005937 | mating projection |
| 2. P | GO:0048366 | leaf development |
| 2. P | GO:2000653 | regulation of genetic imprinting |
| 2. P | GO:0048316 | seed development |
| 2. P | GO:0010231 | maintenance of seed dormancy |
| 3. B | GO:0021540 | corpus callosum morphogenesis |
| 3. B | GO:1902510 | regulation of apoptotic DNA fragmentation |
| 3. B | GO:1990147 | talin binding |
| 3. B | GO:0090141 | positive regulation of mitochondrial fission |
| 3. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 3. B | GO:0043614 | multi-eIF complex |
| 3. B | GO:0019226 | transmission of nerve impulse |
| 3. B | GO:0000244 | spliceosomal tri-snRNP complex assembly |
| 3. B | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 3. B | GO:1901800 | positive regulation of proteasomal protein catabolic process |
| 3. B | GO:0071353 | cellular response to interleukin-4 |
| 3. B | GO:1905861 | intranuclear rod assembly |
| 3. B | GO:0031965 | nuclear membrane |
| 3. B | GO:0032796 | uropod organization |
| 3. B | GO:0060307 | regulation of ventricular cardiac muscle cell membrane repolarization |
| 3. B | GO:1903673 | mitotic cleavage furrow formation |
| 3. B | GO:0007541 | sex determination, primary response to X:A ratio |
| 3. B | GO:0010267 | primary ta-siRNA processing |
| 3. B | GO:0000972 | transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery |
| 3. B | GO:2000234 | positive regulation of rRNA processing |
| 3. B | GO:0009553 | embryo sac development |
| 3. B | GO:0008344 | adult locomotory behavior |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0005615 | extracellular space |
| 3. B | GO:0032956 | regulation of actin cytoskeleton organization |
| 3. B | GO:0032420 | stereocilium |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0005869 | dynactin complex |
| 3. B | GO:0043224 | nuclear SCF ubiquitin ligase complex |
| 3. B | GO:0006337 | nucleosome disassembly |
| 3. B | GO:0005667 | transcription regulator complex |
| 3. B | GO:0016579 | protein deubiquitination |
| 3. B | GO:0016282 | eukaryotic 43S preinitiation complex |
| 3. B | GO:0090148 | membrane fission |
| 3. B | GO:0071217 | cellular response to external biotic stimulus |
| 3. B | GO:0003735 | structural constituent of ribosome |
| 3. B | GO:0017053 | transcription repressor complex |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0015935 | small ribosomal subunit |
| 3. B | GO:0061700 | GATOR2 complex |
| 3. B | GO:0061883 | clathrin-dependent endocytosis involved in vitellogenesis |
| 3. B | GO:0097428 | protein maturation by iron-sulfur cluster transfer |
| 3. B | GO:0005198 | structural molecule activity |
| 3. B | GO:0019985 | translesion synthesis |
| 3. B | GO:0039023 | pronephric duct morphogenesis |
| 3. B | GO:0005826 | actomyosin contractile ring |
| 3. B | GO:0072520 | seminiferous tubule development |
| 3. B | GO:1904263 | positive regulation of TORC1 signaling |
| 3. B | GO:0040011 | locomotion |
| 3. B | GO:2000393 | negative regulation of lamellipodium morphogenesis |
| 3. B | GO:0090114 | COPII-coated vesicle budding |
| 3. B | GO:0030836 | positive regulation of actin filament depolymerization |
| 3. B | GO:0008656 | cysteine-type endopeptidase activator activity involved in apoptotic process |
| 3. B | GO:0051169 | nuclear transport |
| 3. B | GO:0050765 | negative regulation of phagocytosis |
| 3. B | GO:0051539 | 4 iron, 4 sulfur cluster binding |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0006367 | transcription initiation from RNA polymerase II promoter |
| 3. B | GO:0006334 | nucleosome assembly |
| 3. B | GO:0016477 | cell migration |
| 3. B | GO:0006886 | intracellular protein transport |
| 3. B | GO:0061003 | positive regulation of dendritic spine morphogenesis |
| 3. B | GO:0010632 | regulation of epithelial cell migration |
| 3. B | GO:0017145 | stem cell division |
| 3. B | GO:0043521 | regulation of myosin II filament disassembly |
| 3. B | GO:0071906 | CRD domain binding |
| 3. B | GO:0000349 | generation of catalytic spliceosome for first transesterification step |
| 3. B | GO:0005819 | spindle |
| 3. B | GO:0043130 | ubiquitin binding |
| 3. B | GO:0001667 | ameboidal-type cell migration |
| 3. B | GO:0031529 | ruffle organization |
| 3. B | GO:0048511 | rhythmic process |
| 3. B | GO:0048814 | regulation of dendrite morphogenesis |
| 3. B | GO:0071215 | cellular response to abscisic acid stimulus |
| 3. B | GO:0031589 | cell-substrate adhesion |
| 3. B | GO:0031037 | myosin II filament disassembly |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:1900024 | regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0006890 | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
| 3. B | GO:0036170 | filamentous growth of a population of unicellular organisms in response to starvation |
| 3. B | GO:0000472 | endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0009968 | negative regulation of signal transduction |
| 3. B | GO:1902184 | negative regulation of shoot apical meristem development |
| 3. B | GO:2000217 | regulation of invasive growth in response to glucose limitation |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0048527 | lateral root development |
| 3. B | GO:0005930 | axoneme |
| 3. B | GO:0030515 | snoRNA binding |
| 3. B | GO:0099139 | cheating during chimeric sorocarp development |
| 3. B | GO:0009933 | meristem structural organization |
| 3. B | GO:0034504 | protein localization to nucleus |
| 3. B | GO:0043297 | apical junction assembly |
| 3. B | GO:0001764 | neuron migration |
| 3. B | GO:0034388 | Pwp2p-containing subcomplex of 90S preribosome |
| 3. B | GO:1903013 | response to differentiation-inducing factor 1 |
| 3. B | GO:0030971 | receptor tyrosine kinase binding |
| 3. B | GO:0003682 | chromatin binding |
| 3. B | GO:0030157 | pancreatic juice secretion |
| 3. B | GO:0016905 | myosin heavy chain kinase activity |
| 3. B | GO:2000394 | positive regulation of lamellipodium morphogenesis |
| 3. B | GO:0030178 | negative regulation of Wnt signaling pathway |
| 3. B | GO:0030127 | COPII vesicle coat |
| 3. B | GO:0097750 | endosome membrane tubulation |
| 3. B | GO:0007312 | oocyte nucleus migration involved in oocyte dorsal/ventral axis specification |
| 3. B | GO:0005840 | ribosome |
| 3. B | GO:0098792 | xenophagy |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:0010992 | ubiquitin recycling |
| 3. B | GO:1990266 | neutrophil migration |
| 3. B | GO:0007294 | germarium-derived oocyte fate determination |
| 3. B | GO:0030043 | actin filament fragmentation |
| 3. B | GO:1903146 | regulation of autophagy of mitochondrion |
| 3. B | GO:0030834 | regulation of actin filament depolymerization |
| 3. B | GO:0016575 | histone deacetylation |
| 3. B | GO:0006606 | protein import into nucleus |
| 3. B | GO:0008352 | katanin complex |
| 3. B | GO:0070121 | Kupffer's vesicle development |
| 3. B | GO:0051299 | centrosome separation |
| 3. B | GO:0034198 | cellular response to amino acid starvation |
| 3. B | GO:0035844 | cloaca development |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0071817 | MMXD complex |
| 3. B | GO:0042304 | regulation of fatty acid biosynthetic process |
| 3. B | GO:0010697 | negative regulation of mitotic spindle pole body separation |
| 3. B | GO:0005662 | DNA replication factor A complex |
| 3. B | GO:0008013 | beta-catenin binding |
| 3. B | GO:2000024 | regulation of leaf development |
| 3. B | GO:1990907 | beta-catenin-TCF complex |
| 3. B | GO:2000728 | regulation of mRNA export from nucleus in response to heat stress |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0051434 | BH3 domain binding |
| 3. B | GO:0051081 | nuclear membrane disassembly |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051028 | mRNA transport |
| 3. B | GO:0071539 | protein localization to centrosome |
| 3. B | GO:0000245 | spliceosomal complex assembly |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0038202 | TORC1 signaling |
| 3. B | GO:0140285 | endosome fission |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0051082 | unfolded protein binding |
| 3. B | GO:0051510 | regulation of unidimensional cell growth |
| 3. B | GO:0048872 | homeostasis of number of cells |
| 3. B | GO:1990716 | axonemal central apparatus |
| 3. B | GO:0001675 | acrosome assembly |
| 3. B | GO:0061502 | early endosome to recycling endosome transport |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0030687 | preribosome, large subunit precursor |
| 3. B | GO:0030723 | ovarian fusome organization |
| 3. B | GO:0007298 | border follicle cell migration |
| 3. B | GO:0045741 | positive regulation of epidermal growth factor-activated receptor activity |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0045542 | positive regulation of cholesterol biosynthetic process |
| 3. B | GO:0039008 | pronephric nephron tubule morphogenesis |
| 3. B | GO:0010272 | response to silver ion |
| 3. B | GO:0048713 | regulation of oligodendrocyte differentiation |
| 3. B | GO:0030838 | positive regulation of actin filament polymerization |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0034399 | nuclear periphery |
| 3. B | GO:0034396 | negative regulation of transcription from RNA polymerase II promoter in response to iron |
| 3. B | GO:0006891 | intra-Golgi vesicle-mediated transport |
| 3. B | GO:0000480 | endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:1902525 | regulation of protein monoubiquitination |
| 3. B | GO:0050795 | regulation of behavior |
| 3. B | GO:0006310 | DNA recombination |
| 3. B | GO:0010044 | response to aluminum ion |
| 3. B | GO:0033276 | transcription factor TFTC complex |
| 3. B | GO:0007019 | microtubule depolymerization |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:2001224 | positive regulation of neuron migration |
| 3. B | GO:0007281 | germ cell development |
| 3. B | GO:1904672 | regulation of somatic stem cell population maintenance |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:2001244 | positive regulation of intrinsic apoptotic signaling pathway |
| 3. B | GO:0051642 | centrosome localization |
| 3. B | GO:0005884 | actin filament |
| 3. B | GO:0009585 | red, far-red light phototransduction |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0051315 | attachment of mitotic spindle microtubules to kinetochore |
| 3. B | GO:0031616 | spindle pole centrosome |
| 3. B | GO:0030595 | leukocyte chemotaxis |
| 3. B | GO:0000417 | HIR complex |
| 3. B | GO:0043560 | insulin receptor substrate binding |
| 3. B | GO:0009507 | chloroplast |
| 3. B | GO:0000463 | maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0000421 | autophagosome membrane |
| 3. B | GO:0010073 | meristem maintenance |
| 3. B | GO:0005848 | mRNA cleavage stimulating factor complex |
| 3. B | GO:0001732 | formation of cytoplasmic translation initiation complex |
| 3. B | GO:0032933 | SREBP signaling pathway |
| 3. B | GO:0009663 | plasmodesma organization |
| 3. B | GO:2001205 | negative regulation of osteoclast development |
| 3. B | GO:0051664 | nuclear pore localization |
| 3. B | GO:0060590 | ATPase regulator activity |
| 3. B | GO:0045159 | myosin II binding |
| 3. B | GO:0000380 | alternative mRNA splicing, via spliceosome |
| 3. B | GO:0031339 | negative regulation of vesicle fusion |
| 3. B | GO:0007095 | mitotic G2 DNA damage checkpoint signaling |
| 3. B | GO:0006999 | nuclear pore organization |
| 3. B | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0005741 | mitochondrial outer membrane |
| 3. B | GO:0051219 | phosphoprotein binding |
| 3. B | GO:1902183 | regulation of shoot apical meristem development |
| 3. B | GO:0048026 | positive regulation of mRNA splicing, via spliceosome |
| 3. B | GO:0051225 | spindle assembly |
| 3. B | GO:0051983 | regulation of chromosome segregation |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0051901 | positive regulation of mitochondrial depolarization |
| 3. B | GO:0032430 | positive regulation of phospholipase A2 activity |
| 3. B | GO:0002446 | neutrophil mediated immunity |
| 3. B | GO:0034501 | protein localization to kinetochore |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0035973 | aggrephagy |
| 3. B | GO:1903003 | positive regulation of protein deubiquitination |
| 3. B | GO:0033137 | negative regulation of peptidyl-serine phosphorylation |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:1990630 | IRE1-RACK1-PP2A complex |
| 3. B | GO:0003700 | DNA-binding transcription factor activity |
| 3. B | GO:1990447 | U2 snRNP binding |
| 3. B | GO:0051126 | negative regulation of actin nucleation |
| 3. B | GO:0045309 | protein phosphorylated amino acid binding |
| 3. B | GO:0010393 | galacturonan metabolic process |
| 3. B | GO:0000266 | mitochondrial fission |
| 3. B | GO:0007099 | centriole replication |
| 3. B | GO:0046329 | negative regulation of JNK cascade |
| 3. B | GO:0140026 | contractile vacuole dissociation from plasma membrane |
| 3. B | GO:0006895 | Golgi to endosome transport |
| 3. B | GO:0071363 | cellular response to growth factor stimulus |
| 3. B | GO:0005765 | lysosomal membrane |
| 3. B | GO:0043548 | phosphatidylinositol 3-kinase binding |
| 3. B | GO:0006909 | phagocytosis |
| 3. B | GO:0030332 | cyclin binding |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0000347 | THO complex |
| 3. B | GO:0090176 | microtubule cytoskeleton organization involved in establishment of planar polarity |
| 3. B | GO:0005828 | kinetochore microtubule |
| 3. B | GO:0016230 | sphingomyelin phosphodiesterase activator activity |
| 3. B | GO:0000433 | carbon catabolite repression of transcription from RNA polymerase II promoter by glucose |
| 3. B | GO:0043087 | regulation of GTPase activity |
| 3. B | GO:0001961 | positive regulation of cytokine-mediated signaling pathway |
| 3. B | GO:0071599 | otic vesicle development |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0031334 | positive regulation of protein-containing complex assembly |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031514 | motile cilium |
| 3. B | GO:0051276 | chromosome organization |
| 3. B | GO:0031929 | TOR signaling |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0030968 | endoplasmic reticulum unfolded protein response |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0035845 | photoreceptor cell outer segment organization |
| 3. B | GO:0097525 | spliceosomal snRNP complex |
| 3. B | GO:0030621 | U4 snRNA binding |
| 3. B | GO:0070507 | regulation of microtubule cytoskeleton organization |
| 3. B | GO:0031124 | mRNA 3'-end processing |
| 3. B | GO:0012507 | ER to Golgi transport vesicle membrane |
| 3. B | GO:0002102 | podosome |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:2000060 | positive regulation of ubiquitin-dependent protein catabolic process |
| 3. B | GO:0031648 | protein destabilization |
| 3. B | GO:0090135 | actin filament branching |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0002188 | translation reinitiation |
| 3. B | GO:0031932 | TORC2 complex |
| 3. B | GO:0043029 | T cell homeostasis |
| 3. B | GO:0034450 | ubiquitin-ubiquitin ligase activity |
| 3. B | GO:0045862 | positive regulation of proteolysis |
| 3. B | GO:1905191 | positive regulation of metaphase/anaphase transition of meiosis II |
| 3. B | GO:0003743 | translation initiation factor activity |
| 3. B | GO:0051013 | microtubule severing |
| 3. B | GO:0005656 | nuclear pre-replicative complex |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0043162 | ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0006693 | prostaglandin metabolic process |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0071672 | negative regulation of smooth muscle cell chemotaxis |
| 3. B | GO:0048359 | mucilage metabolic process involved in seed coat development |
| 3. B | GO:0120095 | vacuole-isolation membrane contact site |
| 3. B | GO:0051343 | positive regulation of cyclic-nucleotide phosphodiesterase activity |
| 3. B | GO:0016319 | mushroom body development |
| 3. B | GO:1900045 | negative regulation of protein K63-linked ubiquitination |
| 3. B | GO:0007405 | neuroblast proliferation |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0006413 | translational initiation |
| 3. B | GO:0071540 | eukaryotic translation initiation factor 3 complex, eIF3e |
| 3. B | GO:0008247 | 1-alkyl-2-acetylglycerophosphocholine esterase complex |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0007303 | cytoplasmic transport, nurse cell to oocyte |
| 3. B | GO:0034316 | negative regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0019005 | SCF ubiquitin ligase complex |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0030041 | actin filament polymerization |
| 3. B | GO:0046540 | U4/U6 x U5 tri-snRNP complex |
| 3. B | GO:0010072 | primary shoot apical meristem specification |
| 3. B | GO:0071005 | U2-type precatalytic spliceosome |
| 3. B | GO:0061739 | protein lipidation involved in autophagosome assembly |
| 3. B | GO:0031931 | TORC1 complex |
| 3. B | GO:2001235 | positive regulation of apoptotic signaling pathway |
| 3. B | GO:0015031 | protein transport |
| 3. B | GO:0039689 | negative stranded viral RNA replication |
| 3. B | GO:0034141 | positive regulation of toll-like receptor 3 signaling pathway |
| 3. B | GO:0030864 | cortical actin cytoskeleton |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0006412 | translation |
| 3. B | GO:0075296 | positive regulation of ascospore formation |
| 3. B | GO:1990298 | bub1-bub3 complex |
| 3. B | GO:0042753 | positive regulation of circadian rhythm |
| 3. B | GO:0031080 | nuclear pore outer ring |
| 3. B | GO:2000280 | regulation of root development |
| 3. B | GO:0044665 | MLL1/2 complex |
| 3. B | GO:0008298 | intracellular mRNA localization |
| 3. B | GO:0016005 | phospholipase A2 activator activity |
| 3. B | GO:0097361 | CIA complex |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0051130 | positive regulation of cellular component organization |
| 3. B | GO:0030331 | estrogen receptor binding |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0051383 | kinetochore organization |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0048142 | germarium-derived cystoblast division |
| 3. B | GO:0019827 | stem cell population maintenance |
| 3. B | GO:0051661 | maintenance of centrosome location |
| 3. B | GO:0032036 | myosin heavy chain binding |
| 3. B | GO:0090326 | positive regulation of locomotion involved in locomotory behavior |
| 3. B | GO:0045540 | regulation of cholesterol biosynthetic process |
| 3. B | GO:0042273 | ribosomal large subunit biogenesis |
| 3. B | GO:0072432 | response to G1 DNA damage checkpoint signaling |
| 3. B | GO:0032934 | sterol binding |
| 3. B | GO:0003720 | telomerase activity |
| 3. B | GO:0042052 | rhabdomere development |
| 3. B | GO:0071011 | precatalytic spliceosome |
| 3. B | GO:0043143 | regulation of translation by machinery localization |
| 3. B | GO:0001891 | phagocytic cup |
| 3. B | GO:0051660 | establishment of centrosome localization |
| 3. B | GO:1903026 | negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding |
| 3. B | GO:0045014 | carbon catabolite repression of transcription by glucose |
| 3. B | GO:0080135 | regulation of cellular response to stress |
| 3. B | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0051015 | actin filament binding |
| 3. B | GO:0090724 | central region of growth cone |
| 3. B | GO:0120197 | mucociliary clearance |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0000775 | chromosome, centromeric region |
| 3. B | GO:0006907 | pinocytosis |
| 3. B | GO:1900091 | regulation of raffinose biosynthetic process |
| 3. B | GO:0030042 | actin filament depolymerization |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0045943 | positive regulation of transcription by RNA polymerase I |
| 3. B | GO:0034719 | SMN-Sm protein complex |
| 3. B | GO:0000235 | astral microtubule |
| 3. B | GO:0090049 | regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0010826 | negative regulation of centrosome duplication |
| 3. B | GO:0046716 | muscle cell cellular homeostasis |
| 3. B | GO:0038026 | reelin-mediated signaling pathway |
| 3. B | GO:1903378 | positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway |
| 3. B | GO:1904115 | axon cytoplasm |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:1903955 | positive regulation of protein targeting to mitochondrion |
| 3. B | GO:0032008 | positive regulation of TOR signaling |
| 3. B | GO:1900087 | positive regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0010118 | stomatal movement |
| 3. B | GO:0006364 | rRNA processing |
| 3. B | GO:0032797 | SMN complex |
| 3. B | GO:0040019 | positive regulation of embryonic development |
| 3. B | GO:0097344 | Rix1 complex |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0001845 | phagolysosome assembly |
| 3. B | GO:0036180 | filamentous growth of a population of unicellular organisms in response to biotic stimulus |
| 3. B | GO:0045827 | negative regulation of isoprenoid metabolic process |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0090110 | COPII-coated vesicle cargo loading |
| 3. B | GO:0030862 | positive regulation of polarized epithelial cell differentiation |
| 3. B | GO:0021819 | layer formation in cerebral cortex |
| 3. B | GO:0035591 | signaling adaptor activity |
| 3. B | GO:0007369 | gastrulation |
| 3. B | GO:0030174 | regulation of DNA-dependent DNA replication initiation |
| 3. B | GO:0005643 | nuclear pore |
| 3. B | GO:0030220 | platelet formation |
| 3. B | GO:0051898 | negative regulation of protein kinase B signaling |
| 3. B | GO:1902463 | protein localization to cell leading edge |
| 3. B | GO:0007399 | nervous system development |
| 3. B | GO:0033290 | eukaryotic 48S preinitiation complex |
| 3. B | GO:1903861 | positive regulation of dendrite extension |
| 3. B | GO:0042998 | positive regulation of Golgi to plasma membrane protein transport |
| 3. B | GO:0009991 | response to extracellular stimulus |
| 3. B | GO:1900052 | regulation of retinoic acid biosynthetic process |
| 3. B | GO:0042247 | establishment of planar polarity of follicular epithelium |
| 3. B | GO:0031117 | positive regulation of microtubule depolymerization |
| 3. B | GO:0006974 | cellular response to DNA damage stimulus |
| 3. B | GO:0016559 | peroxisome fission |
| 3. B | GO:0032781 | positive regulation of ATP-dependent activity |
| 3. B | GO:0008023 | transcription elongation factor complex |
| 3. B | GO:0045214 | sarcomere organization |
| 3. B | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 3. B | GO:0016226 | iron-sulfur cluster assembly |
| 3. B | GO:0009867 | jasmonic acid mediated signaling pathway |
| 3. B | GO:0005669 | transcription factor TFIID complex |
| 3. B | GO:0006513 | protein monoubiquitination |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0043622 | cortical microtubule organization |
| 3. B | GO:0034145 | positive regulation of toll-like receptor 4 signaling pathway |
| 3. B | GO:0035859 | Seh1-associated complex |
| 3. B | GO:0120151 | positive regulation of mitotic actomyosin contractile ring disassembly |
| 3. B | GO:0006405 | RNA export from nucleus |
| 3. B | GO:0030277 | maintenance of gastrointestinal epithelium |
| 3. B | GO:0043320 | natural killer cell degranulation |
| 3. B | GO:0072499 | photoreceptor cell axon guidance |
| 3. B | GO:0032880 | regulation of protein localization |
| 3. B | GO:1903423 | positive regulation of synaptic vesicle recycling |
| 3. B | GO:0031252 | cell leading edge |
| 3. B | GO:1905392 | plant organ morphogenesis |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0031154 | culmination involved in sorocarp development |
| 3. B | GO:0002183 | cytoplasmic translational initiation |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:0008635 | activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c |
| 3. B | GO:0071006 | U2-type catalytic step 1 spliceosome |
| 3. B | GO:0045199 | maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0043021 | ribonucleoprotein complex binding |
| 3. B | GO:0021895 | cerebral cortex neuron differentiation |
| 3. B | GO:0030126 | COPI vesicle coat |
| 3. B | GO:0036035 | osteoclast development |
| 3. B | GO:0071541 | eukaryotic translation initiation factor 3 complex, eIF3m |
| 3. B | GO:0000437 | carbon catabolite repression of transcription from RNA polymerase II promoter |
| 3. B | GO:0060117 | auditory receptor cell development |
| 3. B | GO:0032527 | protein exit from endoplasmic reticulum |
| 3. B | GO:0051721 | protein phosphatase 2A binding |
| 3. B | GO:0002098 | tRNA wobble uridine modification |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0098532 | histone H3-K27 trimethylation |
| 3. B | GO:0000466 | maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0017070 | U6 snRNA binding |
| 3. B | GO:0048135 | female germ-line cyst formation |
| 3. B | GO:0030686 | 90S preribosome |
| 3. B | GO:0061966 | establishment of left/right asymmetry |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0035767 | endothelial cell chemotaxis |
| 3. B | GO:0030286 | dynein complex |
| 3. B | GO:0036038 | MKS complex |
| 3. B | GO:1990939 | |
| 3. B | GO:0005852 | eukaryotic translation initiation factor 3 complex |
| 3. B | GO:0071001 | U4/U6 snRNP |
| 3. B | GO:0010973 | positive regulation of division septum assembly |
| 3. B | GO:0080001 | mucilage extrusion from seed coat |
| 3. B | GO:0009723 | response to ethylene |
| 3. B | GO:0005871 | kinesin complex |
| 3. B | GO:0016480 | negative regulation of transcription by RNA polymerase III |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:1990452 | Parkin-FBXW7-Cul1 ubiquitin ligase complex |
| 3. B | GO:0034629 | |
| 3. B | GO:0043293 | apoptosome |
| 3. B | GO:0030381 | chorion-containing eggshell pattern formation |
| 3. B | GO:0003777 | microtubule motor activity |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0050816 | phosphothreonine residue binding |
| 3. B | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0009640 | photomorphogenesis |
| 3. B | GO:0031570 | DNA integrity checkpoint signaling |
| 3. B | GO:0071933 | Arp2/3 complex binding |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0042249 | establishment of planar polarity of embryonic epithelium |
| 3. B | GO:0033588 | elongator holoenzyme complex |
| 3. B | GO:0042169 | SH2 domain binding |
| 3. B | GO:1903208 | negative regulation of hydrogen peroxide-induced neuron death |
| 3. B | GO:0030292 | protein tyrosine kinase inhibitor activity |
| 3. B | GO:0090443 | FAR/SIN/STRIPAK complex |
| 3. B | GO:0120206 | photoreceptor distal connecting cilium |
| 3. B | GO:0010842 | retina layer formation |
| 3. B | GO:1904950 | negative regulation of establishment of protein localization |
| 3. B | GO:1901796 | regulation of signal transduction by p53 class mediator |
| 3. B | GO:1900088 | regulation of inositol biosynthetic process |
| 3. B | GO:0051279 | regulation of release of sequestered calcium ion into cytosol |
| 3. B | GO:0070016 | armadillo repeat domain binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5BE22 | Pre-mRNA-splicing factor prp46 | 1.26e-10 | 4.47e-05 | 7.36e-12 |
| 1. PB | Q0IF90 | WD repeat-containing protein 55 homolog | 1.24e-08 | 1.89e-03 | 1.38e-04 |
| 1. PB | Q5R4T8 | DDB1- and CUL4-associated factor 13 | 1.43e-14 | 6.06e-07 | 0.011 |
| 1. PB | G4MQX3 | MST50-interacting protein 11 | 0.00e+00 | 2.28e-02 | 9.38e-17 |
| 1. PB | A1L271 | Guanine nucleotide-binding protein subunit beta-5a | 4.06e-10 | 4.31e-03 | 9.59e-11 |
| 1. PB | Q6DRF9 | WD repeat-containing protein 55 | 2.21e-11 | 4.09e-02 | 2.31e-06 |
| 1. PB | Q9W1J3 | Gastrulation defective protein 1 homolog | 6.79e-07 | 2.32e-04 | 1.04e-04 |
| 1. PB | Q75AV4 | Polyadenylation factor subunit 2 | 1.16e-10 | 2.17e-05 | 1.72e-10 |
| 1. PB | Q6PAC3 | DDB1- and CUL4-associated factor 13 | 1.34e-14 | 8.16e-08 | 3.44e-05 |
| 1. PB | Q6C7Q4 | Histone acetyltransferase type B subunit 2 | 6.00e-09 | 2.30e-02 | 5.78e-05 |
| 1. PB | O94244 | Histone acetyltransferase type B subunit 2 | 2.89e-15 | 2.58e-02 | 3.52e-07 |
| 1. PB | Q17I16 | WD repeat-containing protein on Y chromosome | 6.14e-05 | 2.58e-04 | 1.66e-07 |
| 1. PB | B4LS78 | Ribosome biogenesis protein WDR12 homolog | 2.56e-11 | 4.36e-02 | 2.30e-09 |
| 1. PB | Q9NYS7 | WD repeat and SOCS box-containing protein 2 | 2.19e-09 | 3.54e-05 | 1.15e-11 |
| 1. PB | Q5ZK69 | Proteasomal ATPase-associated factor 1 | 1.25e-11 | 9.67e-04 | 5.02e-13 |
| 1. PB | Q75BY3 | Pre-mRNA-splicing factor PRP46 | 6.94e-14 | 7.46e-06 | 1.36e-07 |
| 1. PB | P62881 | Guanine nucleotide-binding protein subunit beta-5 | 2.55e-15 | 5.10e-05 | 3.32e-09 |
| 1. PB | A4R3M4 | Nuclear distribution protein PAC1 | 2.93e-14 | 1.06e-02 | 4.79e-17 |
| 1. PB | Q6P2Y2 | Dynein assembly factor with WDR repeat domains 1 | 1.32e-11 | 9.74e-03 | 1.87e-26 |
| 1. PB | C0NRC6 | Nuclear distribution protein PAC1 | 6.33e-15 | 9.93e-03 | 1.85e-20 |
| 1. PB | F4K5R6 | Cell division cycle 20.6, cofactor of APC complex | 5.18e-07 | 3.58e-05 | 1.61e-04 |
| 1. PB | A0CH87 | Lissencephaly-1 homolog 2 | 0.00e+00 | 5.77e-04 | 1.10e-18 |
| 1. PB | Q5M7K4 | Histone-binding protein RBBP4 | 3.22e-15 | 4.82e-02 | 4.01e-05 |
| 1. PB | C5MJE8 | Nuclear distribution protein PAC1 | 2.45e-12 | 1.79e-02 | 3.42e-11 |
| 1. PB | Q6ZMY6 | WD repeat-containing protein 88 | 0 | 3.43e-148 | 0.0 |
| 1. PB | Q12021 | Radiation-sensitive protein 28 | 2.44e-05 | 7.44e-03 | 1.27e-06 |
| 1. PB | A8X8C6 | WD repeat-containing protein tag-125 | 4.60e-14 | 2.78e-07 | 2.66e-21 |
| 1. PB | C7Z6H2 | Nuclear distribution protein PAC1 | 1.15e-14 | 1.61e-04 | 8.41e-18 |
| 1. PB | Q9BUR4 | Telomerase Cajal body protein 1 | 9.90e-07 | 1.79e-02 | 3.82e-05 |
| 1. PB | P18851 | Guanine nucleotide-binding protein subunit beta | 3.04e-11 | 1.08e-02 | 1.97e-04 |
| 1. PB | Q498M4 | WD repeat-containing protein 5 | 0.00e+00 | 1.76e-04 | 1.84e-27 |
| 1. PB | Q24572 | Chromatin assembly factor 1 p55 subunit | 2.44e-15 | 1.67e-03 | 4.89e-04 |
| 1. PB | A3LNI7 | Nuclear distribution protein PAC1 | 1.78e-11 | 3.98e-02 | 6.04e-08 |
| 1. PB | Q03177 | WD repeat-containing protein YMR102C | 5.46e-03 | 6.74e-04 | 0.042 |
| 1. PB | Q7T2F6 | WD repeat and SOCS box-containing protein 1 | 1.94e-12 | 3.62e-05 | 7.02e-15 |
| 1. PB | Q0U1B1 | Nuclear distribution protein PAC1 | 4.02e-14 | 1.02e-03 | 6.65e-18 |
| 1. PB | Q5QP82 | DDB1- and CUL4-associated factor 10 | 3.28e-08 | 1.72e-03 | 7.99e-04 |
| 1. PB | Q17963 | WD repeat-containing protein wdr-5.1 | 1.19e-12 | 3.24e-05 | 1.93e-20 |
| 1. PB | B2VWG7 | Nuclear distribution protein PAC1 | 3.33e-14 | 9.93e-05 | 1.73e-18 |
| 1. PB | C4R6H3 | Nuclear distribution protein PAC1 | 1.90e-10 | 1.96e-05 | 5.51e-12 |
| 1. PB | P79959 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.44e-15 | 2.04e-04 | 5.78e-13 |
| 1. PB | Q94AD8 | F-box/WD-40 repeat-containing protein At5g21040 | 2.47e-07 | 5.24e-03 | 5.90e-05 |
| 1. PB | Q4WLM7 | Nuclear distribution protein nudF | 2.80e-14 | 2.09e-03 | 1.42e-15 |
| 1. PB | P62882 | Guanine nucleotide-binding protein subunit beta-5 | 1.38e-14 | 2.31e-03 | 4.08e-09 |
| 1. PB | Q9S7H3 | Cell division cycle 20.3, cofactor of APC complex | 1.64e-08 | 1.30e-04 | 1.25e-07 |
| 1. PB | Q9HAV0 | Guanine nucleotide-binding protein subunit beta-4 | 2.44e-15 | 1.70e-04 | 1.20e-11 |
| 1. PB | Q8TEB1 | DDB1- and CUL4-associated factor 11 | 2.02e-07 | 4.36e-09 | 0.009 |
| 1. PB | Q6DH44 | WD repeat domain-containing protein 83 | 1.88e-14 | 1.13e-03 | 1.25e-09 |
| 1. PB | P54313 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.11e-15 | 1.46e-04 | 6.07e-14 |
| 1. PB | Q8AVH1 | Histone-binding protein RBBP7 | 2.44e-15 | 4.44e-02 | 3.34e-06 |
| 1. PB | Q6FJZ9 | Pre-mRNA-splicing factor PRP46 | 7.24e-10 | 7.81e-06 | 2.85e-08 |
| 1. PB | B6HP56 | Nuclear distribution protein nudF 1 | 2.31e-14 | 5.71e-04 | 8.99e-16 |
| 1. PB | Q8VE80 | THO complex subunit 3 | 9.77e-15 | 9.81e-07 | 5.39e-10 |
| 1. PB | A0A2R8RWN9 | F-box and WD repeat domain-containing 11-B | 1.10e-13 | 2.60e-02 | 1.57e-16 |
| 1. PB | Q29RH4 | THO complex subunit 3 | 6.51e-14 | 1.50e-04 | 1.48e-09 |
| 1. PB | Q9NV06 | DDB1- and CUL4-associated factor 13 | 6.30e-13 | 7.72e-07 | 0.001 |
| 1. PB | Q6CKE8 | Pre-mRNA-splicing factor PRP46 | 3.05e-13 | 2.13e-08 | 1.90e-07 |
| 1. PB | Q12417 | Pre-mRNA-splicing factor PRP46 | 1.24e-09 | 6.35e-06 | 1.72e-06 |
| 1. PB | Q4R304 | Histone-binding protein RBBP7 | 5.44e-15 | 3.63e-02 | 9.75e-07 |
| 1. PB | Q8VC51 | Telomerase Cajal body protein 1 | 9.11e-07 | 4.43e-06 | 1.26e-05 |
| 1. PB | Q42384 | Protein pleiotropic regulatory locus 1 | 1.86e-10 | 3.25e-02 | 1.49e-11 |
| 1. PB | A0DB19 | Lissencephaly-1 homolog 1 | 0.00e+00 | 6.21e-04 | 3.42e-20 |
| 1. PB | O48716 | Protein JINGUBANG | 2.45e-08 | 2.00e-02 | 1.87e-06 |
| 1. PB | O54929 | WD repeat and SOCS box-containing protein 2 | 1.72e-10 | 1.16e-05 | 1.07e-12 |
| 1. PB | D4DG66 | Nuclear distribution protein PAC1 | 4.90e-14 | 7.48e-04 | 3.30e-15 |
| 1. PB | Q8VZY6 | Polycomb group protein FIE2 | 4.24e-10 | 1.83e-03 | 0.003 |
| 1. PB | Q55AR8 | U5 small nuclear ribonucleoprotein 40 kDa protein | 4.00e-12 | 1.60e-06 | 1.28e-24 |
| 1. PB | Q5R9T6 | WD repeat-containing protein 55 | 6.66e-13 | 3.46e-05 | 6.31e-04 |
| 1. PB | Q09150 | Meiotic recombination protein rec14 | 0.00e+00 | 1.09e-02 | 3.78e-10 |
| 1. PB | Q13685 | Angio-associated migratory cell protein | 1.71e-08 | 2.51e-02 | 4.64e-05 |
| 1. PB | Q6PE01 | U5 small nuclear ribonucleoprotein 40 kDa protein | 5.66e-15 | 2.65e-07 | 1.89e-28 |
| 1. PB | Q8W1K8 | Protein Mut11 | 0.00e+00 | 4.87e-02 | 3.66e-20 |
| 1. PB | Q3E906 | Cell division cycle 20.5, cofactor of APC complex | 3.26e-09 | 5.75e-05 | 1.08e-09 |
| 1. PB | O54927 | WD repeat and SOCS box-containing protein 1 | 1.54e-11 | 3.73e-07 | 1.53e-13 |
| 1. PB | P69104 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 1.30e-02 | 3.40e-14 |
| 1. PB | Q9D7H2 | WD repeat-containing protein 5B | 1.02e-13 | 1.04e-03 | 4.06e-27 |
| 1. PB | Q5R7H5 | DDB1- and CUL4-associated factor 11 | 2.67e-07 | 8.07e-09 | 0.008 |
| 1. PB | Q8VEJ4 | Notchless protein homolog 1 | 1.59e-09 | 1.33e-02 | 6.78e-16 |
| 1. PB | C5FWH1 | Nuclear distribution protein PAC1 | 8.94e-14 | 2.69e-04 | 1.62e-15 |
| 1. PB | Q60525 | Telomerase Cajal body protein 1 | 1.87e-07 | 7.82e-05 | 1.04e-06 |
| 1. PB | P54311 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.22e-15 | 6.78e-05 | 4.82e-13 |
| 1. PB | Q5R5W8 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.33e-15 | 1.45e-04 | 1.52e-13 |
| 1. PB | Q4WEI5 | Histone acetyltransferase type B subunit 2 | 6.66e-16 | 4.09e-04 | 3.89e-09 |
| 1. PB | O16519 | Gastrulation defective protein 1 | 1.21e-07 | 1.12e-03 | 4.65e-08 |
| 1. PB | B8P4B0 | Nuclear distribution protein PAC1-1 | 6.66e-16 | 1.86e-02 | 9.56e-19 |
| 1. PB | P90917 | Probable histone-binding protein rba-1 | 4.44e-16 | 1.08e-04 | 6.80e-05 |
| 1. PB | Q9NVX2 | Notchless protein homolog 1 | 1.51e-09 | 3.05e-02 | 1.58e-16 |
| 1. PB | Q6P1V3 | WD repeat and SOCS box-containing protein 1 | 2.80e-09 | 3.72e-06 | 9.10e-13 |
| 1. PB | Q6CU55 | Nuclear distribution protein PAC1 | 2.98e-11 | 1.01e-04 | 5.40e-08 |
| 1. PB | Q13216 | DNA excision repair protein ERCC-8 | 2.36e-13 | 1.66e-04 | 3.24e-08 |
| 1. PB | Q96DI7 | U5 small nuclear ribonucleoprotein 40 kDa protein | 1.61e-12 | 1.05e-06 | 7.75e-28 |
| 1. PB | Q2UA71 | Histone acetyltransferase type B subunit 2 | 0.00e+00 | 2.59e-05 | 5.32e-08 |
| 1. PB | O22467 | Histone-binding protein MSI1 | 2.22e-16 | 8.19e-03 | 0.015 |
| 1. PB | P90916 | Probable histone-binding protein lin-53 | 1.89e-15 | 5.72e-03 | 4.09e-06 |
| 1. PB | C5GVJ9 | Nuclear distribution protein PAC1 | 3.71e-09 | 4.36e-04 | 4.10e-17 |
| 1. PB | Q9Y4P3 | Transducin beta-like protein 2 | 7.63e-09 | 1.22e-07 | 1.49e-07 |
| 1. PB | Q6CGP9 | Polyadenylation factor subunit 2 | 8.14e-09 | 5.06e-07 | 1.03e-08 |
| 1. PB | O18640 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 3.77e-02 | 8.51e-17 |
| 1. PB | C4JPW9 | Nuclear distribution protein PAC1-2 | 0.00e+00 | 1.52e-07 | 5.33e-17 |
| 1. PB | Q0P593 | Dynein assembly factor with WDR repeat domains 1 | 3.78e-11 | 2.35e-02 | 9.57e-33 |
| 1. PB | Q71UF4 | Histone-binding protein RBBP7 | 1.78e-15 | 3.63e-02 | 9.75e-07 |
| 1. PB | Q7ZTY4 | Histone-binding protein RBBP7 | 2.33e-15 | 1.58e-03 | 4.19e-05 |
| 1. PB | Q9SZA4 | Cell division cycle 20.1, cofactor of APC complex | 1.04e-08 | 8.37e-04 | 1.74e-11 |
| 1. PB | Q9LYK6 | Protein ANTHESIS POMOTING FACTOR 1 | 1.11e-16 | 4.36e-02 | 9.43e-05 |
| 1. PB | Q1JQD2 | Glutamate-rich WD repeat-containing protein 1 | 5.06e-10 | 7.02e-03 | 2.92e-07 |
| 1. PB | O93377 | Histone-binding protein RBBP4-A | 3.11e-15 | 1.14e-02 | 4.94e-05 |
| 1. PB | Q5XII5 | Telomerase Cajal body protein 1 | 1.51e-07 | 1.60e-05 | 6.53e-06 |
| 1. PB | Q9W5Z5 | WD repeat and SOCS box-containing protein 1 | 2.09e-11 | 3.40e-03 | 1.86e-15 |
| 1. PB | Q9R099 | Transducin beta-like protein 2 | 5.05e-09 | 7.48e-08 | 6.89e-08 |
| 1. PB | A1CF18 | Nuclear distribution protein nudF 2 | 0.00e+00 | 1.12e-07 | 5.20e-17 |
| 1. PB | Q8N7N5 | DDB1- and CUL4-associated factor 8 | 7.78e-09 | 2.11e-03 | 0.045 |
| 1. PB | Q08706 | Guanine nucleotide-binding protein subunit beta | 2.11e-15 | 1.85e-03 | 2.06e-09 |
| 1. PB | Q6BU94 | Pre-mRNA-splicing factor PRP46 | 2.41e-10 | 4.82e-07 | 7.26e-11 |
| 1. PB | Q09028 | Histone-binding protein RBBP4 | 0.00e+00 | 1.95e-02 | 3.13e-05 |
| 1. PB | Q5M786 | WD repeat-containing protein 5 | 0.00e+00 | 2.29e-04 | 6.23e-26 |
| 1. PB | Q92466 | DNA damage-binding protein 2 | 1.08e-08 | 3.17e-03 | 0.008 |
| 1. PB | Q54KL5 | WD repeat-containing protein 5 homolog | 6.66e-16 | 8.93e-03 | 9.07e-29 |
| 1. PB | Q6NWH1 | DDB1- and CUL4-associated factor 10 | 1.70e-07 | 9.28e-03 | 0.010 |
| 1. PB | Q6BK34 | Histone acetyltransferase type B subunit 2 | 6.05e-12 | 3.17e-03 | 0.010 |
| 1. PB | Q61Y48 | Probable histone-binding protein lin-53 | 0.00e+00 | 8.19e-03 | 5.22e-05 |
| 1. PB | O24467 | LEC14B homolog | 4.05e-10 | 1.05e-03 | 9.50e-10 |
| 1. PB | P62872 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.44e-15 | 6.78e-05 | 4.82e-13 |
| 1. PB | Q58D20 | Notchless protein homolog 1 | 2.87e-09 | 1.89e-02 | 7.25e-16 |
| 1. PB | Q5R654 | Histone-binding protein RBBP7 | 6.11e-15 | 1.01e-02 | 6.61e-05 |
| 1. PB | Q6P3H7 | Histone-binding protein RBBP4 | 2.66e-15 | 1.51e-02 | 7.01e-05 |
| 1. PB | Q2HBX6 | Nuclear distribution protein PAC1-1 | 4.05e-14 | 6.02e-04 | 8.52e-16 |
| 1. PB | Q12834 | Cell division cycle protein 20 homolog | 4.39e-08 | 2.00e-02 | 2.00e-09 |
| 1. PB | Q10281 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 2.37e-02 | 7.24e-19 |
| 1. PB | P49177 | Guanine nucleotide-binding protein subunit beta | 1.49e-14 | 8.85e-03 | 2.20e-11 |
| 1. PB | Q9FLX9 | Notchless protein homolog | 1.06e-08 | 1.02e-03 | 1.28e-17 |
| 1. PB | Q8R537 | Peroxisomal targeting signal 2 receptor | 0.00e+00 | 1.44e-02 | 3.52e-07 |
| 1. PB | O94394 | Uncharacterized WD repeat-containing protein C126.01c | 2.88e-13 | 4.02e-07 | 2.00e-05 |
| 1. PB | Q93847 | WD repeat-containing protein wdr-5.2 | 3.39e-12 | 2.47e-06 | 1.42e-24 |
| 1. PB | Q5U2M6 | DDB1- and CUL4-associated factor 8 | 3.11e-08 | 1.05e-03 | 0.043 |
| 1. PB | Q40153 | LEC14B protein | 5.17e-10 | 2.89e-07 | 7.90e-07 |
| 1. PB | P83774 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 4.94e-03 | 1.34e-11 |
| 1. PB | P26308 | Guanine nucleotide-binding protein subunit beta-1 | 2.22e-15 | 6.27e-04 | 3.76e-12 |
| 1. PB | O94620 | Pre-mRNA-splicing factor cwf17 | 4.77e-15 | 1.11e-06 | 7.62e-11 |
| 1. PB | Q9NDC9 | Lissencephaly-1 homolog | 0.00e+00 | 1.45e-03 | 1.13e-19 |
| 1. PB | Q1LV15 | Dynein assembly factor with WDR repeat domains 1 | 2.11e-11 | 6.74e-04 | 5.03e-28 |
| 1. PB | Q4V7A0 | WD repeat-containing protein 61 | 0.00e+00 | 2.24e-02 | 2.11e-12 |
| 1. PB | Q59WJ4 | Polyadenylation factor subunit 2 | 2.77e-09 | 2.20e-07 | 7.73e-06 |
| 1. PB | Q6FXI8 | Histone acetyltransferase type B subunit 2 | 3.64e-12 | 8.93e-03 | 1.16e-07 |
| 1. PB | Q61011 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.11e-15 | 2.27e-04 | 1.80e-11 |
| 1. PB | Q5RDY7 | Guanine nucleotide-binding protein subunit beta-5 | 2.24e-14 | 1.12e-03 | 5.69e-09 |
| 1. PB | Q5H7C0 | Cell division cycle protein 20 homolog | 3.74e-08 | 1.74e-02 | 3.90e-09 |
| 1. PB | Q7RY30 | Nuclear distribution protein nudF-2 | 3.85e-14 | 1.83e-03 | 5.88e-17 |
| 1. PB | Q86VZ2 | WD repeat-containing protein 5B | 1.83e-10 | 4.14e-04 | 4.28e-25 |
| 1. PB | P90794 | DDB1- and CUL4-associated factor 11 homolog | 1.28e-07 | 5.06e-07 | 1.12e-04 |
| 1. PB | Q6PBY0 | Guanine nucleotide-binding protein subunit beta-5b | 1.23e-14 | 1.41e-03 | 3.69e-09 |
| 1. PB | A9V790 | Lissencephaly-1 homolog | 0.00e+00 | 7.99e-05 | 1.01e-22 |
| 1. PB | Q5FWQ6 | Dynein assembly factor with WDR repeat domains 1 | 1.41e-11 | 1.78e-03 | 3.38e-27 |
| 1. PB | P62874 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.44e-15 | 6.78e-05 | 4.82e-13 |
| 1. PB | C5JD40 | Nuclear distribution protein PAC1 | 4.90e-09 | 4.36e-04 | 4.10e-17 |
| 1. PB | Q9LTJ6 | WD repeat-containing protein RUP1 | 5.99e-09 | 1.50e-04 | 0.004 |
| 1. PB | P52287 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.33e-15 | 3.39e-04 | 3.49e-11 |
| 1. PB | Q62623 | Cell division cycle protein 20 homolog | 3.89e-08 | 4.32e-02 | 1.17e-09 |
| 1. PB | Q5RCG7 | Angio-associated migratory cell protein | 2.43e-08 | 2.10e-02 | 5.15e-05 |
| 1. PB | A1DP19 | Nuclear distribution protein nudF | 1.24e-14 | 1.91e-06 | 4.26e-15 |
| 1. PB | Q4WT34 | Pre-mRNA-splicing factor prp46 | 2.35e-12 | 1.73e-05 | 6.07e-12 |
| 1. PB | Q20636 | Guanine nucleotide-binding protein subunit beta-2 | 6.54e-11 | 5.72e-06 | 7.05e-08 |
| 1. PB | Q2HJH6 | U5 small nuclear ribonucleoprotein 40 kDa protein | 3.12e-09 | 2.07e-07 | 4.28e-28 |
| 1. PB | D1ZEM6 | Nuclear distribution protein PAC1-2 | 2.24e-08 | 1.18e-02 | 7.11e-17 |
| 1. PB | Q9UTN4 | Polyadenylation factor subunit 2 | 4.94e-09 | 1.81e-02 | 2.94e-07 |
| 1. PB | Q5BK30 | Dynein assembly factor with WDR repeat domains 1 | 3.93e-11 | 8.37e-04 | 8.49e-32 |
| 1. PB | Q9H6Y2 | WD repeat-containing protein 55 | 3.30e-11 | 2.65e-05 | 3.41e-04 |
| 1. PB | O22469 | WD-40 repeat-containing protein MSI3 | 3.33e-16 | 2.72e-04 | 0.003 |
| 1. PB | Q6GPP0 | WD repeat-containing protein 70 | 2.12e-07 | 1.87e-03 | 1.19e-05 |
| 1. PB | P23232 | Guanine nucleotide-binding protein subunit beta | 1.78e-15 | 1.53e-04 | 3.48e-10 |
| 1. PB | C6HTE8 | Nuclear distribution protein PAC1 | 8.33e-15 | 9.93e-03 | 1.85e-20 |
| 1. PB | Q7S7L4 | Nuclear distribution protein nudF-1 | 5.85e-09 | 2.47e-03 | 3.80e-18 |
| 1. PB | P61964 | WD repeat-containing protein 5 | 0.00e+00 | 1.76e-04 | 1.84e-27 |
| 1. PB | P36408 | Guanine nucleotide-binding protein subunit beta | 6.66e-16 | 1.45e-07 | 2.01e-14 |
| 1. PB | Q5A7Q3 | Pre-mRNA-splicing factor PRP46 | 5.65e-10 | 1.93e-06 | 1.36e-11 |
| 1. PB | Q9SU78 | WD-40 repeat-containing protein MSI5 | 1.11e-09 | 1.81e-02 | 0.002 |
| 1. PB | P0CS42 | Nuclear distribution protein PAC1 | 4.44e-16 | 5.37e-04 | 2.95e-20 |
| 1. PB | Q9JHB4 | WD repeat-containing protein 31 | 5.87e-13 | 1.42e-06 | 2.07e-05 |
| 1. PB | Q6TMK6 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | NA | 1.06e-04 | 5.95e-13 |
| 1. PB | G0SC29 | Ribosome assembly protein 4 | 9.19e-08 | 4.13e-02 | 1.07e-18 |
| 1. PB | Q54S59 | WD repeat-containing protein 61 homolog | 0.00e+00 | 3.02e-03 | 1.28e-06 |
| 1. PB | Q9DAJ4 | WD repeat domain-containing protein 83 | 2.22e-16 | 1.93e-02 | 3.25e-11 |
| 1. PB | Q9Y1C1 | 77 kDa echinoderm microtubule-associated protein (Fragment) | 7.29e-06 | 9.28e-03 | 0.001 |
| 1. PB | Q32P44 | Echinoderm microtubule-associated protein-like 3 | 1.20e-04 | 2.47e-03 | 0.001 |
| 1. PB | P17343 | Guanine nucleotide-binding protein subunit beta-1 | 2.55e-15 | 6.34e-04 | 4.67e-11 |
| 1. PB | Q39190 | Protein pleiotropic regulator PRL2 | 9.04e-11 | 6.25e-03 | 1.36e-10 |
| 1. PB | Q93134 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 0.00e+00 | 2.26e-03 | 1.12e-16 |
| 1. PB | P61965 | WD repeat-containing protein 5 | 0.00e+00 | 1.76e-04 | 1.84e-27 |
| 1. PB | Q4R8E7 | Dynein assembly factor with WDR repeat domains 1 | 4.41e-11 | 8.27e-03 | 5.23e-31 |
| 1. PB | Q8I0F4 | Lissencephaly-1 homolog | 0.00e+00 | 5.83e-04 | 3.48e-21 |
| 1. PB | B0XM00 | Nuclear distribution protein nudF | 5.08e-14 | 2.09e-03 | 1.42e-15 |
| 1. PB | Q96J01 | THO complex subunit 3 | 3.66e-15 | 6.20e-06 | 1.55e-09 |
| 1. PB | P73594 | WD repeat-containing protein slr1409 | 7.02e-10 | 3.80e-04 | 1.15e-11 |
| 1. PB | P29829 | Guanine nucleotide-binding protein subunit beta-2 | 1.11e-16 | 8.06e-08 | 2.12e-17 |
| 1. PB | Q3TWF6 | WD repeat-containing protein 70 | 4.95e-06 | 1.91e-03 | 0.042 |
| 1. PB | Q9S7I8 | Cell division cycle 20.2, cofactor of APC complex | 1.02e-08 | 2.29e-04 | 2.37e-11 |
| 1. PB | Q6FJS0 | Polyadenylation factor subunit 2 | 1.24e-09 | 5.85e-06 | 1.39e-07 |
| 1. PB | Q0V8J1 | WD repeat and SOCS box-containing protein 2 | 2.39e-11 | 1.08e-04 | 5.38e-12 |
| 1. PB | B7FNU7 | Lissencephaly-1 homolog | 3.33e-16 | 4.24e-02 | 4.26e-15 |
| 1. PB | C0S902 | Nuclear distribution protein PAC1 | 4.35e-09 | 1.15e-05 | 4.99e-18 |
| 1. PB | Q8N136 | Dynein assembly factor with WDR repeat domains 1 | 4.15e-11 | 2.46e-02 | 2.40e-34 |
| 1. PB | Q6BVZ3 | Polyadenylation factor subunit 2 | 5.53e-10 | 1.05e-06 | 7.91e-08 |
| 1. PB | B6QC56 | Nuclear distribution protein nudF 1 | 4.22e-15 | 1.31e-04 | 8.07e-18 |
| 1. PB | Q9W7I5 | Histone-binding protein RBBP4 | 3.11e-15 | 3.22e-02 | 3.61e-05 |
| 1. PB | Q58DT8 | WD repeat-containing protein 55 | 2.59e-11 | 5.90e-04 | 6.94e-04 |
| 1. PB | P0CS43 | Nuclear distribution protein PAC1 | 8.88e-16 | 5.37e-04 | 2.95e-20 |
| 1. PB | A8XZJ9 | Lissencephaly-1 homolog | 0.00e+00 | 1.40e-02 | 1.23e-18 |
| 1. PB | A8XEN7 | DDB1- and CUL4-associated factor 11 homolog | 2.72e-07 | 4.18e-08 | 2.68e-06 |
| 1. PB | B6GZD3 | Nuclear distribution protein nudF 2 | 9.51e-13 | 7.09e-03 | 6.14e-17 |
| 1. PB | Q5GIS3 | Guanine nucleotide-binding protein subunit beta | 0.00e+00 | 4.42e-05 | 1.39e-11 |
| 1. PB | D3BUN1 | Lissencephaly-1 homolog | 1.11e-16 | 5.40e-03 | 4.74e-19 |
| 1. PB | Q61ZF6 | Guanine nucleotide-binding protein subunit beta-1 | 2.55e-15 | 6.34e-04 | 4.67e-11 |
| 1. PB | Q4ICM0 | Nuclear distribution protein PAC1 | 3.12e-14 | 1.02e-02 | 1.56e-16 |
| 1. PB | Q0D0X6 | Nuclear distribution protein nudF | 2.49e-14 | 1.20e-02 | 1.77e-15 |
| 1. PB | A2AKB9 | DDB1- and CUL4-associated factor 10 | 5.37e-07 | 2.68e-03 | 7.83e-04 |
| 1. PB | B2AEZ5 | Nuclear distribution protein PAC1-1 | 1.08e-13 | 6.69e-03 | 3.48e-16 |
| 1. PB | P62873 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.33e-15 | 6.78e-05 | 4.82e-13 |
| 1. PB | A7EKM8 | Nuclear distribution protein PAC1 | 5.61e-11 | 2.17e-06 | 7.98e-19 |
| 1. PB | Q8CFD5 | DNA excision repair protein ERCC-8 | 4.52e-12 | 2.13e-04 | 9.29e-09 |
| 1. PB | Q5RFF8 | Notchless protein homolog 1 | 3.98e-09 | 3.73e-02 | 1.74e-16 |
| 1. PB | P46800 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 2.41e-02 | 5.76e-16 |
| 1. PB | O35353 | Guanine nucleotide-binding protein subunit beta-4 | 2.44e-15 | 3.18e-04 | 2.81e-12 |
| 1. PB | Q6LA54 | Uncharacterized WD repeat-containing protein C3H5.08c | 2.93e-04 | 3.08e-03 | 0.002 |
| 1. PB | Q4I7L0 | Histone acetyltransferase type B subunit 2 | 4.55e-15 | 1.03e-04 | 4.69e-10 |
| 1. PB | Q6INH0 | Histone-binding protein RBBP4-B | 4.66e-15 | 3.60e-02 | 4.65e-05 |
| 1. PB | O14775 | Guanine nucleotide-binding protein subunit beta-5 | 4.66e-15 | 9.61e-05 | 4.65e-09 |
| 1. PB | Q60973 | Histone-binding protein RBBP7 | 4.44e-15 | 4.40e-02 | 9.84e-07 |
| 1. PB | Q5BLX8 | WD repeat domain-containing protein 83 | 1.11e-16 | 1.19e-02 | 2.28e-11 |
| 1. PB | Q5RF51 | U5 small nuclear ribonucleoprotein 40 kDa protein | 1.41e-12 | 1.22e-07 | 2.28e-28 |
| 1. PB | O60136 | Uncharacterized WD repeat-containing protein C18H10.05 | 9.92e-08 | 4.31e-03 | 1.04e-05 |
| 1. PB | P62871 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.44e-15 | 6.78e-05 | 4.82e-13 |
| 1. PB | Q3Y8L7 | Dynein assembly factor with WDR repeat domains 1 | 6.42e-11 | 7.96e-08 | 6.85e-28 |
| 1. PB | Q7ZYQ6 | DDB1- and CUL4-associated factor 13 | 1.37e-14 | 1.67e-08 | 2.65e-05 |
| 1. PB | Q6PNB6 | Guanine nucleotide-binding protein subunit beta-5 | 9.33e-15 | 3.54e-03 | 5.95e-09 |
| 1. PB | Q3MHL3 | Histone-binding protein RBBP4 | 4.22e-15 | 1.95e-02 | 3.13e-05 |
| 1. PB | O42248 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 0.00e+00 | 3.47e-02 | 2.64e-16 |
| 1. PB | Q5XGI5 | WD repeat domain-containing protein 83 | 3.33e-16 | 2.60e-03 | 2.04e-12 |
| 1. PB | Q2KIG2 | WD repeat-containing protein 5 | 0.00e+00 | 2.58e-04 | 1.88e-27 |
| 1. PB | Q9CX97 | WD repeat-containing protein 55 | 1.68e-11 | 1.36e-05 | 3.82e-05 |
| 1. PB | Q09990 | F-box/WD repeat-containing protein lin-23 | 4.22e-10 | 5.34e-03 | 1.05e-19 |
| 1. PB | P62880 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.22e-15 | 1.46e-04 | 6.07e-14 |
| 1. PB | A1L112 | WD repeat-containing protein 55 | 8.15e-14 | 1.13e-05 | 4.85e-05 |
| 1. PB | Q9LV28 | Receptor for activated C kinase 1C | 0.00e+00 | 3.77e-02 | 3.88e-19 |
| 1. PB | O43017 | Set1 complex component swd3 | 5.06e-12 | 2.04e-04 | 3.50e-14 |
| 1. PB | Q9BRX9 | WD repeat domain-containing protein 83 | 4.44e-16 | 2.33e-03 | 4.24e-11 |
| 1. PB | B2ZZS9 | WD repeat-containing protein 55 | 5.86e-08 | 2.65e-06 | 7.19e-07 |
| 1. PB | O43818 | U3 small nucleolar RNA-interacting protein 2 | 1.16e-11 | 3.77e-02 | 9.72e-12 |
| 1. PB | B8M0Q1 | Nuclear distribution protein nudF | 2.89e-15 | 3.32e-04 | 2.21e-17 |
| 1. PB | Q25189 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 2.58e-03 | 3.18e-15 |
| 1. PB | Q60972 | Histone-binding protein RBBP4 | 5.88e-15 | 1.95e-02 | 3.13e-05 |
| 1. PB | Q6L4F8 | Guanine nucleotide-binding protein subunit beta-like protein B | 0.00e+00 | 5.31e-04 | 1.22e-14 |
| 1. PB | Q9I8G9 | Histone-binding protein RBBP7 | 2.00e-15 | 2.04e-02 | 3.25e-06 |
| 1. PB | C1GB49 | Nuclear distribution protein PAC1 | 7.53e-09 | 2.17e-05 | 3.76e-18 |
| 1. PB | O74340 | Protein sof1 | 5.19e-12 | 5.10e-05 | 7.29e-14 |
| 1. PB | Q9UT73 | Uncharacterized WD repeat-containing protein C343.17c | 5.07e-06 | 2.52e-04 | 0.038 |
| 1. PB | Q39221 | SEC12-like protein 2 | 9.66e-13 | 9.37e-03 | 0.020 |
| 1. PB | C5PFX0 | Nuclear distribution protein PAC1 | 6.66e-08 | 7.82e-05 | 1.31e-13 |
| 1. PB | O14435 | Guanine nucleotide-binding protein subunit beta | 3.46e-11 | 9.70e-06 | 1.55e-08 |
| 1. PB | Q7KWL3 | DDB1- and CUL4-associated factor 13 | 8.50e-13 | 9.14e-08 | 1.12e-10 |
| 1. PB | P53196 | 26S proteasome regulatory subunit RPN14 | 1.23e-09 | 2.90e-03 | 5.00e-05 |
| 1. PB | Q80ZD0 | Guanine nucleotide-binding protein subunit beta-5 | 2.28e-14 | 2.35e-03 | 5.95e-09 |
| 1. PB | O43660 | Pleiotropic regulator 1 | 1.86e-08 | 2.96e-02 | 5.73e-09 |
| 1. PB | Q4P9P9 | Nuclear distribution protein PAC1 | 0.00e+00 | 3.91e-03 | 3.22e-23 |
| 1. PB | P25387 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 2.45e-03 | 2.33e-17 |
| 1. PB | P79147 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.11e-15 | 5.26e-04 | 2.54e-12 |
| 1. PB | Q8NA23 | WD repeat-containing protein 31 | 2.21e-13 | 1.33e-07 | 3.16e-05 |
| 1. PB | B3MJV8 | Ribosome biogenesis protein WDR12 homolog | 5.31e-11 | 3.84e-02 | 4.93e-12 |
| 1. PB | Q8VC03 | Echinoderm microtubule-associated protein-like 3 | 2.06e-04 | 3.27e-03 | 7.91e-04 |
| 1. PB | Q5TAQ9 | DDB1- and CUL4-associated factor 8 | 3.44e-08 | 1.19e-02 | 0.043 |
| 1. PB | Q2UGU1 | Nuclear distribution protein nudF | 1.33e-14 | 6.49e-05 | 2.94e-19 |
| 1. PB | Q6P5M2 | WD repeat-containing protein 61 | 0.00e+00 | 8.68e-03 | 3.14e-19 |
| 1. PB | Q7S7N3 | Histone acetyltransferase type B subunit 2 | 7.67e-11 | 4.05e-04 | 1.31e-08 |
| 1. PB | Q9M2Z2 | COMPASS-like H3K4 histone methylase component WDR5A | 0.00e+00 | 2.99e-04 | 2.60e-25 |
| 1. PB | Q803X4 | DDB1- and CUL4-associated factor 13 | 1.30e-14 | 3.39e-07 | 7.78e-08 |
| 1. PB | O13615 | Pre-mRNA-splicing factor prp5 | 5.02e-13 | 5.66e-04 | 5.87e-09 |
| 1. PB | Q5RF92 | Histone-binding protein RBBP4 | 4.00e-15 | 1.16e-02 | 3.33e-05 |
| 1. PB | Q26613 | 77 kDa echinoderm microtubule-associated protein | 3.04e-06 | 3.40e-02 | 9.00e-05 |
| 1. PB | Q16576 | Histone-binding protein RBBP7 | 2.78e-15 | 3.63e-02 | 9.75e-07 |
| 1. PB | P42841 | Polyadenylation factor subunit 2 | 3.16e-10 | 8.34e-05 | 8.68e-08 |
| 1. PB | D4AZ50 | Nuclear distribution protein PAC1 | 5.23e-14 | 7.48e-04 | 3.30e-15 |
| 1. PB | Q3KQ62 | WD repeat domain-containing protein 83 | 2.22e-16 | 1.59e-03 | 6.02e-09 |
| 1. PB | B8N9H4 | Nuclear distribution protein nudF | 0.00e+00 | 6.49e-05 | 2.94e-19 |
| 1. PB | Q5JTN6 | WD repeat-containing protein 38 | 0.00e+00 | 8.51e-03 | 5.99e-28 |
| 1. PB | P62879 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.11e-15 | 1.46e-04 | 6.07e-14 |
| 1. PB | Q6CP71 | Polyadenylation factor subunit 2 | 5.40e-09 | 1.37e-06 | 1.08e-06 |
| 1. PB | Q5E9I8 | DDB1- and CUL4-associated factor 11 | 1.57e-07 | 3.82e-09 | 0.007 |
| 1. PB | O42249 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 0.00e+00 | 1.28e-02 | 1.85e-15 |
| 1. PB | Q9Y6I7 | WD repeat and SOCS box-containing protein 1 | 1.59e-11 | 1.85e-05 | 1.18e-14 |
| 1. PB | A1CUD6 | Nuclear distribution protein nudF 1 | 4.73e-14 | 8.64e-04 | 8.43e-15 |
| 1. PB | P74598 | Uncharacterized WD repeat-containing protein sll1491 | 2.44e-10 | 2.68e-02 | 1.27e-13 |
| 1. PB | Q5R448 | DDB1- and CUL4-associated factor 8 | 9.51e-07 | 9.83e-03 | 0.033 |
| 1. PB | Q6PH57 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.33e-15 | 6.49e-05 | 8.21e-14 |
| 1. PB | Q5RE95 | WD repeat-containing protein 5B | 2.42e-11 | 8.64e-04 | 9.49e-26 |
| 1. PB | O00628 | Peroxisomal targeting signal 2 receptor | 0.00e+00 | 1.37e-03 | 3.95e-06 |
| 1. PB | Q4V8C4 | WD repeat-containing protein 5B | 1.12e-13 | 3.28e-05 | 3.76e-26 |
| 1. PB | P97865 | Peroxisomal targeting signal 2 receptor | 0.00e+00 | 3.08e-03 | 1.91e-06 |
| 1. PB | P33750 | Protein SOF1 | 1.07e-12 | 1.23e-05 | 2.05e-06 |
| 1. PB | Q9VPR4 | Protein Notchless | 3.34e-08 | 1.02e-03 | 3.15e-13 |
| 1. PB | P29387 | Guanine nucleotide-binding protein subunit beta-4 | 2.55e-15 | 2.86e-04 | 2.78e-12 |
| 1. PB | Q54SD4 | Probable histone-binding protein rbbD | 0.00e+00 | 2.03e-03 | 1.59e-07 |
| 1. PB | P69103 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | 1.30e-02 | 3.40e-14 |
| 1. PB | Q3SWZ7 | Telomerase Cajal body protein 1 | 1.83e-06 | 1.45e-03 | 2.42e-06 |
| 1. PB | Q5BIM8 | DNA excision repair protein ERCC-8 | 5.81e-12 | 2.32e-04 | 2.75e-07 |
| 1. PB | Q4PSE4 | Cell division cycle 20.4, cofactor of APC complex | 4.63e-10 | 1.27e-03 | 1.49e-07 |
| 1. PB | Q6C709 | Pre-mRNA-splicing factor PRP46 | 1.46e-10 | 2.07e-03 | 6.86e-14 |
| 1. PB | P16520 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.11e-15 | 2.96e-04 | 2.94e-12 |
| 1. PB | P11017 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.22e-15 | 1.46e-04 | 6.07e-14 |
| 1. PB | Q91VU6 | DDB1- and CUL4-associated factor 11 | 2.97e-07 | 7.76e-09 | 0.008 |
| 1. PB | Q00664 | Nuclear distribution protein nudF | 1.78e-14 | 6.74e-04 | 1.26e-17 |
| 1. PB | Q0VA16 | WD repeat-containing protein 70 | 2.27e-05 | 1.74e-03 | 9.17e-06 |
| 1. PB | Q7YR70 | Angio-associated migratory cell protein | 3.10e-08 | 3.47e-02 | 1.88e-04 |
| 1. PB | O45040 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.00e-15 | 3.50e-04 | 1.74e-11 |
| 2. P | P0DOC0 | Protein cortex | 7.37e-08 | 4.22e-04 | NA |
| 2. P | Q99J79 | DNA damage-binding protein 2 | 1.14e-06 | 9.00e-04 | NA |
| 2. P | Q0VBY8 | DNA damage-binding protein 2 | 1.53e-08 | 1.50e-03 | NA |
| 2. P | Q8VZY7 | Polycomb group protein FIE1 | 3.35e-08 | 3.50e-03 | NA |
| 2. P | Q32LB0 | WD repeat-containing protein 70 | 2.63e-06 | 4.35e-03 | NA |
| 2. P | Q93VB2 | Autophagy-related protein 18a | 6.32e-07 | 1.72e-02 | NA |
| 2. P | O74763 | Uncharacterized WD repeat-containing protein C17D11.08 | 1.28e-09 | 7.29e-03 | NA |
| 2. P | Q2UM42 | Probable catabolite repression protein creC | 2.30e-04 | 6.80e-06 | NA |
| 2. P | Q10G81 | Histone-binding protein MSI1 homolog | 3.11e-15 | 1.26e-02 | NA |
| 2. P | Q8BGW4 | DDB1- and CUL4-associated factor 12-like protein 2 | 1.53e-06 | 4.31e-03 | NA |
| 2. P | O15213 | WD repeat-containing protein 46 | 2.12e-07 | 5.09e-03 | NA |
| 2. P | Q28DT7 | Polycomb protein eed | 3.87e-08 | 3.40e-03 | NA |
| 2. P | P0DOB8 | Protein cortex | 2.70e-06 | 5.95e-05 | NA |
| 2. P | Q2YDS1 | DNA damage-binding protein 2 | 9.87e-07 | 4.06e-03 | NA |
| 2. P | Q6ZJX0 | Polycomb group protein FIE1 | 7.63e-12 | 1.48e-02 | NA |
| 2. P | Q5EB92 | WD repeat-containing protein 70 | 8.37e-07 | 1.15e-03 | NA |
| 2. P | Q8UUP2 | Polycomb protein eed-A | 6.27e-09 | 8.12e-04 | NA |
| 2. P | Q9P4R5 | Catabolite repression protein creC | 7.04e-06 | 1.06e-02 | NA |
| 2. P | Q5ZKH3 | Polycomb protein EED | 9.96e-10 | 9.02e-03 | NA |
| 2. P | P40077 | Protein DSE1 | 3.00e-05 | 3.73e-02 | NA |
| 2. P | Q3UMY5 | Echinoderm microtubule-associated protein-like 4 | 7.76e-05 | 1.87e-03 | NA |
| 2. P | Q3SZ25 | Polycomb protein EED | 6.18e-09 | 2.75e-02 | NA |
| 2. P | P39984 | Histone acetyltransferase type B subunit 2 | 1.13e-11 | 2.90e-03 | NA |
| 2. P | Q66JG1 | DNA damage-binding protein 2 | 1.94e-07 | 1.09e-02 | NA |
| 2. P | Q59RH5 | Histone acetyltransferase type B subunit 2 | 5.67e-13 | 4.27e-03 | NA |
| 2. P | Q4WN25 | Probable catabolite repression protein creC | 8.33e-05 | 1.32e-05 | NA |
| 2. P | Q9W351 | Aladin | 2.23e-12 | 4.27e-04 | NA |
| 2. P | Q6AZS2 | Polycomb protein eed-B | 1.57e-09 | 1.30e-03 | NA |
| 2. P | Q8N3Y1 | F-box/WD repeat-containing protein 8 | 1.07e-05 | 4.31e-03 | NA |
| 2. P | A1DMI8 | Probable catabolite repression protein creC | 8.74e-05 | 8.82e-04 | NA |
| 2. P | B0Y7H6 | Probable catabolite repression protein creC | 1.00e-04 | 1.32e-05 | NA |
| 2. P | Q6CNC8 | Protein DSE1 | 1.06e-05 | 2.50e-04 | NA |
| 2. P | O75530 | Polycomb protein EED | 5.06e-10 | 1.54e-02 | NA |
| 2. P | Q10990 | Cell division cycle protein cdt2 | 3.80e-08 | 1.64e-02 | NA |
| 2. P | Q5VU92 | DDB1- and CUL4-associated factor 12-like protein 1 | 2.27e-06 | 4.14e-03 | NA |
| 2. P | A6NGE4 | DDB1- and CUL4-associated factor 8-like protein 1 | 1.67e-06 | 2.74e-04 | NA |
| 2. P | Q5M9G8 | DDB1- and CUL4-associated factor 11 | 2.03e-07 | 2.43e-09 | NA |
| 2. P | P0DOB9 | Protein cortex | 8.95e-08 | 2.93e-03 | NA |
| 2. P | Q12206 | Transcriptional modulator WTM2 | 2.35e-06 | 1.35e-02 | NA |
| 2. P | P32330 | 2-deoxy-glucose resistant protein 2 | 1.54e-04 | 8.29e-04 | NA |
| 2. P | P42000 | U3 small nucleolar RNA-associated protein 18 homolog | 5.78e-09 | 2.71e-05 | NA |
| 2. P | Q12363 | Transcriptional modulator WTM1 | 3.15e-09 | 2.26e-03 | NA |
| 2. P | Q8NA75 | DDB1- and CUL4-associated factor 4-like protein 2 | 1.50e-14 | 2.65e-02 | NA |
| 2. P | Q8GWR1 | Aladin | 1.56e-07 | 2.27e-04 | NA |
| 2. P | Q75AI1 | Protein DSE1 | 1.13e-06 | 1.58e-04 | NA |
| 2. P | Q6ZJW8 | Polycomb group protein FIE1 | 1.66e-09 | 1.47e-03 | NA |
| 2. P | Q5TJE7 | WD repeat-containing protein 46 | 9.29e-06 | 2.99e-04 | NA |
| 2. P | Q28I90 | DDB1- and CUL4-associated factor 8 | 1.12e-07 | 2.80e-02 | NA |
| 2. P | Q9Z0H1 | WD repeat-containing protein 46 | 4.49e-07 | 1.45e-03 | NA |
| 2. P | Q6NRH1 | DDB1- and CUL4-associated factor 8 | 1.10e-08 | 7.37e-03 | NA |
| 2. P | Q9FFA7 | WD repeat-containing protein RUP2 | 2.27e-08 | 2.18e-02 | NA |
| 2. P | B8N4F5 | Probable catabolite repression protein creC | 4.37e-05 | 6.80e-06 | NA |
| 2. P | Q0CKB1 | Probable catabolite repression protein creC | 1.49e-05 | 4.74e-02 | NA |
| 2. P | Q6NVS5 | DDB1- and CUL4-associated factor 13 | 1.41e-14 | 1.47e-08 | NA |
| 2. P | Q75C99 | Histone acetyltransferase type B subunit 2 | 6.52e-10 | 1.01e-03 | NA |
| 2. P | Q9NW82 | WD repeat-containing protein 70 | 1.90e-07 | 3.43e-02 | NA |
| 2. P | Q9HC35 | Echinoderm microtubule-associated protein-like 4 | 4.67e-05 | 1.25e-02 | NA |
| 2. P | Q38960 | WD repeat-containing protein LWD2 | 0.00e+00 | 2.46e-02 | NA |
| 2. P | Q5ZLK1 | DDB1- and CUL4-associated factor 13 | 6.10e-13 | 2.15e-06 | NA |
| 2. P | Q9UKN8 | General transcription factor 3C polypeptide 4 | 2.47e-03 | 3.80e-02 | NA |
| 2. P | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 9.88e-01 | 1.60e-02 | NA |
| 2. P | P53851 | Protein TEX1 | 3.57e-08 | 1.20e-03 | NA |
| 2. P | Q8GYE0 | SEC12-like protein 1 | 3.22e-15 | 3.54e-05 | NA |
| 2. P | Q2TAF3 | Echinoderm microtubule-associated protein-like 4 | 3.28e-04 | 5.40e-06 | NA |
| 2. P | Q6DIP5 | Echinoderm microtubule-associated protein-like 4 | 8.45e-05 | 8.53e-05 | NA |
| 2. P | Q566T0 | Polycomb protein eed | 6.13e-10 | 1.50e-03 | NA |
| 2. P | Q921E6 | Polycomb protein EED | 3.25e-10 | 1.54e-02 | NA |
| 2. P | A2QVV2 | Probable catabolite repression protein creC | 1.52e-04 | 1.40e-02 | NA |
| 2. P | A1CTE6 | Probable catabolite repression protein creC | 3.03e-05 | 6.65e-06 | NA |
| 3. B | Q9D994 | WD repeat-containing protein 38 | 0.00e+00 | NA | 7.84e-27 |
| 3. B | B4KGX9 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.17e-05 |
| 3. B | Q09406 | Autophagic-related protein 16.2 | 2.79e-08 | NA | 0.005 |
| 3. B | Q8YRI1 | Uncharacterized WD repeat-containing protein alr3466 | 1.69e-05 | NA | 6.96e-35 |
| 3. B | Q5R664 | Coatomer subunit beta' | 6.32e-07 | NA | 1.11e-09 |
| 3. B | Q8AVS9 | DDB1- and CUL4-associated factor 10 | 3.83e-08 | NA | 0.001 |
| 3. B | B4JWA1 | Lissencephaly-1 homolog | 0.00e+00 | NA | 5.97e-20 |
| 3. B | A4RDD7 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 9.94e-05 |
| 3. B | Q29HG9 | Protein LST8 homolog | 1.11e-16 | NA | 3.37e-18 |
| 3. B | A2R3Z3 | Mitochondrial division protein 1 | 9.34e-09 | NA | 9.65e-07 |
| 3. B | Q05048 | Cleavage stimulation factor subunit 1 | 1.36e-12 | NA | 5.37e-10 |
| 3. B | O00423 | Echinoderm microtubule-associated protein-like 1 | 8.82e-06 | NA | 0.028 |
| 3. B | Q8SRK1 | Histone acetyltransferase type B subunit 2 | 0.00e+00 | NA | 1.94e-05 |
| 3. B | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 | 9.09e-11 | NA | 9.68e-15 |
| 3. B | P87177 | Uncharacterized WD repeat-containing protein C3D6.12 | 1.63e-06 | NA | 6.02e-13 |
| 3. B | A8XL02 | Ribosome biogenesis protein WDR12 homolog | 2.07e-08 | NA | 2.09e-05 |
| 3. B | Q8BFQ4 | WD repeat-containing protein 82 | 0.00e+00 | NA | 1.70e-05 |
| 3. B | P53197 | APC/C activator protein CDH1 | 9.03e-07 | NA | 1.45e-05 |
| 3. B | B3NPW0 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.04e-20 |
| 3. B | Q6P0D9 | Probable cytosolic iron-sulfur protein assembly protein ciao1 | 0.00e+00 | NA | 5.26e-07 |
| 3. B | Q1DIW7 | Mitochondrial division protein 1 | 3.28e-07 | NA | 8.91e-05 |
| 3. B | Q04305 | U3 small nucleolar RNA-associated protein 15 | 6.72e-09 | NA | 0.026 |
| 3. B | Q9ULI1 | NACHT and WD repeat domain-containing protein 2 | 3.37e-03 | NA | 0.029 |
| 3. B | Q7RXH4 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 6.78e-05 |
| 3. B | P35606 | Coatomer subunit beta' | 8.33e-07 | NA | 1.03e-09 |
| 3. B | B4MY77 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 7.22e-07 |
| 3. B | P0CS30 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.22e-15 | NA | 6.12e-04 |
| 3. B | Q92636 | Protein FAN | 5.30e-07 | NA | 1.54e-10 |
| 3. B | Q6CEW7 | Ribosome biogenesis protein YTM1 | 2.58e-07 | NA | 6.74e-04 |
| 3. B | Q12788 | Transducin beta-like protein 3 | 3.03e-08 | NA | 3.27e-11 |
| 3. B | C5FP68 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.60e-09 | NA | 1.37e-18 |
| 3. B | B8PD53 | Nuclear distribution protein PAC1-2 | NA | NA | 1.33e-19 |
| 3. B | Q86HX1 | Protein HIRA | 1.77e-06 | NA | 6.46e-09 |
| 3. B | Q8MYE8 | Probable proteasomal ATPase-associated factor 1 | 2.45e-11 | NA | 5.79e-04 |
| 3. B | Q32LN7 | WD repeat-containing protein 61 | 0.00e+00 | NA | 8.60e-13 |
| 3. B | P41318 | Target of rapamycin complex subunit LST8 | 0.00e+00 | NA | 3.22e-15 |
| 3. B | Q6BZX5 | Protein transport protein SEC13 | 2.44e-15 | NA | 1.85e-04 |
| 3. B | Q149M9 | NACHT domain- and WD repeat-containing protein 1 | 1.00e-03 | NA | 0.004 |
| 3. B | Q6NZH4 | Lissencephaly-1 homolog | 0.00e+00 | NA | 5.20e-19 |
| 3. B | A8WVX8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.55e-05 |
| 3. B | Q8SQS4 | Transcription initiation factor TFIID subunit 5 | 2.70e-08 | NA | 2.34e-05 |
| 3. B | B0LSW3 | Platelet-activating factor acetylhydrolase IB subunit beta | 0.00e+00 | NA | 7.75e-20 |
| 3. B | P49846 | Transcription initiation factor TFIID subunit 5 | 1.71e-08 | NA | 2.68e-15 |
| 3. B | Q5FW06 | DDB1- and CUL4-associated factor 10 | 2.32e-07 | NA | 0.001 |
| 3. B | Q9R1K5 | Fizzy-related protein homolog | 1.70e-07 | NA | 1.13e-06 |
| 3. B | A2QP30 | Nuclear distribution protein nudF | 0.00e+00 | NA | 1.59e-15 |
| 3. B | Q4I7X1 | Polyadenylation factor subunit 2 | 2.08e-09 | NA | 4.87e-06 |
| 3. B | Q8YV57 | Uncharacterized WD repeat-containing protein all2124 | 1.54e-08 | NA | 2.18e-35 |
| 3. B | Q8HXX0 | Platelet-activating factor acetylhydrolase IB subunit alpha | 0.00e+00 | NA | 1.34e-19 |
| 3. B | B9WN49 | Restriction of telomere capping protein 1 | 8.31e-04 | NA | 0.009 |
| 3. B | Q9P775 | Uncharacterized WD repeat-containing protein C17D11.16 | 2.06e-06 | NA | 0.007 |
| 3. B | Q80T85 | DDB1- and CUL4-associated factor 5 | 3.99e-05 | NA | 4.77e-04 |
| 3. B | Q499N3 | WD repeat-containing protein 18 | 5.19e-08 | NA | 2.10e-10 |
| 3. B | O43071 | Pre-mRNA-processing factor 17 | 9.08e-09 | NA | 3.48e-13 |
| 3. B | Q0VC24 | Ribosome biogenesis protein WDR12 | 1.28e-09 | NA | 5.65e-09 |
| 3. B | Q4P6E2 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.61e-05 |
| 3. B | Q05583 | Cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 1.53e-10 |
| 3. B | P16371 | Protein groucho | 1.39e-08 | NA | 1.22e-06 |
| 3. B | Q9D0I6 | WD repeat, SAM and U-box domain-containing protein 1 | 1.70e-12 | NA | 2.17e-16 |
| 3. B | Q86TI4 | WD repeat-containing protein 86 | 2.68e-10 | NA | 1.36e-14 |
| 3. B | Q9FKT5 | THO complex subunit 3 | 0.00e+00 | NA | 2.09e-13 |
| 3. B | Q4WVS4 | Mitochondrial division protein 1 | 1.59e-05 | NA | 0.004 |
| 3. B | Q54MZ3 | Anaphase-promoting complex subunit cdc20 | 2.67e-07 | NA | 1.92e-07 |
| 3. B | Q90ZL4 | Lissencephaly-1 homolog | 0.00e+00 | NA | 8.26e-19 |
| 3. B | A6ZPA6 | Nuclear distribution protein PAC1 | 2.40e-11 | NA | 3.77e-04 |
| 3. B | P63245 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | A8QB65 | Ribosome biogenesis protein WDR12 homolog | 8.38e-12 | NA | 4.75e-08 |
| 3. B | Q9C270 | Periodic tryptophan protein 2 homolog | 4.70e-04 | NA | 2.24e-16 |
| 3. B | Q5R1S9 | Chromatin assembly factor 1 subunit B | 9.40e-12 | NA | 9.93e-08 |
| 3. B | Q54N86 | F-box/WD repeat-containing protein A-like protein | 4.46e-05 | NA | 9.40e-06 |
| 3. B | O17468 | Protein HIRA homolog | 1.43e-06 | NA | 1.11e-05 |
| 3. B | P61480 | Ribosome biogenesis protein WDR12 | 1.14e-09 | NA | 5.17e-09 |
| 3. B | A5DGL8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.93e-04 |
| 3. B | P0CS54 | Ribosome biogenesis protein YTM1 | 6.88e-08 | NA | 4.15e-04 |
| 3. B | Q6P1W0 | Denticleless protein homolog | 1.50e-08 | NA | 4.56e-06 |
| 3. B | Q3SWS8 | mRNA export factor | 2.33e-11 | NA | 0.003 |
| 3. B | Q99973 | Telomerase protein component 1 | 3.63e-03 | NA | 5.47e-12 |
| 3. B | O75037 | Kinesin-like protein KIF21B | 7.42e-04 | NA | 0.005 |
| 3. B | Q54LT8 | Serine-threonine kinase receptor-associated protein | 0.00e+00 | NA | 4.06e-13 |
| 3. B | Q94A40 | Coatomer subunit alpha-1 | 7.06e-10 | NA | 4.47e-11 |
| 3. B | B3MC74 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 1.59e-09 |
| 3. B | Q6C553 | Protein HIR1 | 1.84e-06 | NA | 1.71e-08 |
| 3. B | O13286 | WD repeat-containing protein srw1 | 4.97e-09 | NA | 8.25e-08 |
| 3. B | Q0J3D9 | Coatomer subunit alpha-3 | 4.05e-10 | NA | 1.53e-11 |
| 3. B | Q8TAF3 | WD repeat-containing protein 48 | 1.98e-07 | NA | 1.71e-12 |
| 3. B | O93277 | WD repeat-containing protein 1 | 8.97e-06 | NA | 2.57e-07 |
| 3. B | Q9M3B4 | Protein ROOT INITIATION DEFECTIVE 3 | 5.40e-09 | NA | 4.86e-06 |
| 3. B | Q7Z4S6 | Kinesin-like protein KIF21A | 6.28e-04 | NA | 1.11e-04 |
| 3. B | Q5ZKU8 | p21-activated protein kinase-interacting protein 1-like | 7.21e-11 | NA | 1.08e-06 |
| 3. B | Q6NLV4 | Flowering time control protein FY | 5.52e-08 | NA | 7.13e-13 |
| 3. B | Q2TBS9 | WD40 repeat-containing protein SMU1 | 4.65e-11 | NA | 2.11e-14 |
| 3. B | A7ETB3 | Mitochondrial division protein 1 | 8.90e-07 | NA | 0.003 |
| 3. B | Q55FJ2 | WD repeat-containing protein 91 homolog | 1.01e-08 | NA | 1.18e-04 |
| 3. B | Q01277 | Probable E3 ubiquitin ligase complex SCF subunit scon-2 | 1.55e-07 | NA | 2.92e-17 |
| 3. B | Q9VU68 | Actin-interacting protein 1 | 3.63e-08 | NA | 4.25e-07 |
| 3. B | Q86A97 | EARP-interacting protein homolog | 1.73e-14 | NA | 4.05e-04 |
| 3. B | O88879 | Apoptotic protease-activating factor 1 | 2.21e-07 | NA | 5.34e-16 |
| 3. B | Q28I85 | POC1 centriolar protein homolog A | 1.84e-14 | NA | 5.99e-19 |
| 3. B | Q5U4D9 | THO complex subunit 6 homolog | 8.88e-15 | NA | 0.003 |
| 3. B | Q29KQ0 | Ribosome biogenesis protein WDR12 homolog | 6.42e-14 | NA | 2.01e-12 |
| 3. B | P25382 | Ribosome assembly protein 4 | 1.69e-08 | NA | 3.36e-16 |
| 3. B | Q5I0B9 | Autophagy-related protein 16 | 1.81e-10 | NA | 1.37e-10 |
| 3. B | Q921C3 | Bromodomain and WD repeat-containing protein 1 | 4.35e-03 | NA | 1.03e-08 |
| 3. B | Q7RY68 | Polyadenylation factor subunit 2 | 1.97e-09 | NA | 5.04e-07 |
| 3. B | F1MNN4 | F-box/WD repeat-containing protein 7 | 1.16e-05 | NA | 1.06e-25 |
| 3. B | Q54Y96 | WD40 repeat-containing protein smu1 | 1.18e-10 | NA | 2.36e-13 |
| 3. B | O42478 | Transducin-like enhancer protein 4 | 6.43e-09 | NA | 4.84e-07 |
| 3. B | Q9SY00 | COMPASS-like H3K4 histone methylase component WDR5B | 0.00e+00 | NA | 1.22e-24 |
| 3. B | Q6NNP0 | Autophagy-related protein 16 | 2.11e-15 | NA | 2.35e-11 |
| 3. B | Q9GZL7 | Ribosome biogenesis protein WDR12 | 1.34e-09 | NA | 4.90e-09 |
| 3. B | Q55DA2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 8.71e-08 |
| 3. B | O60336 | Mitogen-activated protein kinase-binding protein 1 | 2.43e-03 | NA | 1.40e-08 |
| 3. B | P56094 | General transcriptional corepressor TUP1 | 1.67e-07 | NA | 8.63e-25 |
| 3. B | Q91ZN1 | Coronin-1A | 6.83e-07 | NA | 4.24e-05 |
| 3. B | A2CEH0 | POC1 centriolar protein homolog B | 6.19e-13 | NA | 1.63e-20 |
| 3. B | Q58D00 | F-box/WD repeat-containing protein 2 | 1.56e-12 | NA | 8.80e-07 |
| 3. B | Q9Y0T2 | F-box/WD repeat-containing protein A | 9.42e-05 | NA | 0.039 |
| 3. B | Q2GSJ9 | Protein HIR1 | 2.93e-07 | NA | 3.54e-05 |
| 3. B | Q5A7Q6 | Nuclear distribution protein PAC1 | 1.81e-12 | NA | 1.22e-12 |
| 3. B | Q8VBV4 | F-box/WD repeat-containing protein 7 | 2.49e-05 | NA | 8.57e-25 |
| 3. B | Q4X1Y0 | Polyadenylation factor subunit 2 | 1.61e-10 | NA | 1.97e-07 |
| 3. B | P53622 | Coatomer subunit alpha | 4.81e-08 | NA | 6.04e-14 |
| 3. B | G5EFW7 | Intraflagellar transport protein 122 homolog | 2.86e-06 | NA | 0.007 |
| 3. B | O14301 | Uncharacterized WD repeat-containing protein C9G1.05 | 6.84e-08 | NA | 4.22e-05 |
| 3. B | Q08E38 | Pre-mRNA-processing factor 19 | 9.55e-11 | NA | 5.26e-15 |
| 3. B | Q9NSI6 | Bromodomain and WD repeat-containing protein 1 | 4.64e-02 | NA | 1.07e-08 |
| 3. B | P0CS45 | Mitochondrial division protein 1 | 1.21e-06 | NA | 1.46e-05 |
| 3. B | Q54YD8 | Coatomer subunit beta' | 1.86e-06 | NA | 3.44e-15 |
| 3. B | O60508 | Pre-mRNA-processing factor 17 | 2.52e-09 | NA | 9.73e-14 |
| 3. B | Q5BDU4 | Protein hir1 | 7.39e-06 | NA | 8.66e-08 |
| 3. B | Q54RP0 | UDP-galactose:fucoside alpha-3-galactosyltransferase | 1.08e-07 | NA | 6.26e-07 |
| 3. B | A8QBF3 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 8.51e-06 |
| 3. B | O75529 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 5.85e-09 | NA | 2.92e-15 |
| 3. B | A5DHD9 | Protein transport protein SEC13 | 5.55e-16 | NA | 0.050 |
| 3. B | Q8WWQ0 | PH-interacting protein | 4.23e-04 | NA | 4.04e-08 |
| 3. B | Q75C26 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 2.13e-10 |
| 3. B | Q94BM7 | Protein SPA1-RELATED 4 | 8.35e-07 | NA | 1.39e-04 |
| 3. B | Q5IS43 | Platelet-activating factor acetylhydrolase IB subunit alpha | 0.00e+00 | NA | 7.61e-20 |
| 3. B | B6K1G6 | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 | 4.91e-09 | NA | 5.44e-05 |
| 3. B | Q5FVA9 | mRNA export factor | 1.40e-11 | NA | 1.14e-04 |
| 3. B | Q8H594 | Ribosome biogenesis protein WDR12 homolog | 2.21e-08 | NA | 4.65e-05 |
| 3. B | A7RHG8 | Ribosome biogenesis protein WDR12 homolog (Fragment) | 1.26e-11 | NA | 3.71e-06 |
| 3. B | Q61666 | Protein HIRA | 2.70e-07 | NA | 2.14e-04 |
| 3. B | C3XVT5 | Lissencephaly-1 homolog | 0.00e+00 | NA | 1.18e-21 |
| 3. B | Q8HXL3 | WD repeat-containing protein 62 | 8.02e-04 | NA | 1.08e-06 |
| 3. B | Q10NY2 | Protein TPR3 | 7.11e-05 | NA | 0.002 |
| 3. B | B8M7Q5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 1.62e-08 | NA | 6.66e-20 |
| 3. B | A8XJ40 | Protein SEC13 homolog | 4.89e-10 | NA | 0.011 |
| 3. B | Q9DCE5 | p21-activated protein kinase-interacting protein 1 | 5.38e-09 | NA | 0.001 |
| 3. B | Q8BHD1 | POC1 centriolar protein homolog B | 9.67e-13 | NA | 5.86e-23 |
| 3. B | Q6CSI1 | Histone acetyltransferase type B subunit 2 | 2.22e-11 | NA | 7.98e-05 |
| 3. B | A5DVY3 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 0.031 |
| 3. B | A1CBP8 | Mitochondrial division protein 1 | 9.09e-09 | NA | 0.001 |
| 3. B | F4IIK6 | Non-functional target of rapamycin complex subunit LST8-2 | 1.11e-16 | NA | 3.35e-12 |
| 3. B | Q8VZS9 | Protein FIZZY-RELATED 1 | 1.11e-09 | NA | 0.006 |
| 3. B | A1CGS0 | Protein transport protein sec13 | 1.73e-14 | NA | 1.73e-04 |
| 3. B | Q9VKQ3 | Ribosome biogenesis protein WDR12 homolog | 4.01e-09 | NA | 1.80e-10 |
| 3. B | Q8VYZ5 | Periodic tryptophan protein 2 | 8.89e-06 | NA | 8.31e-13 |
| 3. B | Q0CLJ4 | Ribosome biogenesis protein ytm1 | 1.02e-08 | NA | 5.61e-05 |
| 3. B | P54686 | Actin-interacting protein 1 | 4.37e-06 | NA | 1.73e-08 |
| 3. B | Q5XFW6 | WD repeat-containing protein 6 | 2.18e-04 | NA | 2.03e-04 |
| 3. B | Q7ZVR1 | WD repeat-containing protein 75 | 2.79e-05 | NA | 4.51e-04 |
| 3. B | A8NEG8 | Nuclear distribution protein PAC1 | 0.00e+00 | NA | 5.31e-23 |
| 3. B | P58404 | Striatin-4 | 9.14e-08 | NA | 3.27e-06 |
| 3. B | Q8C6G8 | WD repeat-containing protein 26 | 2.58e-13 | NA | 2.24e-04 |
| 3. B | A8Q2R5 | WD repeat-containing protein 48 homolog | 6.65e-08 | NA | 6.21e-07 |
| 3. B | C5DY07 | Nuclear distribution protein PAC1 | 5.43e-12 | NA | 8.28e-04 |
| 3. B | Q04727 | Transducin-like enhancer protein 4 | 4.71e-07 | NA | 4.68e-07 |
| 3. B | P58405 | Striatin-3 | 1.37e-08 | NA | 0.002 |
| 3. B | Q5BJ90 | Ribosome biogenesis protein wdr12 | 1.42e-09 | NA | 1.77e-08 |
| 3. B | Q4R6D2 | mRNA export factor | 2.39e-11 | NA | 0.003 |
| 3. B | A2QI22 | Ribosome biogenesis protein ytm1 | 3.54e-09 | NA | 4.70e-04 |
| 3. B | Q9DB94 | WD repeat-containing protein 53 | 0.00e+00 | NA | 0.005 |
| 3. B | O82266 | Protein SLOW WALKER 1 | 1.48e-08 | NA | 8.74e-05 |
| 3. B | Q68EI0 | WD repeat-containing protein 18 | 1.28e-08 | NA | 3.52e-09 |
| 3. B | F4I1S7 | Elongator complex protein 2 | 6.24e-06 | NA | 7.33e-04 |
| 3. B | A1D7I5 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.82e-06 |
| 3. B | Q5TTP0 | WD repeat-containing protein on Y chromosome | 1.40e-03 | NA | 9.68e-06 |
| 3. B | O89046 | Coronin-1B | 3.45e-07 | NA | 4.76e-04 |
| 3. B | Q5XX13 | F-box/WD repeat-containing protein 10 | 1.40e-04 | NA | 7.97e-07 |
| 3. B | B6QC06 | Nuclear distribution protein nudF 2 | 2.90e-14 | NA | 2.43e-15 |
| 3. B | B4NW98 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.66e-05 |
| 3. B | Q2UFN8 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 3.84e-06 | NA | 9.18e-20 |
| 3. B | Q4WNK7 | Protein transport protein sec13 | 4.46e-14 | NA | 1.29e-04 |
| 3. B | Q8LPL5 | Protein FIZZY-RELATED 3 | 5.89e-09 | NA | 0.002 |
| 3. B | A4RD35 | Protein transport protein SEC31 | 6.79e-05 | NA | 0.049 |
| 3. B | Q03897 | Maintenance of telomere capping protein 5 | 9.33e-05 | NA | 7.17e-04 |
| 3. B | Q9ERG2 | Striatin-3 | 3.47e-07 | NA | 0.004 |
| 3. B | Q62440 | Transducin-like enhancer protein 1 | 9.07e-09 | NA | 4.75e-07 |
| 3. B | Q07141 | Transducin-like enhancer protein 4 | 6.03e-09 | NA | 2.92e-07 |
| 3. B | Q5JSH3 | WD repeat-containing protein 44 | 1.10e-04 | NA | 1.91e-04 |
| 3. B | Q148I1 | Proteasomal ATPase-associated factor 1 | 7.79e-11 | NA | 9.40e-11 |
| 3. B | Q6CL75 | Protein transport protein SEC31 | 1.49e-06 | NA | 0.009 |
| 3. B | Q10282 | Guanine nucleotide-binding protein subunit beta | 0.00e+00 | NA | 1.29e-08 |
| 3. B | Q5E959 | Serine-threonine kinase receptor-associated protein | 1.80e-14 | NA | 1.09e-07 |
| 3. B | Q5ZL33 | Serine-threonine kinase receptor-associated protein | 3.33e-16 | NA | 8.62e-07 |
| 3. B | A2RRU3 | U3 small nucleolar RNA-associated protein 15 homolog | 8.23e-10 | NA | 2.81e-14 |
| 3. B | Q6BIR9 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 5.37e-05 |
| 3. B | Q9DCJ1 | Target of rapamycin complex subunit LST8 | 2.22e-16 | NA | 2.03e-13 |
| 3. B | Q9VPH8 | Retinoblastoma-binding protein 5 homolog | 2.80e-09 | NA | 1.61e-04 |
| 3. B | B0DWM8 | Ribosome biogenesis protein YTM1 | 3.02e-08 | NA | 0.007 |
| 3. B | Q8C5V5 | WD repeat-containing protein 27 | 7.53e-08 | NA | 0.007 |
| 3. B | O22785 | Pre-mRNA-processing factor 19 homolog 2 | 4.04e-11 | NA | 4.11e-12 |
| 3. B | Q8L4J2 | Cleavage stimulation factor subunit 50 | 1.63e-11 | NA | 4.93e-05 |
| 3. B | Q1DR81 | Probable cytosolic iron-sulfur protein assembly protein 1 | 2.22e-15 | NA | 0.003 |
| 3. B | P53699 | Cell division control protein 4 | 5.63e-06 | NA | 5.09e-12 |
| 3. B | Q19124 | Autophagic-related protein 16.1 | 3.63e-13 | NA | 4.30e-05 |
| 3. B | Q54W52 | Ribosome biogenesis protein WDR12 homolog | 2.72e-09 | NA | 5.82e-05 |
| 3. B | A6ZPA9 | Ribosome biogenesis protein YTM1 | 5.59e-08 | NA | 1.63e-05 |
| 3. B | Q5EA99 | p21-activated protein kinase-interacting protein 1 | 5.99e-11 | NA | 6.04e-04 |
| 3. B | F4HTH8 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 | 6.72e-08 | NA | 5.68e-16 |
| 3. B | Q0CHM0 | Protein transport protein sec13 | 2.54e-14 | NA | 8.32e-04 |
| 3. B | Q7ZV55 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.38e-05 |
| 3. B | Q9JMJ4 | Pre-mRNA-processing factor 19 | 4.55e-14 | NA | 2.27e-14 |
| 3. B | P93339 | Guanine nucleotide-binding protein subunit beta | NA | NA | 4.11e-12 |
| 3. B | Q6P5U7 | NACHT and WD repeat domain-containing protein 2 | 9.16e-03 | NA | 0.027 |
| 3. B | O76734 | General transcriptional corepressor tupA | 8.73e-11 | NA | 3.56e-25 |
| 3. B | C8ZH19 | Nuclear distribution protein PAC1 | 2.41e-11 | NA | 0.001 |
| 3. B | Q2TAY7 | WD40 repeat-containing protein SMU1 | 1.24e-10 | NA | 2.11e-14 |
| 3. B | P0CS44 | Mitochondrial division protein 1 | 4.06e-03 | NA | 1.46e-05 |
| 3. B | Q6BRR2 | Protein transport protein SEC31 | 1.38e-04 | NA | 0.015 |
| 3. B | Q1LZ08 | WD repeat-containing protein 48 homolog | 3.36e-07 | NA | 1.71e-11 |
| 3. B | Q5AG86 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 1.21e-04 |
| 3. B | Q9T014 | Protein SPA1-RELATED 2 | 2.45e-05 | NA | 6.81e-08 |
| 3. B | P33215 | Protein NEDD1 | 8.20e-13 | NA | 0.005 |
| 3. B | O43379 | WD repeat-containing protein 62 | 1.28e-03 | NA | 9.92e-07 |
| 3. B | A7TNS8 | CCR4-associated factor 4 homolog | 7.53e-08 | NA | 1.60e-06 |
| 3. B | Q6DDF0 | WD repeat-containing protein 37 | 2.47e-08 | NA | 2.62e-07 |
| 3. B | Q8QFR2 | Protein HIRA | 1.53e-06 | NA | 0.005 |
| 3. B | Q7K1Y4 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 9.33e-11 |
| 3. B | Q8K3E5 | Jouberin | 1.59e-05 | NA | 0.012 |
| 3. B | Q9LV35 | Actin-interacting protein 1-2 | 1.28e-05 | NA | 1.74e-06 |
| 3. B | Q4R8H1 | F-box-like/WD repeat-containing protein TBL1X | 3.36e-08 | NA | 3.67e-13 |
| 3. B | B5X3Z6 | Lissencephaly-1 homolog A | 0.00e+00 | NA | 8.89e-19 |
| 3. B | Q5RAN6 | Nucleoporin SEH1 | 1.53e-09 | NA | 6.57e-04 |
| 3. B | Q39836 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 6.76e-18 |
| 3. B | A5E2R6 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 0.001 |
| 3. B | D4AM37 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 3.62e-11 | NA | 3.10e-19 |
| 3. B | Q0V320 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.63e-07 |
| 3. B | Q5REG7 | Platelet-activating factor acetylhydrolase IB subunit alpha | 1.11e-16 | NA | 5.24e-20 |
| 3. B | Q64LD2 | WD repeat-containing protein 25 | 9.36e-11 | NA | 6.39e-07 |
| 3. B | O55106 | Striatin | 6.45e-07 | NA | 0.001 |
| 3. B | Q9JMJ2 | F-box/WD repeat-containing protein 4 | 5.26e-10 | NA | 0.003 |
| 3. B | B4GMG4 | WD repeat-containing protein 55 homolog | 5.59e-10 | NA | 4.35e-08 |
| 3. B | A2QPW4 | Probable cytosolic iron-sulfur protein assembly protein 1 | 5.71e-12 | NA | 2.13e-04 |
| 3. B | Q06078 | U3 small nucleolar RNA-associated protein 21 | 1.94e-04 | NA | 9.82e-06 |
| 3. B | Q759U7 | Nuclear distribution protein PAC1 | 6.78e-14 | NA | 5.52e-04 |
| 3. B | Q9UT57 | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c | 1.44e-10 | NA | 1.12e-08 |
| 3. B | Q5B563 | Protein transport protein sec13 | 2.20e-14 | NA | 0.001 |
| 3. B | Q5NVK4 | Coronin-1B | 1.74e-06 | NA | 0.001 |
| 3. B | Q9C1X0 | Uncharacterized WD repeat-containing protein C713.05 | 0.00e+00 | NA | 4.05e-05 |
| 3. B | Q8VDD9 | PH-interacting protein | 1.84e-03 | NA | 3.40e-08 |
| 3. B | Q92176 | Coronin-1A | 5.29e-07 | NA | 1.06e-04 |
| 3. B | C4JZS6 | Nuclear distribution protein PAC1-1 | 2.33e-14 | NA | 3.27e-15 |
| 3. B | Q6BLS5 | Ribosome biogenesis protein YTM1 | 4.66e-12 | NA | 0.011 |
| 3. B | B4GAJ1 | Lissencephaly-1 homolog | 0.00e+00 | NA | 2.04e-19 |
| 3. B | Q9H1Z4 | WD repeat-containing protein 13 | 4.92e-10 | NA | 0.002 |
| 3. B | P0CS39 | Protein HIR1 | 3.06e-09 | NA | 5.66e-12 |
| 3. B | P42527 | Myosin heavy chain kinase A | 5.26e-05 | NA | 1.51e-10 |
| 3. B | P0CS55 | Ribosome biogenesis protein YTM1 | 8.11e-08 | NA | 4.15e-04 |
| 3. B | Q5REE6 | Ribosome biogenesis protein WDR12 | 1.40e-09 | NA | 3.47e-09 |
| 3. B | Q54JS5 | GATOR complex protein WDR24 | 8.84e-06 | NA | 0.005 |
| 3. B | Q9SYX2 | Protein SUPPRESSOR OF PHYA-105 1 | 4.97e-05 | NA | 4.78e-05 |
| 3. B | P0CS36 | Histone acetyltransferase type B subunit 2 | 5.66e-15 | NA | 1.24e-04 |
| 3. B | Q969H0 | F-box/WD repeat-containing protein 7 | 3.21e-05 | NA | 1.55e-25 |
| 3. B | Q6CKX3 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 0.004 |
| 3. B | Q4P5F5 | Probable cytosolic iron-sulfur protein assembly protein 1 | 3.00e-10 | NA | 7.83e-06 |
| 3. B | A7S338 | Lissencephaly-1 homolog | 0.00e+00 | NA | 7.20e-20 |
| 3. B | P78972 | WD repeat-containing protein slp1 | 6.13e-07 | NA | 1.62e-05 |
| 3. B | Q676U5 | Autophagy-related protein 16-1 | 2.40e-08 | NA | 1.38e-10 |
| 3. B | Q652L2 | Protein HIRA | 2.32e-08 | NA | 6.58e-08 |
| 3. B | B8NGT5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 4.61e-09 | NA | 1.02e-19 |
| 3. B | Q40687 | Guanine nucleotide-binding protein subunit beta | 6.00e-15 | NA | 2.54e-12 |
| 3. B | A4RJA0 | ASTRA-associated protein 1 | 2.05e-10 | NA | 0.004 |
| 3. B | Q6P315 | Histone-binding protein RBBP7 | 2.44e-15 | NA | 3.78e-06 |
| 3. B | P36130 | CCR4-associated factor 4 | 1.71e-07 | NA | 5.52e-07 |
| 3. B | Q6DFF9 | Mitogen-activated protein kinase-binding protein 1 | 1.62e-03 | NA | 2.45e-05 |
| 3. B | Q9QXL2 | Kinesin-like protein KIF21A | 2.49e-04 | NA | 6.35e-04 |
| 3. B | Q6PFM9 | WD repeat-containing protein 48 | 1.95e-07 | NA | 6.40e-13 |
| 3. B | Q9NNW5 | WD repeat-containing protein 6 | 2.52e-04 | NA | 2.43e-04 |
| 3. B | Q9WUM3 | Coronin-1B | 7.99e-07 | NA | 0.002 |
| 3. B | O94423 | Meiotic fizzy-related protein 1 | 1.06e-08 | NA | 0.009 |
| 3. B | Q9I9H8 | Apoptotic protease-activating factor 1 | 2.98e-05 | NA | 1.83e-12 |
| 3. B | O13168 | Transducin-like enhancer protein 3-B | 7.53e-08 | NA | 3.86e-07 |
| 3. B | C7GWC1 | Nuclear distribution protein PAC1 | 3.54e-08 | NA | 3.97e-04 |
| 3. B | B4LJT7 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 2.59e-08 |
| 3. B | Q11176 | Actin-interacting protein 1 | 3.29e-08 | NA | 7.70e-07 |
| 3. B | Q8W117 | Suppressor of mec-8 and unc-52 protein homolog 1 | 8.82e-14 | NA | 2.32e-13 |
| 3. B | Q8N1V2 | Cilia- and flagella-associated protein 52 | 8.44e-15 | NA | 2.90e-08 |
| 3. B | Q5DFU0 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 7.46e-06 |
| 3. B | Q810D6 | Glutamate-rich WD repeat-containing protein 1 | 7.47e-10 | NA | 5.64e-07 |
| 3. B | Q9SXY1 | Chromatin assembly factor 1 subunit FAS2 | 7.08e-13 | NA | 1.10e-10 |
| 3. B | O14170 | WD repeat-containing protein pop2 | 2.35e-06 | NA | 1.16e-16 |
| 3. B | Q54R82 | Mitogen-activated protein kinase kinase kinase A | 4.40e-06 | NA | 8.96e-11 |
| 3. B | Q7K4B3 | Probable elongator complex protein 2 | 8.29e-06 | NA | 0.005 |
| 3. B | B6H7A3 | Probable cytosolic iron-sulfur protein assembly protein 1 | 3.22e-15 | NA | 0.002 |
| 3. B | A6RUL1 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.85e-04 |
| 3. B | Q95JL5 | Cilia- and flagella-associated protein 52 | 2.16e-07 | NA | 3.24e-06 |
| 3. B | O35142 | Coatomer subunit beta' | 5.44e-07 | NA | 1.15e-08 |
| 3. B | B7QKS1 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 1.69e-08 |
| 3. B | Q9WVB2 | Transducin-like enhancer protein 2 | 4.74e-09 | NA | 4.32e-06 |
| 3. B | A7EZJ5 | Probable cytosolic iron-sulfur protein assembly protein 1 | 2.62e-14 | NA | 0.007 |
| 3. B | Q9QXE7 | F-box-like/WD repeat-containing protein TBL1X | 1.57e-08 | NA | 1.36e-14 |
| 3. B | P0CS47 | Polyadenylation factor subunit 2 | 2.07e-07 | NA | 3.48e-06 |
| 3. B | Q9BZK7 | F-box-like/WD repeat-containing protein TBL1XR1 | 4.54e-08 | NA | 4.20e-12 |
| 3. B | Q7ZXZ2 | U3 small nucleolar RNA-associated protein 15 homolog | 9.64e-11 | NA | 1.69e-11 |
| 3. B | P91341 | Periodic tryptophan protein 2 homolog | 6.03e-06 | NA | 1.05e-05 |
| 3. B | P90648 | Myosin heavy chain kinase B | 5.68e-08 | NA | 2.87e-18 |
| 3. B | Q54ZP5 | WD repeat-containing protein 48 homolog | 1.58e-03 | NA | 4.32e-10 |
| 3. B | Q4R7Y4 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | Q96EE3 | Nucleoporin SEH1 | 1.28e-08 | NA | 6.28e-04 |
| 3. B | Q91WQ5 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 4.04e-08 | NA | 1.26e-16 |
| 3. B | P97260 | Sterol regulatory element-binding protein cleavage-activating protein | 1.47e-03 | NA | 5.11e-05 |
| 3. B | Q9WVB3 | Transducin-like enhancer protein 6 | 1.27e-07 | NA | 0.003 |
| 3. B | A5D7H2 | Striatin-3 | 5.19e-08 | NA | 6.62e-05 |
| 3. B | B4J8H6 | WD repeat-containing protein 48 homolog | 2.63e-07 | NA | 3.90e-11 |
| 3. B | A7THX0 | Mitochondrial division protein 1 | 2.10e-08 | NA | 1.04e-07 |
| 3. B | P0CS50 | Protein transport protein SEC13 | 1.35e-14 | NA | 0.042 |
| 3. B | B3RQN1 | Ribosome biogenesis protein WDR12 homolog | 2.38e-08 | NA | 4.96e-05 |
| 3. B | B7FF06 | WD repeat-containing protein on Y chromosome | 1.50e-04 | NA | 9.20e-05 |
| 3. B | Q26544 | WD repeat-containing protein SL1-17 | NA | NA | 1.22e-14 |
| 3. B | Q28D01 | WD repeat-containing protein 26 | 1.56e-13 | NA | 1.98e-04 |
| 3. B | O13923 | Coronin-like protein crn1 | 3.95e-05 | NA | 0.015 |
| 3. B | Q9C1X1 | Periodic tryptophan protein 2 homolog | 2.20e-07 | NA | 4.72e-11 |
| 3. B | Q7Z5U6 | WD repeat-containing protein 53 | 0.00e+00 | NA | 0.011 |
| 3. B | Q9VLN1 | WD repeat-containing protein 82 | 0.00e+00 | NA | 0.003 |
| 3. B | Q4P8R5 | Mitochondrial division protein 1 | 3.45e-06 | NA | 1.16e-04 |
| 3. B | F1DLK1 | Protein DECREASED SIZE EXCLUSION LIMIT 1 | 0.00e+00 | NA | 0.001 |
| 3. B | B0R0D7 | Coronin-1C-A | 5.46e-07 | NA | 4.20e-04 |
| 3. B | A6ZQL5 | Mitochondrial division protein 1 | 4.86e-07 | NA | 1.44e-07 |
| 3. B | O64740 | Protein transport protein SEC13 homolog B | 9.99e-16 | NA | 0.005 |
| 3. B | Q9BV38 | WD repeat-containing protein 18 | 1.63e-07 | NA | 3.40e-09 |
| 3. B | Q17QU5 | Target of rapamycin complex subunit LST8 | 0.00e+00 | NA | 4.00e-12 |
| 3. B | P49695 | Probable serine/threonine-protein kinase PkwA | 1.53e-11 | NA | 2.67e-29 |
| 3. B | Q95RJ9 | F-box-like/WD repeat-containing protein ebi | 3.93e-08 | NA | 5.11e-13 |
| 3. B | O74319 | Transcription initiation factor TFIID subunit taf73 | 4.45e-11 | NA | 2.75e-12 |
| 3. B | B4LUA5 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 8.27e-06 |
| 3. B | P41811 | Coatomer subunit beta' | 2.19e-07 | NA | 7.89e-05 |
| 3. B | Q6BUA6 | Nuclear distribution protein PAC1 | 7.77e-16 | NA | 5.24e-06 |
| 3. B | A8JAN3 | Centriole proteome protein 16 | 1.73e-02 | NA | 5.76e-04 |
| 3. B | Q3ULA2 | F-box/WD repeat-containing protein 1A | 1.30e-12 | NA | 1.39e-17 |
| 3. B | Q54MT0 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 0.006 |
| 3. B | Q8BUB4 | WD repeat and FYVE domain-containing protein 2 | 1.18e-09 | NA | 2.48e-10 |
| 3. B | B8MWR8 | Probable cytosolic iron-sulfur protein assembly protein 1 | 6.66e-16 | NA | 1.27e-04 |
| 3. B | Q05B17 | WD repeat-containing protein 48 | 3.09e-07 | NA | 6.58e-13 |
| 3. B | Q4VBE8 | WD repeat-containing protein 18 | 1.07e-07 | NA | 4.46e-10 |
| 3. B | Q9XS70 | Coronin-1B | 6.72e-07 | NA | 0.002 |
| 3. B | Q6GL39 | WD repeat-containing protein 82 | 0.00e+00 | NA | 8.16e-06 |
| 3. B | B4KRQ4 | WD repeat-containing protein 48 homolog | 3.16e-07 | NA | 5.36e-11 |
| 3. B | P49178 | Guanine nucleotide-binding protein subunit beta | 1.10e-14 | NA | 8.07e-13 |
| 3. B | Q5U2W5 | Transducin beta-like protein 3 | 2.56e-09 | NA | 3.40e-12 |
| 3. B | Q32PG3 | WD repeat-containing protein 48 | 2.36e-07 | NA | 1.78e-12 |
| 3. B | P43033 | Platelet-activating factor acetylhydrolase IB subunit beta | 0.00e+00 | NA | 8.67e-20 |
| 3. B | Q6CSZ5 | Protein transport protein SEC13 | 4.44e-15 | NA | 0.001 |
| 3. B | B4QTL6 | WD repeat-containing protein 55 homolog | 4.02e-09 | NA | 2.32e-08 |
| 3. B | Q5RF99 | mRNA export factor | 4.44e-12 | NA | 0.004 |
| 3. B | Q5ZJH5 | WD repeat-containing protein 61 | 0.00e+00 | NA | 1.21e-12 |
| 3. B | Q00808 | Vegetative incompatibility protein HET-E-1 | 3.15e-06 | NA | 3.81e-43 |
| 3. B | P63246 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | A0AUS0 | WD repeat, SAM and U-box domain-containing protein 1 | 5.06e-13 | NA | 4.44e-22 |
| 3. B | B1ANS9 | WD repeat-containing protein 64 | 4.45e-04 | NA | 4.16e-07 |
| 3. B | Q5U4Y8 | Nucleoporin SEH1 | 1.56e-08 | NA | 0.001 |
| 3. B | A8IR43 | Ribosome biogenesis protein WDR12 homolog | 1.71e-09 | NA | 0.008 |
| 3. B | P78406 | mRNA export factor | 3.80e-12 | NA | 0.004 |
| 3. B | Q6NS57 | Mitogen-activated protein kinase-binding protein 1 | 1.17e-03 | NA | 3.42e-09 |
| 3. B | P20484 | Protein MAK11 | 2.73e-06 | NA | 6.13e-07 |
| 3. B | B2B5V0 | Ribosome biogenesis protein YTM1 | 2.07e-09 | NA | 3.94e-04 |
| 3. B | A5GFN6 | mRNA export factor | 2.53e-11 | NA | 0.005 |
| 3. B | Q5RBW3 | Coronin-7 | 2.17e-04 | NA | 4.62e-06 |
| 3. B | Q0UXP3 | Ribosome biogenesis protein YTM1 | 4.08e-08 | NA | 0.025 |
| 3. B | Q8IWB7 | WD repeat and FYVE domain-containing protein 1 | 1.31e-09 | NA | 2.80e-13 |
| 3. B | O75083 | WD repeat-containing protein 1 | 7.82e-06 | NA | 7.95e-06 |
| 3. B | A7YY75 | Nucleoporin SEH1 | 4.61e-10 | NA | 2.18e-04 |
| 3. B | Q0U2T3 | Mitochondrial division protein 1 | 8.30e-07 | NA | 7.95e-05 |
| 3. B | Q2UQ34 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.23e-06 |
| 3. B | B4PU14 | WD repeat-containing protein 55 homolog | 8.83e-10 | NA | 2.89e-08 |
| 3. B | P87060 | WD repeat-containing protein pop1 | 5.43e-05 | NA | 1.49e-12 |
| 3. B | B9WHJ2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 5.30e-05 |
| 3. B | Q4P4R3 | Protein HIR1 | 7.87e-08 | NA | 1.32e-08 |
| 3. B | Q8N0X2 | Sperm-associated antigen 16 protein | 7.33e-15 | NA | 6.12e-17 |
| 3. B | P54319 | Phospholipase A-2-activating protein | 3.61e-10 | NA | 6.13e-07 |
| 3. B | P38262 | SIR4-interacting protein SIF2 | 7.53e-07 | NA | 2.67e-04 |
| 3. B | Q6GMD2 | WD repeat-containing protein 61 | 0.00e+00 | NA | 6.46e-13 |
| 3. B | A8IZG4 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 9.06e-10 |
| 3. B | B3NQR5 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 1.17e-10 |
| 3. B | Q7ZVA0 | WD40 repeat-containing protein SMU1 | 2.69e-11 | NA | 3.69e-11 |
| 3. B | P57737 | Coronin-7 | 5.81e-04 | NA | 2.48e-06 |
| 3. B | Q8K450 | Sperm-associated antigen 16 protein | 2.29e-12 | NA | 3.66e-17 |
| 3. B | O60137 | Set1 complex component swd2 | 3.59e-10 | NA | 0.028 |
| 3. B | B2RZ17 | F-box/WD repeat-containing protein 2 | 3.02e-12 | NA | 1.48e-06 |
| 3. B | Q9USZ0 | Uncharacterized WD repeat-containing protein C1306.02 | 2.66e-04 | NA | 0.007 |
| 3. B | Q9M0V4 | U3 snoRNP-associated protein-like YAO | 1.41e-09 | NA | 1.11e-10 |
| 3. B | Q6GNF1 | Nucleoporin SEH1-B | 1.45e-09 | NA | 0.003 |
| 3. B | Q54H44 | WD repeat domain-containing protein 83 homolog | 0.00e+00 | NA | 3.92e-07 |
| 3. B | Q54SA5 | WD repeat-containing protein 55 homolog | 1.63e-12 | NA | 1.91e-05 |
| 3. B | P70483 | Striatin | 2.51e-09 | NA | 0.002 |
| 3. B | Q9C701 | Mitotic checkpoint protein BUB3.2 | 0.00e+00 | NA | 0.002 |
| 3. B | B0XFT7 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 9.95e-06 |
| 3. B | Q08924 | Regulator of Ty1 transposition protein 10 | 7.61e-07 | NA | 2.06e-04 |
| 3. B | Q5F3K4 | WD repeat-containing protein 48 | 2.08e-07 | NA | 1.27e-12 |
| 3. B | Q3U821 | WD repeat-containing protein 75 | 5.22e-05 | NA | 0.001 |
| 3. B | Q4V7Z1 | POC1 centriolar protein homolog B | 3.74e-13 | NA | 1.18e-20 |
| 3. B | B4HWV6 | Ribosome biogenesis protein WDR12 homolog | 1.51e-10 | NA | 8.92e-11 |
| 3. B | Q5SQM0 | Echinoderm microtubule-associated protein-like 6 | 7.14e-03 | NA | 7.53e-08 |
| 3. B | B7FF08 | WD repeat-containing protein on Y chromosome | 1.19e-04 | NA | 2.75e-04 |
| 3. B | Q15542 | Transcription initiation factor TFIID subunit 5 | 6.41e-08 | NA | 3.91e-20 |
| 3. B | Q01369 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 4.12e-15 |
| 3. B | Q8N9V3 | WD repeat, SAM and U-box domain-containing protein 1 | 1.46e-12 | NA | 7.44e-16 |
| 3. B | Q5IH81 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.32e-05 |
| 3. B | O22607 | WD-40 repeat-containing protein MSI4 | 4.30e-10 | NA | 0.002 |
| 3. B | Q5ZMC3 | WD repeat, SAM and U-box domain-containing protein 1 | 1.04e-11 | NA | 1.29e-19 |
| 3. B | Q86H45 | Probable elongator complex protein 2 | 8.46e-04 | NA | 0.008 |
| 3. B | Q6H8D6 | Putative coatomer subunit beta'-3 | 5.47e-07 | NA | 5.34e-09 |
| 3. B | Q6FKK3 | Ribosome biogenesis protein YTM1 | 6.36e-08 | NA | 0.009 |
| 3. B | B3N534 | Ribosome biogenesis protein WDR12 homolog | 7.61e-10 | NA | 7.95e-11 |
| 3. B | Q9UKB1 | F-box/WD repeat-containing protein 11 | 3.60e-08 | NA | 7.57e-18 |
| 3. B | C1BK83 | Nucleoporin SEH1 | 2.46e-08 | NA | 0.010 |
| 3. B | Q2UGK1 | Ribosome biogenesis protein ytm1 | 1.70e-09 | NA | 1.22e-04 |
| 3. B | Q54J37 | Striatin homolog | 8.49e-07 | NA | 5.79e-07 |
| 3. B | P87314 | Protein hir1 | 8.52e-08 | NA | 4.51e-10 |
| 3. B | Q9YGY3 | Mitotic checkpoint protein BUB3 | 0.00e+00 | NA | 0.005 |
| 3. B | Q8BH57 | WD repeat-containing protein 48 | 2.70e-07 | NA | 1.40e-12 |
| 3. B | Q3MKM6 | U3 snoRNP-associated protein-like EMB2271 | 7.92e-10 | NA | 8.45e-09 |
| 3. B | Q8C0P5 | Coronin-2A | 1.80e-06 | NA | 0.002 |
| 3. B | Q8SRB0 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.05e-06 |
| 3. B | B0XYC8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.99e-06 |
| 3. B | B9WD30 | Nuclear distribution protein PAC1 | 2.07e-12 | NA | 3.93e-14 |
| 3. B | Q27GK7 | Topless-related protein 4 | 9.73e-05 | NA | 5.43e-04 |
| 3. B | B8AP31 | Guanine nucleotide-binding protein subunit beta | 7.11e-15 | NA | 2.54e-12 |
| 3. B | Q12220 | U3 small nucleolar RNA-associated protein 12 | 1.15e-05 | NA | 6.30e-14 |
| 3. B | Q5AXW3 | Mitochondrial division protein 1 | 3.70e-07 | NA | 0.003 |
| 3. B | A5DJX5 | Nuclear distribution protein PAC1 | 2.22e-16 | NA | 6.97e-07 |
| 3. B | Q0CXH9 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.40e-06 |
| 3. B | O74184 | Target of rapamycin complex subunit wat1 | 5.55e-16 | NA | 1.27e-16 |
| 3. B | Q8N157 | Jouberin | 1.32e-04 | NA | 0.042 |
| 3. B | Q06506 | Ribosomal RNA-processing protein 9 | 1.19e-06 | NA | 0.012 |
| 3. B | A1C7E4 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 4.88e-06 | NA | 1.08e-20 |
| 3. B | O55029 | Coatomer subunit beta' | 5.67e-07 | NA | 8.14e-10 |
| 3. B | Q0V8F1 | Coronin-7 | 4.23e-04 | NA | 8.07e-06 |
| 3. B | Q9W2E7 | Protein Rae1 | 2.22e-16 | NA | 1.28e-04 |
| 3. B | O80775 | WD repeat-containing protein 55 | 2.44e-14 | NA | 0.003 |
| 3. B | B4M4W4 | WD repeat-containing protein 55 homolog | 3.90e-09 | NA | 1.82e-05 |
| 3. B | Q8NI36 | WD repeat-containing protein 36 | 8.98e-05 | NA | 0.005 |
| 3. B | Q5APF0 | Ribosome biogenesis protein YTM1 | 3.79e-09 | NA | 0.004 |
| 3. B | Q3UKJ7 | WD40 repeat-containing protein SMU1 | 4.40e-11 | NA | 2.11e-14 |
| 3. B | A3LX18 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 0.011 |
| 3. B | B6Q4Z5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 7.69e-08 | NA | 1.59e-19 |
| 3. B | Q20168 | Probable coatomer subunit beta' | 1.78e-06 | NA | 1.28e-12 |
| 3. B | D4D8P3 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 5.28e-11 | NA | 2.97e-19 |
| 3. B | Q75BS2 | Protein transport protein SEC13 | 2.89e-15 | NA | 0.002 |
| 3. B | Q9Y297 | F-box/WD repeat-containing protein 1A | 5.38e-14 | NA | 4.62e-18 |
| 3. B | Q3SZD4 | WD repeat-containing protein 18 | 9.08e-08 | NA | 1.21e-13 |
| 3. B | Q6NVE8 | WD repeat-containing protein 44 | 3.08e-06 | NA | 2.57e-04 |
| 3. B | B4GT01 | Ribosome biogenesis protein WDR12 homolog | 1.06e-13 | NA | 4.08e-12 |
| 3. B | Q9NRL3 | Striatin-4 | 6.57e-09 | NA | 2.32e-06 |
| 3. B | P57775 | F-box/WD repeat-containing protein 4 | 3.65e-14 | NA | 0.049 |
| 3. B | Q5ZMV9 | GATOR complex protein WDR24 | 1.21e-05 | NA | 0.005 |
| 3. B | Q38884 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 4.10e-11 |
| 3. B | Q1DHE1 | Protein HIR1 | 3.85e-06 | NA | 9.02e-07 |
| 3. B | A2QCU8 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 1.92e-07 | NA | 1.10e-17 |
| 3. B | Q9C4Z6 | Receptor for activated C kinase 1B | 0.00e+00 | NA | 5.72e-19 |
| 3. B | O94527 | WD repeat protein iqw1 | 5.13e-05 | NA | 2.23e-04 |
| 3. B | Q96KV7 | WD repeat-containing protein 90 | 4.80e-03 | NA | 0.001 |
| 3. B | B4GDM7 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 7.43e-10 |
| 3. B | Q498F0 | WD repeat-containing protein 44 | 2.02e-06 | NA | 0.004 |
| 3. B | Q6TNS2 | p21-activated protein kinase-interacting protein 1-like | 1.91e-12 | NA | 3.42e-04 |
| 3. B | Q229Z6 | POC1 centriolar protein homolog | 1.13e-08 | NA | 6.81e-12 |
| 3. B | O13982 | Uncharacterized WD repeat-containing protein C25H1.08c | 2.68e-11 | NA | 5.80e-04 |
| 3. B | P0DPA1 | WD repeat-containing protein DDB_G0349043 | 9.55e-15 | NA | 6.11e-11 |
| 3. B | Q54MP8 | Bromodomain and WD repeat-containing DDB_G0285837 | 3.85e-03 | NA | 0.001 |
| 3. B | Q9SJT9 | Coatomer subunit alpha-2 | 4.48e-10 | NA | 1.53e-11 |
| 3. B | Q8BU03 | Periodic tryptophan protein 2 homolog | 6.36e-06 | NA | 1.28e-06 |
| 3. B | A1CJY4 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.97e-06 |
| 3. B | P36037 | Protein DOA1 | 7.05e-07 | NA | 5.47e-06 |
| 3. B | O13282 | Transcription initiation factor TFIID subunit 5 | 2.43e-10 | NA | 4.90e-13 |
| 3. B | Q4WX90 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.99e-06 |
| 3. B | B4P6P9 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.04e-20 |
| 3. B | O94289 | Ubiquitin homeostasis protein lub1 | 2.25e-06 | NA | 0.002 |
| 3. B | Q9D180 | Cilia- and flagella-associated protein 57 | 7.54e-05 | NA | 2.59e-04 |
| 3. B | O94365 | U3 small nucleolar RNA-associated protein 15 | 1.29e-09 | NA | 1.12e-05 |
| 3. B | Q3SZK1 | Angio-associated migratory cell protein | 2.32e-08 | NA | 1.12e-05 |
| 3. B | B6GZA1 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 2.52e-09 | NA | 7.38e-11 |
| 3. B | Q5RF24 | WD repeat-containing protein 13 | 1.46e-08 | NA | 0.007 |
| 3. B | Q5RFQ3 | Periodic tryptophan protein 2 homolog | 4.56e-05 | NA | 2.36e-08 |
| 3. B | B4KKN1 | Ribosome biogenesis protein WDR12 homolog | 2.66e-08 | NA | 1.41e-08 |
| 3. B | Q20059 | WD repeat-containing protein 48 homolog | 8.89e-08 | NA | 6.03e-07 |
| 3. B | A0JP70 | WD repeat-containing protein 90 | 3.58e-03 | NA | 0.002 |
| 3. B | O13046 | WD repeat and HMG-box DNA-binding protein 1 | 4.91e-06 | NA | 0.005 |
| 3. B | Q9UKT8 | F-box/WD repeat-containing protein 2 | 2.70e-12 | NA | 9.04e-07 |
| 3. B | A4R2Q6 | Ribosome biogenesis protein YTM1 | 7.89e-09 | NA | 1.44e-07 |
| 3. B | Q94AI7 | Protein TOPLESS | 6.15e-05 | NA | 0.019 |
| 3. B | B3MET8 | WD repeat-containing protein 48 homolog | 2.60e-07 | NA | 1.10e-11 |
| 3. B | Q9LXN4 | Protein HIRA | 5.09e-08 | NA | 3.19e-07 |
| 3. B | Q6PAX7 | WD repeat-containing protein 1-B | 2.35e-05 | NA | 1.37e-06 |
| 3. B | Q8CFJ9 | GATOR complex protein WDR24 | 8.80e-07 | NA | 9.99e-05 |
| 3. B | Q9Y2I8 | WD repeat-containing protein 37 | 1.52e-08 | NA | 3.91e-05 |
| 3. B | B3LJT5 | Nuclear distribution protein PAC1 | 1.34e-11 | NA | 3.77e-04 |
| 3. B | O42937 | Probable coatomer subunit beta' | 1.73e-07 | NA | 8.98e-12 |
| 3. B | Q8IZU2 | WD repeat-containing protein 17 | 3.18e-05 | NA | 2.67e-10 |
| 3. B | Q5NBT9 | Protein TPR1 | 7.14e-05 | NA | 7.02e-04 |
| 3. B | Q5ACW8 | Protein HIR1 | 2.72e-07 | NA | 1.15e-08 |
| 3. B | Q16MY0 | WD repeat-containing protein 48 homolog | 4.32e-08 | NA | 1.44e-07 |
| 3. B | Q6ZPG2 | WD repeat-containing protein 90 | 2.67e-03 | NA | 1.07e-06 |
| 3. B | P32479 | Protein HIR1 | 3.73e-09 | NA | 8.90e-07 |
| 3. B | P63005 | Platelet-activating factor acetylhydrolase IB subunit beta | 0.00e+00 | NA | 7.75e-20 |
| 3. B | Q292E8 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 7.92e-10 |
| 3. B | B4I195 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.91e-05 |
| 3. B | Q54BI5 | WD repeat-containing protein 53 homolog | 5.33e-15 | NA | 2.90e-05 |
| 3. B | P93340 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 9.51e-18 |
| 3. B | Q93454 | mRNA export factor rae-1 | 1.02e-12 | NA | 0.046 |
| 3. B | O60907 | F-box-like/WD repeat-containing protein TBL1X | 2.43e-08 | NA | 1.95e-13 |
| 3. B | Q8CIE6 | Coatomer subunit alpha | 6.71e-10 | NA | 6.73e-08 |
| 3. B | D1ZEB4 | Nuclear distribution protein PAC1-1 | 3.41e-14 | NA | 3.83e-17 |
| 3. B | B3P4F8 | WD repeat-containing protein 55 homolog | 1.02e-09 | NA | 5.67e-08 |
| 3. B | Q5RD06 | POC1 centriolar protein homolog B | 1.56e-13 | NA | 4.68e-18 |
| 3. B | Q6TGU2 | Nucleoporin SEH1 | 1.35e-08 | NA | 0.009 |
| 3. B | Q9Z1Z2 | Serine-threonine kinase receptor-associated protein | 2.05e-14 | NA | 1.43e-07 |
| 3. B | Q2GSM6 | Protein transport protein SEC13 | 4.94e-14 | NA | 1.05e-08 |
| 3. B | Q32PJ6 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 0.00e+00 | NA | 1.19e-09 |
| 3. B | O14021 | RbAp48-related WD40 repeat-containing protein prw1 | 3.07e-12 | NA | 7.07e-07 |
| 3. B | Q55563 | Uncharacterized WD repeat-containing protein sll0163 | 1.06e-04 | NA | 4.59e-28 |
| 3. B | B0XAF3 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 3.32e-10 |
| 3. B | Q2H139 | Mitochondrial division protein 1 | 3.10e-07 | NA | 8.39e-07 |
| 3. B | D3ZW91 | POC1 centriolar protein homolog B | 1.28e-10 | NA | 8.29e-17 |
| 3. B | O62621 | Coatomer subunit beta' | 6.50e-07 | NA | 3.09e-08 |
| 3. B | Q0UNC6 | Protein HIR1 | 3.08e-07 | NA | 7.12e-08 |
| 3. B | Q9H2Y7 | Zinc finger protein 106 | 3.15e-03 | NA | 2.13e-05 |
| 3. B | A2QEV8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 9.78e-07 |
| 3. B | O62471 | Protein qui-1 | 1.59e-04 | NA | 6.86e-13 |
| 3. B | P68040 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | A6ZZZ8 | CCR4-associated factor 4 | 8.35e-09 | NA | 7.37e-07 |
| 3. B | Q7K0L4 | WD repeat-containing protein 26 homolog | 1.75e-10 | NA | 1.15e-05 |
| 3. B | Q9WUC8 | Pleiotropic regulator 1 | 2.67e-10 | NA | 1.98e-09 |
| 3. B | Q5RKI0 | WD repeat-containing protein 1 | 7.96e-06 | NA | 1.07e-07 |
| 3. B | O61585 | Katanin p80 WD40 repeat-containing subunit B1 | 2.99e-10 | NA | 2.69e-15 |
| 3. B | B2VZH2 | Ribosome biogenesis protein ytm1 | 3.34e-08 | NA | 1.45e-04 |
| 3. B | Q5EBE8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.92e-06 |
| 3. B | P42935 | Elongator complex protein 2 | 5.21e-06 | NA | 0.003 |
| 3. B | Q8WQ85 | Villidin | 1.31e-02 | NA | 0.002 |
| 3. B | Q5AI86 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 0.018 |
| 3. B | P93397 | Guanine nucleotide-binding protein subunit beta-1 | 3.11e-15 | NA | 5.24e-12 |
| 3. B | Q5ZME8 | WD40 repeat-containing protein SMU1 | 1.22e-08 | NA | 1.91e-14 |
| 3. B | Q17BB0 | Ribosome biogenesis protein WDR12 homolog | 5.39e-11 | NA | 1.92e-07 |
| 3. B | B5FZ19 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.02e-05 |
| 3. B | B0W517 | Ribosome biogenesis protein WDR12 homolog | 3.97e-13 | NA | 2.02e-06 |
| 3. B | Q06440 | Coronin-like protein | 1.17e-05 | NA | 1.50e-08 |
| 3. B | Q5MNU5 | Sterol regulatory element-binding protein cleavage-activating protein | 1.46e-03 | NA | 1.15e-04 |
| 3. B | Q5RBZ2 | Methylosome protein 50 | 6.99e-13 | NA | 0.031 |
| 3. B | Q6PBD6 | WD repeat-containing protein 61 | 0.00e+00 | NA | 5.27e-13 |
| 3. B | Q17N69 | Lissencephaly-1 homolog | 0.00e+00 | NA | 6.50e-20 |
| 3. B | B4P7H8 | WD repeat-containing protein 48 homolog | 2.44e-07 | NA | 4.63e-11 |
| 3. B | Q8C7V3 | U3 small nucleolar RNA-associated protein 15 homolog | 8.77e-09 | NA | 1.95e-14 |
| 3. B | Q6CXX3 | Protein HIR1 | 5.31e-07 | NA | 1.14e-11 |
| 3. B | Q05BC3 | Echinoderm microtubule-associated protein-like 1 | 7.15e-06 | NA | 0.029 |
| 3. B | Q758R7 | Mitochondrial division protein 1 | 1.95e-07 | NA | 7.41e-05 |
| 3. B | P43034 | Platelet-activating factor acetylhydrolase IB subunit beta | 0.00e+00 | NA | 7.68e-20 |
| 3. B | P27612 | Phospholipase A-2-activating protein | 6.81e-07 | NA | 1.60e-06 |
| 3. B | B4P7Q3 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 1.56e-11 |
| 3. B | A1DDL6 | Mitochondrial division protein 1 | 1.58e-08 | NA | 7.99e-04 |
| 3. B | Q6FT96 | Mitochondrial division protein 1 | 1.70e-08 | NA | 2.13e-07 |
| 3. B | Q9UT85 | Uncharacterized WD repeat-containing protein C343.04c | 0.00e+00 | NA | 4.01e-08 |
| 3. B | Q9FE91 | Zinc finger CCCH domain-containing protein 62 | 6.10e-08 | NA | 2.69e-05 |
| 3. B | A8PTE4 | Mitochondrial division protein 1 | 3.67e-07 | NA | 7.71e-10 |
| 3. B | Q9VAT2 | DDB1- and CUL4-associated factor 10 homolog | 5.15e-04 | NA | 5.79e-08 |
| 3. B | Q9UQ03 | Coronin-2B | 7.65e-07 | NA | 0.047 |
| 3. B | Q640J6 | WD repeat-containing protein 82-A | 0.00e+00 | NA | 2.11e-05 |
| 3. B | Q8L828 | Coatomer subunit beta'-3 | 5.28e-07 | NA | 2.04e-10 |
| 3. B | B3MEY6 | Lissencephaly-1 homolog | 0.00e+00 | NA | 2.11e-19 |
| 3. B | A4REK3 | Protein transport protein SEC13 | 6.05e-14 | NA | 1.28e-06 |
| 3. B | A1DHW6 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 4.97e-08 | NA | 1.49e-19 |
| 3. B | O14727 | Apoptotic protease-activating factor 1 | 5.08e-07 | NA | 2.45e-18 |
| 3. B | A7UWE6 | ASTRA-associated protein 1 | 6.27e-08 | NA | 0.001 |
| 3. B | Q2U5Z8 | Mitochondrial division protein 1 | 2.79e-07 | NA | 5.83e-04 |
| 3. B | A6S0T8 | Ribosome biogenesis protein ytm1 | 4.62e-13 | NA | 0.018 |
| 3. B | B2B766 | Nuclear distribution protein PAC1-2 | 5.90e-14 | NA | 8.98e-17 |
| 3. B | Q2KJH4 | WD repeat-containing protein 1 | 7.63e-06 | NA | 1.02e-06 |
| 3. B | G8SD34 | NAD(+) hydrolase ApTIR | 1.14e-13 | NA | 1.99e-21 |
| 3. B | Q7ZW33 | U3 small nucleolar RNA-associated protein 15 homolog | 2.39e-09 | NA | 1.35e-10 |
| 3. B | Q756D0 | Ribosome biogenesis protein YTM1 | 2.14e-09 | NA | 0.002 |
| 3. B | Q58E77 | WD repeat-containing protein 82-B | 0.00e+00 | NA | 8.77e-06 |
| 3. B | O42469 | Transducin-like enhancer protein 1 | 7.37e-09 | NA | 1.81e-07 |
| 3. B | Q5RFQ4 | WD repeat-containing protein 72 | 1.30e-03 | NA | 0.035 |
| 3. B | Q9W7F2 | WD repeat-containing protein 1-A | 6.92e-07 | NA | 1.25e-06 |
| 3. B | B0BNA7 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.05e-05 |
| 3. B | D5GBI7 | Nuclear distribution protein PAC1 | 1.98e-14 | NA | 4.54e-20 |
| 3. B | Q9XWH0 | Mitotic checkpoint protein bub-3 | 1.11e-16 | NA | 0.001 |
| 3. B | Q9BQA1 | Methylosome protein 50 | 2.66e-14 | NA | 0.046 |
| 3. B | P0CS51 | Protein transport protein SEC13 | 5.18e-13 | NA | 0.042 |
| 3. B | Q13033 | Striatin-3 | 2.75e-08 | NA | 2.69e-05 |
| 3. B | Q4WP10 | Ribosome biogenesis protein ytm1 | 3.82e-07 | NA | 4.58e-05 |
| 3. B | O89053 | Coronin-1A | 6.45e-07 | NA | 7.22e-05 |
| 3. B | P0CS49 | Pre-mRNA-splicing factor PRP46 | 2.04e-11 | NA | 2.78e-14 |
| 3. B | Q5RHI5 | Denticleless protein homolog | 5.91e-08 | NA | 1.14e-06 |
| 3. B | O74855 | Ribosome assembly protein 4 | 4.32e-09 | NA | 2.30e-26 |
| 3. B | O43815 | Striatin | 7.92e-08 | NA | 8.85e-04 |
| 3. B | P74442 | Uncharacterized WD repeat-containing protein slr0143 | 1.03e-07 | NA | 3.37e-17 |
| 3. B | P93563 | Guanine nucleotide-binding protein subunit beta | 6.33e-15 | NA | 2.57e-12 |
| 3. B | Q2GTM8 | Eukaryotic translation initiation factor 3 subunit I | 8.55e-15 | NA | 4.56e-04 |
| 3. B | Q9C827 | Coatomer subunit beta'-2 | 7.90e-07 | NA | 8.29e-09 |
| 3. B | Q2UBU2 | Protein HIR1 | 4.79e-05 | NA | 3.17e-08 |
| 3. B | B4Q9T6 | Ribosome biogenesis protein WDR12 homolog | 3.78e-11 | NA | 1.40e-10 |
| 3. B | Q7PP77 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.14e-05 |
| 3. B | Q6FWT9 | Nuclear distribution protein PAC1 | 2.18e-11 | NA | 5.09e-04 |
| 3. B | A6QM06 | Sterol regulatory element-binding protein cleavage-activating protein | 7.06e-03 | NA | 1.16e-04 |
| 3. B | Q9LJN8 | Mitotic checkpoint protein BUB3.1 | 0.00e+00 | NA | 3.81e-04 |
| 3. B | P0CS32 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.03e-05 |
| 3. B | Q4IBR4 | Protein HIR1 | 1.38e-07 | NA | 8.41e-06 |
| 3. B | Q3MHE2 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.11e-10 | NA | 4.99e-15 |
| 3. B | Q6FJ73 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 1.17e-08 |
| 3. B | Q1DZQ0 | Protein transport protein SEC13 | 4.00e-15 | NA | 0.003 |
| 3. B | Q6FNV4 | Protein transport protein SEC13-1 | 4.55e-15 | NA | 0.001 |
| 3. B | Q7T0P4 | POC1 centriolar protein homolog A | 7.01e-12 | NA | 4.07e-19 |
| 3. B | Q5XGE2 | U3 small nucleolar RNA-associated protein 15 homolog | 3.18e-09 | NA | 1.39e-12 |
| 3. B | Q9BVC4 | Target of rapamycin complex subunit LST8 | 3.33e-14 | NA | 2.05e-12 |
| 3. B | P91343 | Ribosome biogenesis protein WDR12 homolog | 8.86e-10 | NA | 2.29e-06 |
| 3. B | Q40507 | Guanine nucleotide-binding protein subunit beta | 2.11e-15 | NA | 8.06e-12 |
| 3. B | Q9C2I5 | Ribosome biogenesis protein ytm1 | 4.12e-09 | NA | 4.98e-04 |
| 3. B | B0WYR6 | WD repeat-containing protein on Y chromosome | 1.99e-05 | NA | 4.34e-08 |
| 3. B | P47025 | Mitochondrial division protein 1 | 1.70e-07 | NA | 2.06e-07 |
| 3. B | Q9UTC7 | Uncharacterized WD repeat-containing protein C227.12 | 5.61e-11 | NA | 8.63e-21 |
| 3. B | C5DF48 | Nuclear distribution protein PAC1 | 4.49e-12 | NA | 0.009 |
| 3. B | Q9NWT1 | p21-activated protein kinase-interacting protein 1 | 3.63e-09 | NA | 1.12e-04 |
| 3. B | Q61FW2 | F-box/WD repeat-containing protein sel-10 | 7.92e-07 | NA | 1.35e-18 |
| 3. B | Q99ME2 | WD repeat-containing protein 6 | 3.19e-05 | NA | 4.37e-04 |
| 3. B | Q6UXN9 | WD repeat-containing protein 82 | 0.00e+00 | NA | 1.70e-05 |
| 3. B | P39014 | F-box protein MET30 | 7.81e-07 | NA | 6.00e-11 |
| 3. B | Q9P7I3 | Mitochondrial division protein 1 | 4.08e-07 | NA | 4.83e-07 |
| 3. B | P0CS48 | Pre-mRNA-splicing factor PRP46 | 5.67e-11 | NA | 6.68e-14 |
| 3. B | Q6CB13 | Mitochondrial division protein 1 | 7.79e-11 | NA | 1.04e-08 |
| 3. B | Q8NHY2 | E3 ubiquitin-protein ligase COP1 | 6.12e-08 | NA | 4.29e-05 |
| 3. B | Q6CI08 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 6.89e-05 |
| 3. B | F1LTR1 | WD repeat-containing protein 26 | 1.05e-14 | NA | 0.001 |
| 3. B | Q9P7C0 | Uncharacterized WD repeat-containing protein C2E1P5.05 | 2.96e-08 | NA | 4.89e-05 |
| 3. B | Q17GR9 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 4.00e-09 |
| 3. B | Q54PP7 | BEACH domain-containing protein lvsF | 6.55e-06 | NA | 2.29e-05 |
| 3. B | Q9UM11 | Fizzy-related protein homolog | 3.06e-07 | NA | 1.22e-06 |
| 3. B | Q8TC44 | POC1 centriolar protein homolog B | 1.60e-13 | NA | 2.05e-18 |
| 3. B | Q6FQU6 | Protein transport protein SEC13-2 | 1.33e-15 | NA | 0.004 |
| 3. B | Q12770 | Sterol regulatory element-binding protein cleavage-activating protein | 3.71e-03 | NA | 3.06e-04 |
| 3. B | B3RNR8 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 8.43e-07 |
| 3. B | P53024 | Protein transport protein SEC13 | 1.22e-15 | NA | 9.50e-08 |
| 3. B | P0CS38 | Protein HIR1 | 1.32e-08 | NA | 5.66e-12 |
| 3. B | P25635 | Periodic tryptophan protein 2 | 2.43e-06 | NA | 5.76e-13 |
| 3. B | P63244 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | Q6DTM3 | Jouberin | 6.93e-05 | NA | 0.006 |
| 3. B | B4QHG6 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.35e-20 |
| 3. B | Q9D2V7 | Coronin-7 | 1.14e-04 | NA | 2.17e-08 |
| 3. B | B7PY76 | Ribosome biogenesis protein WDR12 homolog | 1.40e-09 | NA | 3.13e-07 |
| 3. B | Q9DC48 | Pre-mRNA-processing factor 17 | 3.09e-08 | NA | 4.08e-14 |
| 3. B | B4GSH1 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.57e-05 |
| 3. B | Q23256 | WD repeat-containing protein wdr-5.3 | 3.93e-11 | NA | 3.68e-21 |
| 3. B | Q4R2Z6 | WD repeat-containing protein 48 | 1.54e-08 | NA | 1.56e-12 |
| 3. B | C4YFX2 | Transcriptional repressor TUP1 | 9.44e-12 | NA | 1.88e-22 |
| 3. B | Q6FVD3 | Protein HIR1 | 7.26e-10 | NA | 7.33e-12 |
| 3. B | Q8YTC2 | Uncharacterized WD repeat-containing protein alr2800 | 3.69e-06 | NA | 4.35e-35 |
| 3. B | Q8T088 | WD repeat-containing protein 55 homolog | 3.11e-09 | NA | 3.29e-08 |
| 3. B | Q9DAW6 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.78e-10 | NA | 5.17e-15 |
| 3. B | Q965S8 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.31e-04 |
| 3. B | A7Z052 | WD repeat-containing protein 6 | 3.67e-04 | NA | 2.54e-04 |
| 3. B | P07834 | Cell division control protein 4 | 4.05e-05 | NA | 5.36e-10 |
| 3. B | Q55E54 | Coronin-B | 9.01e-05 | NA | 0.001 |
| 3. B | Q8TED0 | U3 small nucleolar RNA-associated protein 15 homolog | 2.42e-09 | NA | 2.22e-15 |
| 3. B | P43254 | E3 ubiquitin-protein ligase COP1 | 6.38e-06 | NA | 0.002 |
| 3. B | Q9CAA0 | Coatomer subunit beta'-1 | 8.25e-07 | NA | 1.59e-08 |
| 3. B | P0CS46 | Polyadenylation factor subunit 2 | 1.63e-07 | NA | 3.54e-06 |
| 3. B | Q04725 | Transducin-like enhancer protein 2 | 1.35e-08 | NA | 9.33e-06 |
| 3. B | P78706 | Transcriptional repressor rco-1 | 2.11e-10 | NA | 5.65e-25 |
| 3. B | Q6RI45 | Bromodomain and WD repeat-containing protein 3 | 9.70e-04 | NA | 5.19e-07 |
| 3. B | Q4R4I8 | Coatomer subunit beta' | 6.05e-07 | NA | 9.61e-10 |
| 3. B | B4KT48 | Lissencephaly-1 homolog | 0.00e+00 | NA | 1.71e-19 |
| 3. B | A5DL92 | Ribosome biogenesis protein YTM1 | 7.01e-10 | NA | 0.029 |
| 3. B | Q21215 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 0.00e+00 | NA | 1.36e-20 |
| 3. B | Q4R4J2 | Coronin-1A | 3.90e-07 | NA | 6.81e-06 |
| 3. B | Q9EPV5 | Apoptotic protease-activating factor 1 | 5.83e-06 | NA | 1.17e-16 |
| 3. B | Q96P53 | WD repeat and FYVE domain-containing protein 2 | 2.69e-10 | NA | 7.30e-11 |
| 3. B | D9N129 | WD repeat-containing protein 20 homolog | 2.06e-03 | NA | 0.023 |
| 3. B | O35242 | Protein FAN | 7.62e-08 | NA | 2.07e-10 |
| 3. B | B0FXQ5 | WD repeat-containing protein on Y chromosome | 1.59e-04 | NA | 1.38e-04 |
| 3. B | O13985 | Uncharacterized WD repeat-containing protein C26H5.03 | 2.27e-11 | NA | 4.77e-04 |
| 3. B | Q9PTR5 | Lissencephaly-1 homolog | 0.00e+00 | NA | 8.27e-20 |
| 3. B | O24456 | Receptor for activated C kinase 1A | 0.00e+00 | NA | 2.03e-19 |
| 3. B | Q9EQ15 | Guanine nucleotide-binding protein subunit beta-like protein 1 | 0.00e+00 | NA | 0.003 |
| 3. B | P0CS37 | Histone acetyltransferase type B subunit 2 | 4.55e-15 | NA | 1.24e-04 |
| 3. B | Q3TLR7 | Denticleless protein homolog | 2.94e-07 | NA | 1.80e-05 |
| 3. B | P62883 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.73e-12 |
| 3. B | Q6H8D5 | Coatomer subunit beta'-2 | 6.44e-07 | NA | 2.34e-08 |
| 3. B | Q6CJ50 | Mitochondrial division protein 1 | 1.40e-06 | NA | 3.50e-08 |
| 3. B | Q0CQ54 | Protein hir1 | 9.30e-05 | NA | 3.58e-07 |
| 3. B | Q9AUR7 | Coatomer subunit alpha-2 | 9.21e-10 | NA | 5.10e-12 |
| 3. B | Q8CBE3 | WD repeat-containing protein 37 | 3.39e-09 | NA | 4.75e-05 |
| 3. B | Q8BG40 | Katanin p80 WD40 repeat-containing subunit B1 | 2.06e-10 | NA | 3.44e-15 |
| 3. B | Q9UMS4 | Pre-mRNA-processing factor 19 | 3.85e-12 | NA | 1.15e-14 |
| 3. B | P16649 | General transcriptional corepressor TUP1 | 9.93e-09 | NA | 2.96e-23 |
| 3. B | Q9QZD9 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.10e-05 |
| 3. B | Q55FR9 | Coatomer subunit alpha | 3.41e-10 | NA | 6.13e-10 |
| 3. B | Q96S15 | GATOR complex protein WDR24 | 5.20e-06 | NA | 8.34e-05 |
| 3. B | Q8RXA7 | DENN domain and WD repeat-containing protein SCD1 | 9.51e-05 | NA | 8.04e-14 |
| 3. B | B7FF09 | WD repeat-containing protein on Y chromosome | 1.37e-05 | NA | 0.001 |
| 3. B | O80990 | Protein CIA1 | 0.00e+00 | NA | 1.38e-11 |
| 3. B | Q9R1A8 | E3 ubiquitin-protein ligase COP1 | 1.57e-07 | NA | 7.80e-05 |
| 3. B | Q0CJD8 | Mitochondrial division protein 1 | 8.60e-06 | NA | 5.26e-08 |
| 3. B | Q04726 | Transducin-like enhancer protein 3 | 9.32e-08 | NA | 3.63e-07 |
| 3. B | O88466 | Zinc finger protein 106 | 3.85e-03 | NA | 4.89e-06 |
| 3. B | Q5SUS0 | F-box/WD repeat-containing protein 10 | 1.29e-03 | NA | 2.65e-07 |
| 3. B | Q9H7D7 | WD repeat-containing protein 26 | 7.65e-13 | NA | 4.40e-04 |
| 3. B | Q9BQ87 | F-box-like/WD repeat-containing protein TBL1Y | 8.32e-08 | NA | 3.40e-16 |
| 3. B | Q5ZJW8 | Denticleless protein homolog | 1.55e-08 | NA | 1.50e-07 |
| 3. B | P38011 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 2.44e-16 |
| 3. B | A8XSW2 | WD repeat-containing protein 48 homolog | 2.09e-07 | NA | 1.67e-06 |
| 3. B | Q54DS4 | WD repeat-containing protein DDB_G0292056 | 3.00e-03 | NA | 2.65e-05 |
| 3. B | Q9JIT3 | Transducin-like enhancer protein 3 | 4.62e-08 | NA | 3.10e-07 |
| 3. B | A4IIX9 | WD repeat-containing protein 37 | 2.62e-09 | NA | 8.35e-05 |
| 3. B | A0JPH4 | Sterol regulatory element-binding protein cleavage-activating protein | 2.65e-03 | NA | 0.005 |
| 3. B | O35828 | Coronin-7 | 1.20e-04 | NA | 1.84e-08 |
| 3. B | P63247 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | Q9SZQ5 | WD repeat-containing protein VIP3 | 0.00e+00 | NA | 1.07e-09 |
| 3. B | Q4X0A9 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 8.40e-08 | NA | 1.31e-19 |
| 3. B | B4N0L0 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 9.17e-08 |
| 3. B | Q99KP6 | Pre-mRNA-processing factor 19 | 8.44e-15 | NA | 2.27e-14 |
| 3. B | P93398 | Guanine nucleotide-binding protein subunit beta-2 | 3.44e-15 | NA | 4.37e-12 |
| 3. B | Q27954 | Coatomer subunit alpha | 8.12e-08 | NA | 7.53e-08 |
| 3. B | Q5RAW8 | WD repeat-containing protein 48 | 2.63e-07 | NA | 1.82e-12 |
| 3. B | Q5BJQ6 | Cleavage stimulation factor subunit 1 | 1.32e-12 | NA | 4.19e-11 |
| 3. B | B5DG67 | Ribosome biogenesis protein wdr12 | 1.58e-10 | NA | 1.45e-07 |
| 3. B | Q24371 | Protein lethal(2)denticleless | 4.56e-06 | NA | 2.63e-04 |
| 3. B | Q5XIG8 | Serine-threonine kinase receptor-associated protein | 2.89e-15 | NA | 1.40e-07 |
| 3. B | Q5XI13 | Glutamate-rich WD repeat-containing protein 1 | 8.61e-10 | NA | 4.25e-07 |
| 3. B | P14197 | WD repeat-containing protein AAC3 | 8.98e-11 | NA | 3.59e-07 |
| 3. B | Q6GM65 | Phospholipase A-2-activating protein | 3.01e-06 | NA | 1.13e-04 |
| 3. B | Q16K15 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.93e-06 |
| 3. B | Q9FNN2 | WD repeat-containing protein 26 homolog | 4.85e-14 | NA | 1.30e-15 |
| 3. B | Q7KNS3 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.35e-20 |
| 3. B | A2RRU4 | Sterol regulatory element-binding protein cleavage-activating protein | 9.19e-04 | NA | 6.34e-05 |
| 3. B | Q9V3J8 | Protein will die slowly | 4.36e-12 | NA | 6.83e-27 |
| 3. B | Q9FN19 | WD40 repeat-containing protein HOS15 | 5.52e-08 | NA | 5.48e-11 |
| 3. B | Q6GPC6 | F-box-like/WD repeat-containing protein TBL1XR1-B | 1.46e-08 | NA | 3.94e-12 |
| 3. B | F4KB17 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 | 1.15e-08 | NA | 1.30e-16 |
| 3. B | B4HRQ6 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 9.76e-11 |
| 3. B | Q7RZF5 | Protein transport protein sec13 | 3.89e-15 | NA | 2.28e-06 |
| 3. B | A7MB12 | U3 small nucleolar RNA-associated protein 15 homolog | 1.19e-09 | NA | 7.69e-15 |
| 3. B | Q6KAU8 | Protein Atg16l2 | 3.97e-09 | NA | 5.54e-09 |
| 3. B | Q7PS24 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 2.13e-11 |
| 3. B | Q28YY2 | WD repeat-containing protein 48 homolog | 3.63e-07 | NA | 1.48e-10 |
| 3. B | Q6FLI3 | CCR4-associated factor 4 homolog | 1.29e-08 | NA | 6.40e-08 |
| 3. B | Q86W42 | THO complex subunit 6 homolog | 2.73e-12 | NA | 0.004 |
| 3. B | Q2TZG4 | Polyadenylation factor subunit 2 | 8.29e-09 | NA | 1.65e-06 |
| 3. B | Q9XSC3 | WD repeat-containing protein 44 | 2.10e-06 | NA | 2.54e-04 |
| 3. B | O48847 | Transcriptional corepressor LEUNIG_HOMOLOG | 4.10e-08 | NA | 2.62e-12 |
| 3. B | Q9ULV4 | Coronin-1C | 2.39e-06 | NA | 1.45e-04 |
| 3. B | Q6CG48 | Nuclear distribution protein PAC1 | 1.03e-12 | NA | 1.33e-11 |
| 3. B | P39946 | Nuclear distribution protein PAC1 | 2.27e-11 | NA | 3.77e-04 |
| 3. B | Q5E9A4 | mRNA export factor | 2.37e-11 | NA | 0.004 |
| 3. B | A4RJV3 | Mitochondrial division protein 1 | 1.13e-07 | NA | 4.21e-05 |
| 3. B | B0Y5V6 | Ribosome biogenesis protein ytm1 | 5.53e-07 | NA | 4.58e-05 |
| 3. B | A7TH19 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.37e-05 |
| 3. B | Q29L19 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.57e-05 |
| 3. B | P79083 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.21e-06 |
| 3. B | Q5R8K2 | Cleavage stimulation factor subunit 1 | 1.27e-12 | NA | 6.53e-10 |
| 3. B | Q5SP67 | WD repeat-containing protein 26 | 5.37e-10 | NA | 1.02e-04 |
| 3. B | Q32LP9 | Coronin-2A | 2.51e-06 | NA | 0.001 |
| 3. B | P62884 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.73e-12 |
| 3. B | Q5ZMA2 | Pre-mRNA-processing factor 19 | 1.80e-12 | NA | 7.06e-14 |
| 3. B | Q6S7B0 | Transcription initiation factor TFIID subunit 5 | 2.62e-07 | NA | 1.48e-13 |
| 3. B | Q54IY5 | Component of gems protein 5 | 9.89e-04 | NA | 0.009 |
| 3. B | Q9SRI1 | Protein transport protein SEC13 homolog A | 3.33e-16 | NA | 0.027 |
| 3. B | C4Q0P6 | Lissencephaly-1 homolog | 1.11e-14 | NA | 1.04e-20 |
| 3. B | O22212 | U4/U6 small nuclear ribonucleoprotein PRP4-like protein | 8.23e-10 | NA | 2.39e-21 |
| 3. B | Q6BSL7 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.72e-04 |
| 3. B | Q6Q0C0 | E3 ubiquitin-protein ligase TRAF7 | 1.35e-10 | NA | 1.84e-09 |
| 3. B | O43684 | Mitotic checkpoint protein BUB3 | 0.00e+00 | NA | 3.98e-04 |
| 3. B | U4PCM1 | pre-mRNA 3' end processing protein pfs-2 | 9.69e-07 | NA | 5.38e-09 |
| 3. B | O95170 | CMT1A duplicated region transcript 1 protein | 4.79e-05 | NA | 1.33e-06 |
| 3. B | B0X2V9 | WD repeat-containing protein 48 homolog | 2.17e-07 | NA | 3.30e-08 |
| 3. B | Q32KQ2 | WD repeat-containing protein 53 | 0.00e+00 | NA | 0.002 |
| 3. B | Q8K4P0 | pre-mRNA 3' end processing protein WDR33 | 3.07e-05 | NA | 3.47e-10 |
| 3. B | Q6BYU4 | Protein HIR1 | 1.01e-07 | NA | 7.45e-08 |
| 3. B | B4MU54 | Ribosome biogenesis protein WDR12 homolog | 1.06e-09 | NA | 7.35e-10 |
| 3. B | P41838 | Poly(A)+ RNA export protein | 3.60e-13 | NA | 4.46e-06 |
| 3. B | Q6GQT6 | Sterol regulatory element-binding protein cleavage-activating protein | 2.74e-03 | NA | 1.75e-04 |
| 3. B | Q4V837 | Denticleless protein homolog A | 2.73e-07 | NA | 8.71e-06 |
| 3. B | Q9Y263 | Phospholipase A-2-activating protein | 3.88e-08 | NA | 9.01e-08 |
| 3. B | Q09731 | UBP9-binding protein bun107 | 2.19e-06 | NA | 6.87e-10 |
| 3. B | O88342 | WD repeat-containing protein 1 | 7.93e-06 | NA | 9.31e-08 |
| 3. B | Q759L2 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 4.35e-05 |
| 3. B | Q0CY32 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.65e-08 | NA | 4.35e-19 |
| 3. B | Q4PCB8 | Protein transport protein SEC13 | 8.58e-10 | NA | 1.80e-04 |
| 3. B | Q28DW0 | Probable cytosolic iron-sulfur protein assembly protein ciao1 | 0.00e+00 | NA | 2.25e-06 |
| 3. B | Q8C092 | Transcription initiation factor TFIID subunit 5 | 6.15e-08 | NA | 3.27e-20 |
| 3. B | Q9GZS3 | WD repeat-containing protein 61 | 0.00e+00 | NA | 9.52e-13 |
| 3. B | Q8NHV4 | Protein NEDD1 | 2.14e-10 | NA | 1.17e-05 |
| 3. B | Q6CU59 | Ribosome biogenesis protein YTM1 | 2.92e-09 | NA | 2.89e-05 |
| 3. B | Q9URY0 | Ribosome biogenesis protein ytm1 | 9.89e-10 | NA | 0.041 |
| 3. B | Q922V4 | Pleiotropic regulator 1 | 3.18e-10 | NA | 5.38e-09 |
| 3. B | Q5ZMV7 | WD repeat-containing protein 82 | 0.00e+00 | NA | 5.60e-06 |
| 3. B | Q9Z2K5 | Target of rapamycin complex subunit LST8 | 0.00e+00 | NA | 7.50e-11 |
| 3. B | P40066 | mRNA export factor GLE2 | 1.67e-12 | NA | 5.53e-05 |
| 3. B | Q6GPU3 | Denticleless protein homolog B | 3.98e-07 | NA | 2.13e-05 |
| 3. B | Q05AM5 | Elongator complex protein 2 | 1.17e-05 | NA | 0.001 |
| 3. B | Q5ZIU8 | Katanin p80 WD40 repeat-containing subunit B1 | 6.00e-12 | NA | 5.20e-14 |
| 3. B | Q75LV5 | U3 snoRNP-associated protein-like YAOH | 2.70e-09 | NA | 3.00e-13 |
| 3. B | Q13112 | Chromatin assembly factor 1 subunit B | 2.93e-12 | NA | 1.06e-08 |
| 3. B | P79987 | Protein HIRA | 3.87e-06 | NA | 0.002 |
| 3. B | P93107 | Flagellar WD repeat-containing protein Pf20 | 1.11e-10 | NA | 4.25e-13 |
| 3. B | A6R3K5 | Ribosome biogenesis protein YTM1 | 1.72e-09 | NA | 1.18e-04 |
| 3. B | Q04724 | Transducin-like enhancer protein 1 | 8.99e-09 | NA | 5.00e-07 |
| 3. B | Q54QU5 | WD repeat-containing protein 89 homolog | 3.00e-10 | NA | 2.18e-04 |
| 3. B | Q1JQB2 | Mitotic checkpoint protein BUB3 | 0.00e+00 | NA | 3.96e-04 |
| 3. B | Q7T394 | Lissencephaly-1 homolog A | 0.00e+00 | NA | 5.76e-20 |
| 3. B | Q7ZXK9 | Notchless protein homolog 1 | 1.32e-08 | NA | 2.12e-18 |
| 3. B | Q5RAC9 | Autophagy-related protein 16-1 | 7.88e-12 | NA | 1.24e-10 |
| 3. B | D3Z902 | F-box/WD repeat-containing protein 7 | 4.29e-06 | NA | 7.93e-25 |
| 3. B | O08653 | Telomerase protein component 1 | 7.23e-04 | NA | 2.88e-08 |
| 3. B | Q09715 | Transcriptional repressor tup11 | 1.34e-09 | NA | 3.25e-24 |
| 3. B | Q1HPW4 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.06e-04 |
| 3. B | Q9R037 | WD repeat-containing protein 44 | 1.51e-06 | NA | 1.64e-04 |
| 3. B | Q7S8R5 | Mitochondrial division protein 1 | 1.27e-07 | NA | 1.69e-05 |
| 3. B | Q9LV27 | Target of rapamycin complex subunit LST8-1 | 0.00e+00 | NA | 4.30e-16 |
| 3. B | Q9FND4 | WD repeat-containing protein WDS homolog | 2.78e-15 | NA | 1.01e-13 |
| 3. B | A2QHM1 | Protein transport protein sec13 | 1.93e-14 | NA | 5.82e-05 |
| 3. B | B4MY65 | Lissencephaly-1 homolog | 0.00e+00 | NA | 3.11e-20 |
| 3. B | Q7SZM9 | F-box-like/WD repeat-containing protein TBL1XR1-A | 6.99e-09 | NA | 3.31e-12 |
| 3. B | Q93ZG3 | WD repeat-containing protein ATCSA-1 | 1.21e-12 | NA | 3.23e-05 |
| 3. B | Q2HHH2 | DNA damage-binding protein CMR1 | 7.15e-08 | NA | 9.81e-05 |
| 3. B | Q08122 | Transducin-like enhancer protein 3 | 5.96e-08 | NA | 3.51e-07 |
| 3. B | A4R7U3 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.55e-15 | NA | 1.49e-05 |
| 3. B | Q62441 | Transducin-like enhancer protein 4 | 1.11e-08 | NA | 4.25e-07 |
| 3. B | P49027 | Guanine nucleotide-binding protein subunit beta-like protein A | 0.00e+00 | NA | 4.60e-16 |
| 3. B | Q91WM3 | U3 small nucleolar RNA-interacting protein 2 | 1.84e-09 | NA | 1.65e-12 |
| 3. B | B4Q354 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.69e-05 |
| 3. B | P26309 | APC/C activator protein CDC20 | 1.44e-06 | NA | 0.025 |
| 3. B | Q7RZI0 | Protein hir-1 | 4.68e-06 | NA | 1.38e-06 |
| 3. B | Q4P553 | Histone acetyltransferase type B subunit 2 | 3.00e-15 | NA | 5.76e-05 |
| 3. B | Q5AZX0 | Polyadenylation factor subunit 2 | 8.23e-08 | NA | 5.07e-06 |
| 3. B | Q0CCS0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.82e-11 | NA | 1.28e-07 |
| 3. B | Q9AV81 | Pre-mRNA-processing factor 19 | 8.26e-11 | NA | 8.44e-11 |
| 3. B | Q5REE0 | U3 small nucleolar RNA-associated protein 15 homolog | 1.87e-10 | NA | 7.74e-15 |
| 3. B | Q8BHB4 | WD repeat-containing protein 3 | 8.24e-06 | NA | 2.25e-16 |
| 3. B | P87053 | F-box/WD repeat-containing protein pof1 | 7.02e-08 | NA | 4.64e-15 |
| 3. B | Q8C4J7 | Transducin beta-like protein 3 | 1.19e-06 | NA | 8.69e-12 |
| 3. B | Q39336 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.49e-18 |
| 3. B | Q6ZMW3 | Echinoderm microtubule-associated protein-like 6 | 5.09e-04 | NA | 2.78e-09 |
| 3. B | Q9JJ66 | Cell division cycle protein 20 homolog | 3.45e-08 | NA | 3.56e-10 |
| 3. B | Q9W328 | Protein LST8 homolog | 2.44e-15 | NA | 3.74e-17 |
| 3. B | O13166 | Transducin-like enhancer protein 3-A | 6.14e-09 | NA | 2.99e-07 |
| 3. B | A0A2R8QFQ6 | F-box and WD repeat domain-containing 11-A | 3.79e-08 | NA | 1.02e-16 |
| 3. B | Q9GL51 | Platelet-activating factor acetylhydrolase IB subunit alpha | 0.00e+00 | NA | 1.59e-19 |
| 3. B | Q6PA72 | Target of rapamycin complex subunit lst8 | 0.00e+00 | NA | 1.04e-12 |
| 3. B | Q9XW12 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 7.88e-06 |
| 3. B | Q0DYP5 | Zinc finger CCCH domain-containing protein 17 | 1.06e-07 | NA | 0.020 |
| 3. B | C5MIB1 | Restriction of telomere capping protein 1 | 8.32e-05 | NA | 0.017 |
| 3. B | Q5RB58 | Mitotic checkpoint protein BUB3 | 0.00e+00 | NA | 5.58e-04 |
| 3. B | Q7ZX22 | GATOR complex protein WDR24 | 3.45e-06 | NA | 2.93e-04 |
| 3. B | A9VDW7 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 1.98e-08 | NA | 6.15e-04 |
| 3. B | Q9ZU34 | Actin-interacting protein 1-1 | 1.17e-05 | NA | 1.42e-06 |
| 3. B | P38129 | Transcription initiation factor TFIID subunit 5 | 4.21e-09 | NA | 1.28e-14 |
| 3. B | P27133 | Coronin-A | 2.87e-06 | NA | 1.36e-06 |
| 3. B | P0CY34 | Transcriptional repressor TUP1 | 5.67e-12 | NA | 1.89e-22 |
| 3. B | Q2GXT0 | Ribosome biogenesis protein YTM1 | 4.94e-13 | NA | 8.98e-04 |
| 3. B | B0XTS1 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 3.83e-08 | NA | 1.31e-19 |
| 3. B | Q8CGF6 | WD repeat-containing protein 47 | 4.17e-08 | NA | 1.10e-04 |
| 3. B | Q6S003 | Kinesin-related protein 8 | 7.71e-03 | NA | 5.19e-04 |
| 3. B | O14053 | U3 small nucleolar RNA-associated protein 21 homolog | 9.85e-06 | NA | 0.003 |
| 3. B | B3MVL6 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.18e-05 |
| 3. B | B4KTK4 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 1.62e-08 |
| 3. B | E3LB80 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 3.74e-07 |
| 3. B | Q920M5 | Coronin-6 | 3.83e-07 | NA | 1.38e-05 |
| 3. B | Q75BS7 | DNA damage-binding protein CMR1 | 6.66e-07 | NA | 9.54e-05 |
| 3. B | Q5F201 | Cilia- and flagella-associated protein 52 | 1.09e-14 | NA | 2.38e-08 |
| 3. B | Q5NVD0 | U4/U6 small nuclear ribonucleoprotein Prp4 | 2.18e-10 | NA | 7.19e-15 |
| 3. B | Q05946 | U3 small nucleolar RNA-associated protein 13 | 1.10e-06 | NA | 1.10e-13 |
| 3. B | O94319 | Protein transport protein sec13 | 7.77e-16 | NA | 3.86e-04 |
| 3. B | A0A1P8AW69 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 | 1.49e-07 | NA | 5.75e-14 |
| 3. B | Q66J51 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.77e-06 |
| 3. B | P93471 | E3 ubiquitin-protein ligase COP1 | 2.06e-07 | NA | 3.00e-04 |
| 3. B | Q6CBI8 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 4.98e-07 |
| 3. B | B4F7L9 | WD repeat-containing protein on Y chromosome | 3.16e-04 | NA | 2.29e-04 |
| 3. B | Q803D2 | Lissencephaly-1 homolog B | 0.00e+00 | NA | 5.78e-18 |
| 3. B | E9Q4P1 | WD repeat and FYVE domain-containing protein 1 | 1.67e-09 | NA | 2.32e-12 |
| 3. B | Q9UNX4 | WD repeat-containing protein 3 | 2.42e-06 | NA | 5.47e-16 |
| 3. B | Q54WA3 | Peroxisomal targeting signal 2 receptor | 0.00e+00 | NA | 1.42e-08 |
| 3. B | Q9AUR8 | Coatomer subunit alpha-1 | 4.89e-10 | NA | 9.31e-12 |
| 3. B | A6H603 | NACHT domain- and WD repeat-containing protein 1 | 1.56e-04 | NA | 0.005 |
| 3. B | Q8IV35 | WD repeat-containing protein 49 | 3.04e-06 | NA | 0.001 |
| 3. B | Q8JZX3 | POC1 centriolar protein homolog A | 1.11e-16 | NA | 9.19e-19 |
| 3. B | Q9QXL1 | Kinesin-like protein KIF21B | 3.89e-04 | NA | 0.005 |
| 3. B | Q09589 | Protein HIRA | 3.21e-06 | NA | 0.042 |
| 3. B | Q6ED65 | Echinoderm microtubule-associated protein-like 5 | 2.97e-03 | NA | 2.68e-08 |
| 3. B | P40968 | Pre-mRNA-processing factor 17 | 4.23e-10 | NA | 1.19e-12 |
| 3. B | Q2KIY3 | WD repeat and FYVE domain-containing protein 1 | 4.04e-10 | NA | 3.54e-13 |
| 3. B | Q12024 | Ribosome biogenesis protein YTM1 | 7.35e-08 | NA | 1.63e-05 |
| 3. B | A8PD13 | Ribosome biogenesis protein YTM1 | 1.90e-09 | NA | 7.88e-06 |
| 3. B | O24076 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.86e-18 |
| 3. B | Q8NBT0 | POC1 centriolar protein homolog A | 1.55e-15 | NA | 1.10e-17 |
| 3. B | Q3B7M6 | Protein NEDD1 | 2.17e-09 | NA | 1.31e-05 |
| 3. B | Q294Y7 | WD repeat-containing protein 55 homolog | 9.50e-09 | NA | 3.88e-08 |
| 3. B | Q3U3T8 | WD repeat-containing protein 62 | 2.56e-03 | NA | 5.06e-07 |
| 3. B | Q9WUM4 | Coronin-1C | 5.13e-07 | NA | 8.15e-05 |
| 3. B | Q3SWX8 | Histone-binding protein RBBP7 | 1.89e-15 | NA | 8.40e-07 |
| 3. B | A7RM20 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.82e-05 |
| 3. B | F1M5N7 | Kinesin-like protein KIF21B | 6.78e-04 | NA | 0.004 |
| 3. B | Q8C570 | mRNA export factor | 2.36e-11 | NA | 0.004 |
| 3. B | F6ZT52 | POC1 centriolar protein homolog B | 1.75e-11 | NA | 2.54e-22 |
| 3. B | Q9XF57 | Peroxisome biogenesis protein 7 | 0.00e+00 | NA | 3.83e-05 |
| 3. B | Q76B40 | WD40 repeat-containing protein SMU1 | 5.45e-11 | NA | 2.11e-14 |
| 3. B | Q9BRP4 | Proteasomal ATPase-associated factor 1 | 8.68e-11 | NA | 4.23e-13 |
| 3. B | Q9LJR3 | Protein SPA1-RELATED 3 | 4.14e-06 | NA | 6.04e-07 |
| 3. B | Q54HW5 | Guanine nucleotide-binding protein subunit beta-like protein 1 homolog | 1.02e-12 | NA | 0.010 |
| 3. B | Q8C0J2 | Autophagy-related protein 16-1 | 2.22e-08 | NA | 3.24e-11 |
| 3. B | P35605 | Coatomer subunit beta' | 5.40e-07 | NA | 1.17e-09 |
| 3. B | Q5B4R1 | Ribosome biogenesis protein ytm1 | 1.77e-09 | NA | 5.52e-04 |
| 3. B | Q9VZF4 | F-box/WD repeat-containing protein 7 | 2.34e-03 | NA | 3.21e-24 |
| 3. B | A2AHJ4 | Bromodomain and WD repeat-containing protein 3 | 1.79e-03 | NA | 3.23e-07 |
| 3. B | B4JW81 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 2.23e-07 |
| 3. B | B5DHW4 | WD repeat-containing protein on Y chromosome | 4.15e-05 | NA | 0.003 |
| 3. B | B3NSK1 | WD repeat-containing protein 48 homolog | 2.58e-09 | NA | 3.53e-11 |
| 3. B | Q0J7U6 | Protein TOPLESS-RELATED PROTEIN 2 | 4.19e-05 | NA | 0.028 |
| 3. B | Q7ZVF0 | POC1 centriolar protein homolog A | 0.00e+00 | NA | 1.57e-21 |
| 3. B | Q8H0T9 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 | 9.21e-09 | NA | 4.28e-17 |
| 3. B | Q5XUX1 | F-box/WD repeat-containing protein 9 | 1.39e-09 | NA | 0.009 |
| 3. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 0.030 |
| 3. B | C4YPI7 | Nuclear distribution protein PAC1 | 1.93e-12 | NA | 1.22e-12 |
| 3. B | Q4V7Y7 | Katanin p80 WD40 repeat-containing subunit B1 | 1.55e-10 | NA | 2.40e-15 |
| 3. B | B4HND9 | WD repeat-containing protein 48 homolog | 1.88e-08 | NA | 6.83e-12 |
| 3. B | Q2T9T9 | F-box/WD repeat-containing protein 9 | 1.33e-08 | NA | 0.005 |
| 3. B | Q8BHJ5 | F-box-like/WD repeat-containing protein TBL1XR1 | 1.29e-08 | NA | 4.20e-12 |
| 3. B | Q922B6 | E3 ubiquitin-protein ligase TRAF7 | 1.55e-11 | NA | 2.82e-09 |
| 3. B | Q5EBD9 | Elongator complex protein 2 | 2.95e-05 | NA | 0.025 |
| 3. B | Q8R2U0 | Nucleoporin SEH1 | 5.01e-10 | NA | 5.75e-04 |
| 3. B | Q5B8Y3 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 8.06e-06 |
| 3. B | Q7ZWF0 | mRNA export factor | 5.41e-12 | NA | 1.41e-04 |
| 3. B | Q9FNZ1 | Zinc finger CCCH domain-containing protein 63 | 1.00e-08 | NA | 0.004 |
| 3. B | Q6DIF4 | WD repeat-containing protein 1 | 2.15e-05 | NA | 2.26e-06 |
| 3. B | Q803V5 | Target of rapamycin complex subunit lst8 | 1.11e-16 | NA | 7.90e-13 |
| 3. B | O02195 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.91e-05 |
| 3. B | Q9NZJ0 | Denticleless protein homolog | 4.94e-07 | NA | 7.93e-05 |
| 3. B | Q99LC2 | Cleavage stimulation factor subunit 1 | 5.58e-13 | NA | 4.19e-11 |
| 3. B | P31146 | Coronin-1A | 4.16e-07 | NA | 1.61e-04 |
| 3. B | Q54DM1 | Mitotic checkpoint protein bub3 | 0.00e+00 | NA | 0.005 |
| 3. B | A0A1L8HX76 | WD repeat-containing protein 18 | 1.17e-08 | NA | 8.91e-09 |
| 3. B | P0CS31 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.22e-15 | NA | 6.12e-04 |
| 3. B | Q9BR76 | Coronin-1B | 3.63e-07 | NA | 0.001 |
| 3. B | Q6ZD63 | Chromatin assembly factor 1 subunit FAS2 homolog | 8.48e-13 | NA | 2.94e-11 |
| 3. B | O02482 | Transcription factor unc-37 | 5.45e-10 | NA | 0.001 |
| 3. B | Q5FVN8 | WD repeat, SAM and U-box domain-containing protein 1 | 3.11e-15 | NA | 1.68e-16 |
| 3. B | B4GIJ0 | WD repeat-containing protein 48 homolog | 3.07e-08 | NA | 1.48e-10 |
| 3. B | Q6QEF8 | Coronin-6 | 6.09e-07 | NA | 4.79e-06 |
| 3. B | Q54SF9 | Myosin heavy chain kinase D | 1.25e-06 | NA | 1.75e-11 |
| 3. B | Q1DJF7 | Ribosome biogenesis protein YTM1 | 5.60e-07 | NA | 1.62e-04 |
| 3. B | G0SA60 | Protein transport protein SEC13 | 9.99e-15 | NA | 3.03e-06 |
| 3. B | Q2UG43 | Protein transport protein sec13 | 5.34e-14 | NA | 3.16e-04 |
| 3. B | Q291L9 | Lissencephaly-1 homolog | 0.00e+00 | NA | 2.04e-19 |
| 3. B | Q96WV5 | Putative coatomer subunit alpha | 4.55e-08 | NA | 1.89e-09 |
| 3. B | P49026 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 8.70e-17 |
| 3. B | Q5F3D7 | U3 small nucleolar RNA-associated protein 15 homolog | 3.92e-09 | NA | 7.50e-11 |
| 3. B | B7FF12 | WD repeat-containing protein on Y chromosome | 3.45e-04 | NA | 2.25e-04 |
| 3. B | Q9N4A7 | Protein SEC13 homolog | 4.23e-08 | NA | 2.45e-04 |
| 3. B | Q68FJ6 | p21-activated protein kinase-interacting protein 1-like | 7.54e-11 | NA | 7.74e-08 |
| 3. B | A7ECP3 | Ribosome biogenesis protein ytm1 | 5.98e-12 | NA | 0.001 |
| 3. B | Q6DJD8 | Coronin-2B | 1.34e-06 | NA | 0.015 |
| 3. B | P63004 | Platelet-activating factor acetylhydrolase IB subunit alpha | 0.00e+00 | NA | 7.75e-20 |
| 3. B | G5EEG7 | Smu-1 suppressor of mec-8 and unc-52 protein | 1.21e-13 | NA | 2.55e-11 |
| 3. B | Q8L3Z8 | Protein FIZZY-RELATED 2 | 2.87e-07 | NA | 2.65e-04 |
| 3. B | P90587 | 66 kDa stress protein | 6.92e-06 | NA | 8.67e-12 |
| 3. B | Q38942 | Protein RAE1 | 0.00e+00 | NA | 0.001 |
| 3. B | G0SEA3 | mRNA export factor GLE2 | 8.09e-13 | NA | 6.29e-04 |
| 3. B | Q5I0B4 | Target of rapamycin complex subunit lst8 | 0.00e+00 | NA | 9.85e-13 |
| 3. B | Q2GT28 | Nuclear distribution protein PAC1-2 | 4.50e-14 | NA | 3.38e-16 |
| 3. B | Q8MY12 | Myosin heavy chain kinase C | 3.15e-07 | NA | 1.30e-13 |
| 3. B | A7EF03 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 7.89e-04 |
| 3. B | P97499 | Telomerase protein component 1 | 8.46e-03 | NA | 1.03e-08 |
| 3. B | Q94BR4 | Pre-mRNA-processing factor 19 homolog 1 | 2.65e-11 | NA | 4.73e-11 |
| 3. B | A7TMF9 | Ribosome biogenesis protein YTM1 | 3.95e-08 | NA | 4.20e-04 |
| 3. B | Q21624 | Coronin-like protein cor-1 | 2.26e-05 | NA | 8.62e-04 |
| 3. B | Q92828 | Coronin-2A | 1.98e-06 | NA | 0.010 |
| 3. B | B4QB64 | WD repeat-containing protein 48 homolog | 1.38e-08 | NA | 5.06e-12 |
| 3. B | Q9D5R2 | WD repeat-containing protein 20 | 7.87e-06 | NA | 0.013 |
| 3. B | Q3MV14 | Protein DECREASED SIZE EXCLUSION LIMIT 1 | 7.31e-12 | NA | 2.90e-04 |
| 3. B | Q8L4M1 | THO complex subunit 6 | 2.56e-14 | NA | 0.004 |
| 3. B | B5X3C4 | Lissencephaly-1 homolog B | 0.00e+00 | NA | 5.69e-17 |
| 3. B | Q6NRT3 | WD40 repeat-containing protein SMU1 | 1.14e-13 | NA | 2.50e-14 |
| 3. B | Q9WVA3 | Mitotic checkpoint protein BUB3 | 0.00e+00 | NA | 3.96e-04 |
| 3. B | Q2UPI0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 6.66e-16 | NA | 1.27e-04 |
| 3. B | Q5RB07 | WD repeat-containing protein 6 | 4.59e-05 | NA | 2.54e-04 |
| 3. B | Q96JK2 | DDB1- and CUL4-associated factor 5 | 2.86e-06 | NA | 3.62e-04 |
| 3. B | E9Q349 | WD repeat-containing protein 25 | 1.77e-10 | NA | 1.82e-04 |
| 3. B | Q4WTC4 | Protein hir1 | 5.14e-07 | NA | 1.46e-04 |
| 3. B | O76071 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 0.00e+00 | NA | 2.82e-10 |
| 3. B | Q10051 | Pre-mRNA-processing factor 19 | 5.87e-11 | NA | 1.62e-11 |
| 3. B | A7RWD2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 0.00e+00 | NA | 3.84e-09 |
| 3. B | Q2KJJ5 | Transducin beta-like protein 3 | 9.52e-08 | NA | 3.40e-12 |
| 3. B | Q1DPU4 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 8.53e-05 |
| 3. B | Q54D08 | Protein LST8 homolog | 0.00e+00 | NA | 1.56e-14 |
| 3. B | A1CXL0 | Ribosome biogenesis protein ytm1 | 5.16e-09 | NA | 8.58e-05 |
| 3. B | Q9LF27 | Ribosome biogenesis protein WDR12 homolog | 2.13e-08 | NA | 7.81e-06 |
| 3. B | Q2KID6 | Pleiotropic regulator 1 | 9.63e-11 | NA | 4.06e-09 |
| 3. B | P38123 | COMPASS component SWD3 | 0.00e+00 | NA | 2.71e-13 |
| 3. B | Q99M63 | WD40 repeat-containing protein SMU1 | 1.54e-08 | NA | 2.19e-14 |
| 3. B | Q6NX08 | Ribosome biogenesis protein wdr12 | 2.74e-09 | NA | 1.91e-08 |
| 3. B | Q9BVA0 | Katanin p80 WD40 repeat-containing subunit B1 | 1.71e-10 | NA | 3.03e-15 |
| 3. B | Q13347 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.89e-05 |
| 3. B | Q0UNA9 | Protein transport protein SEC13 | 7.68e-14 | NA | 0.003 |
| 3. B | B3S4I5 | Lissencephaly-1 homolog | 0.00e+00 | NA | 1.93e-21 |
| 3. B | B4LQ21 | Lissencephaly-1 homolog | 0.00e+00 | NA | 1.79e-19 |
| 3. B | A8PWQ8 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.51e-12 | NA | 2.81e-04 |
| 3. B | Q9FKR9 | Zinc finger CCCH domain-containing protein 59 | 1.85e-07 | NA | 0.023 |
| 3. B | Q5XJS5 | THO complex subunit 6 homolog | 1.05e-14 | NA | 0.007 |
| 3. B | Q9D0N7 | Chromatin assembly factor 1 subunit B | 4.09e-12 | NA | 4.57e-09 |
| 3. B | Q9UUG8 | Transcriptional repressor tup12 | 1.28e-10 | NA | 1.46e-29 |
| 3. B | B4JPT9 | Ribosome biogenesis protein WDR12 homolog | 9.91e-14 | NA | 1.61e-09 |
| 3. B | Q25306 | Guanine nucleotide-binding protein subunit beta-like protein | 0.00e+00 | NA | 1.15e-12 |
| 3. B | Q8BQM8 | Echinoderm microtubule-associated protein-like 5 | 4.59e-03 | NA | 2.10e-08 |
| 3. B | P53621 | Coatomer subunit alpha | 6.62e-10 | NA | 1.04e-07 |
| 3. B | B4MFM2 | WD repeat-containing protein 48 homolog | 2.39e-07 | NA | 4.78e-11 |
| 3. B | Q552R1 | DDB1- and CUL4-associated factor 7 homolog | 0.00e+00 | NA | 0.005 |
| 3. B | A5DXE2 | Protein transport protein SEC13 | 1.33e-15 | NA | 0.005 |
| 3. B | Q9VU65 | POC1 centriolar protein homolog | 1.55e-15 | NA | 3.37e-15 |
| 3. B | Q9USN3 | Probable U3 small nucleolar RNA-associated protein 13 | 4.28e-08 | NA | 7.63e-22 |
| 3. B | Q32SG6 | Protein HIRA | 1.61e-08 | NA | 9.56e-05 |
| 3. B | Q91854 | Beta-TrCP | 1.78e-07 | NA | 3.71e-18 |
| 3. B | Q6DKP5 | WD repeat-containing protein 13 | 1.46e-08 | NA | 0.005 |
| 3. B | P78798 | Peroxisomal targeting signal 2 receptor | 0.00e+00 | NA | 0.015 |
| 3. B | Q7ZVL2 | GATOR complex protein WDR24 | 2.13e-06 | NA | 0.001 |
| 3. B | B5X212 | Probable cytosolic iron-sulfur protein assembly protein ciao1-B | 0.00e+00 | NA | 1.35e-07 |
| 3. B | B4GQJ7 | WD repeat-containing protein on Y chromosome | 1.66e-05 | NA | 0.004 |
| 3. B | P0CS33 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.03e-05 |
| 3. B | Q6P4J8 | WD40 repeat-containing protein SMU1 | 1.41e-08 | NA | 2.04e-13 |
| 3. B | Q96MR6 | Cilia- and flagella-associated protein 57 | 1.19e-04 | NA | 3.97e-05 |
| 3. B | Q74ZN0 | Protein HIR1 | 1.76e-07 | NA | 5.64e-07 |
| 3. B | Q5VQ78 | Coatomer subunit beta'-1 | 6.47e-07 | NA | 2.14e-13 |
| 3. B | A6NE52 | WD repeat-containing protein 97 | 1.41e-02 | NA | 0.043 |
| 3. B | A3LQ86 | Ribosome biogenesis protein YTM1 | 7.91e-08 | NA | 2.16e-06 |
| 3. B | Q15269 | Periodic tryptophan protein 2 homolog | 9.31e-06 | NA | 8.71e-09 |
| 3. B | Q54S79 | WD repeat-containing protein 3 homolog | 5.89e-06 | NA | 2.73e-11 |
| 3. B | Q99KN2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 0.00e+00 | NA | 6.36e-10 |
| 3. B | Q54PE0 | Periodic tryptophan protein 2 homolog | 1.27e-04 | NA | 1.75e-10 |
| 3. B | Q4FZW5 | Nucleoporin SEH1-A | 1.77e-09 | NA | 0.002 |
| 3. B | Q04491 | Protein transport protein SEC13 | 4.88e-15 | NA | 7.15e-04 |
| 3. B | Q9AYE4 | Target of rapamycin complex subunit LST8 | 0.00e+00 | NA | 2.01e-18 |
| 3. B | B4HSL3 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.35e-20 |
| 3. B | P63243 | Receptor of activated protein C kinase 1 | 0.00e+00 | NA | 1.55e-15 |
| 3. B | Q5R7R2 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 1.58e-05 |
| 3. B | Q09855 | F-box/WD repeat-containing protein pof11 | 1.15e-07 | NA | 3.47e-14 |
| 3. B | Q9FUY2 | Transcriptional corepressor LEUNIG | 2.46e-06 | NA | 1.63e-16 |
| 3. B | A6ZYM0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 1.63e-10 |
| 3. B | A3LVM1 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 3.19e-05 |
| 3. B | Q5E966 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.89e-05 |
| 3. B | Q60584 | F-box/WD repeat-containing protein 2 | 1.89e-08 | NA | 9.77e-07 |
| 3. B | Q00659 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 8.77e-08 | NA | 4.00e-21 |
| 3. B | Q9ERF3 | WD repeat-containing protein 61 | 0.00e+00 | NA | 2.29e-12 |
| 3. B | Q5R650 | WD repeat-containing protein 37 | 1.29e-08 | NA | 5.64e-05 |
| 3. B | B4P116 | Ribosome biogenesis protein WDR12 homolog | 9.02e-14 | NA | 8.38e-11 |
| 3. B | Q6NVM2 | Katanin p80 WD40 repeat-containing subunit B1 | 1.31e-11 | NA | 2.00e-14 |
| 3. B | Q5M7T1 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 0.00e+00 | NA | 6.59e-10 |
| 3. B | Q5BDJ5 | Probable cytosolic iron-sulfur protein assembly protein 1 | 5.32e-13 | NA | 3.13e-06 |
| 3. B | Q7KWK5 | Pre-mRNA-processing factor 19 | 1.34e-10 | NA | 0.001 |
| 3. B | Q6NV31 | WD repeat-containing protein 82 | 0.00e+00 | NA | 3.73e-05 |
| 3. B | Q7QJ33 | Ribosome biogenesis protein WDR12 homolog | 1.95e-11 | NA | 9.81e-06 |
| 3. B | Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | 1.77e-09 | NA | 1.88e-07 |
| 3. B | O22468 | WD-40 repeat-containing protein MSI2 | 3.33e-16 | NA | 8.74e-07 |
| 3. B | Q9C0J8 | pre-mRNA 3' end processing protein WDR33 | 4.03e-06 | NA | 3.29e-10 |
| 3. B | Q6CMA2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 1.19e-09 |
| 3. B | D3TLL6 | Lissencephaly-1 homolog | 0.00e+00 | NA | 1.35e-18 |
| 3. B | A8ILK1 | Cilia- and flagella-associated protein 52 | 2.52e-14 | NA | 7.69e-10 |
| 3. B | O94967 | WD repeat-containing protein 47 | 3.41e-07 | NA | 1.09e-04 |
| 3. B | Q2TBP4 | POC1 centriolar protein homolog A | 1.11e-16 | NA | 8.10e-18 |
| 3. B | P20053 | U4/U6 small nuclear ribonucleoprotein PRP4 | 0.00e+00 | NA | 8.66e-14 |
| 3. B | Q55DM1 | BEACH domain-containing protein lvsA | NA | NA | 0.018 |
| 3. B | Q9Y3F4 | Serine-threonine kinase receptor-associated protein | 1.71e-14 | NA | 2.07e-07 |
| 3. B | Q5SRY7 | F-box/WD repeat-containing protein 11 | 9.94e-14 | NA | 1.35e-17 |
| 3. B | B3N4C7 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.16e-05 |
| 3. B | G0SFB5 | Ribosome biogenesis protein YTM1 | 2.92e-09 | NA | 0.007 |
| 3. B | P54198 | Protein HIRA | 4.44e-07 | NA | 1.72e-04 |
| 3. B | Q7ZUV2 | Katanin p80 WD40 repeat-containing subunit B1 | 1.58e-10 | NA | 4.30e-17 |
| 3. B | B7PS00 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.39e-23 |
| 3. B | B4QFZ8 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 0.00e+00 | NA | 9.16e-11 |
| 3. B | A7TLU2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 0.00e+00 | NA | 5.47e-06 |
| 3. B | B4JB43 | Eukaryotic translation initiation factor 3 subunit I | 0.00e+00 | NA | 2.98e-06 |
| 3. B | Q93794 | F-box/WD repeat-containing protein sel-10 | 2.11e-06 | NA | 1.19e-20 |
| 3. B | Q05BV3 | Echinoderm microtubule-associated protein-like 5 | 2.87e-04 | NA | 7.67e-08 |
| 3. B | Q8NAA4 | Protein Atg16l2 | 1.20e-08 | NA | 5.44e-08 |
| 3. B | Q5AEF2 | Protein transport protein SEC13 | 7.77e-16 | NA | 0.035 |
| 3. B | Q4P2E9 | Ribosome biogenesis protein ERB1 | 3.41e-06 | NA | 0.022 |
| 3. B | Q920J3 | Coronin-6 | 2.11e-06 | NA | 4.57e-04 |
| 3. B | B5X9P2 | Probable cytosolic iron-sulfur protein assembly protein ciao1-A | 0.00e+00 | NA | 5.19e-08 |
| 3. B | O15736 | Protein tipD | 3.63e-08 | NA | 3.30e-14 |
| 3. B | Q6C953 | Pre-rRNA-processing protein IPI3 | 1.91e-09 | NA | 0.045 |
| 3. B | P73595 | Uncharacterized WD repeat-containing protein slr1410 | 4.92e-12 | NA | 1.25e-16 |
| 3. B | Q9JJA4 | Ribosome biogenesis protein WDR12 | 1.23e-09 | NA | 1.71e-08 |
| 3. B | Q4RJN5 | Lissencephaly-1 homolog | 0.00e+00 | NA | 4.00e-18 |
| 3. B | Q6AY87 | THO complex subunit 6 homolog | 1.01e-14 | NA | 0.002 |
| 3. B | A1CH75 | Ribosome biogenesis protein ytm1 | 1.54e-09 | NA | 7.07e-04 |