Summary

Q6ZQT7

Homolog: A2A5X4.
Function: Keratin-associated protein 29-1.

Statistics

Total GO Annotation: 52
Unique PROST Go: 52
Unique BLAST Go: 0

Total Homologs: 87
Unique PROST Homologs: 84
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was A2A5X4 (Keratin-associated protein 29-1) with a FATCAT P-Value: 0.0111 and RMSD of 5.50 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein Q6ZQT7 colored as red in alignment, homolog A2A5X4 colored as blue. Query protein Q6ZQT7 is also shown in right top, homolog A2A5X4 showed in right bottom. They are colored based on secondary structures. 

  Q6ZQT7 ---------------------MQPGGTAG-----PEEAPMR--------EAEAGPPQVGL-SRP-----TCSLPASSP--G-PALPPG-----CVSRPDS 52
  A2A5X4 MADSCCPENPTAVPTVPTISTCSNGGSIRNAIRLPSSCRCRTWQLVTHQENRQGPDSVPVSSEPVSCPSTC-FPE-TPCVGFICQPIGSHMACCAS--DT 96

  Q6ZQT7 GLPTTSLDSAPAQLPAALVDPQLPEAKLPRPSSGL-TVASPGSAPALRWHLQAPNGLRSV---GSSRPSLGLPAASAGPK--RPEVGLSRPSS-----GL 141
  A2A5X4 G-------GSPH--PAASCQPSC----L--ESAGCHTMCYENSS----CHQSSGQG--SACTSGSCQTACG-PSASCDDRSCQP--SCSEATSYAETPCL 172

  Q6ZQT7 PAAF-AG---PS-------RPQVGLELG-LEEQQVSLSGP-SSILSAASPGAKLPRVSLS-RP-------SSS-CLPLASFSP-AQPSSWLSAAFPGPAF 218
  A2A5X4 PAGCEAGSCQPTSCQGGSHQPTRG-E-GQL-CQSVYYQ-PICYVLKSCQ---STPCMSVSCQPLTCMCFCSQTCCVP-----PTCQP---LHCQ-TTPII 256

  Q6ZQT7 DF-WRPL-QAQN---LPS----------SG-PLQARPRPRPHSGLSTPS-------------------------------------- 251
  A2A5X4 SFICQPVAPCQSPCFLKSSSKSASCVMISGQQICGGPTP-DQSGCQSPSCHPPCCVTGLGQPSSSGPGCCPPTSPDICQAGTYGPTS 342

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0045735 nutrient reservoir activity
2. P GO:0018149 peptide cross-linking
2. P GO:0043029 T cell homeostasis
2. P GO:1900740 positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
2. P GO:0090729 toxin activity
2. P GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0030216 keratinocyte differentiation
2. P GO:0030246 carbohydrate binding
2. P GO:0045095 keratin filament
2. P GO:0009411 response to UV
2. P GO:0010921 regulation of phosphatase activity
2. P GO:0033172 gas vesicle shell
2. P GO:0042633 hair cycle
2. P GO:0031424 keratinization
2. P GO:0004867 serine-type endopeptidase inhibitor activity
2. P GO:0048147 negative regulation of fibroblast proliferation
2. P GO:0005184 neuropeptide hormone activity
2. P GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
2. P GO:0010165 response to X-ray
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:1902110 positive regulation of mitochondrial membrane permeability involved in apoptotic process
2. P GO:0016835 carbon-oxygen lyase activity
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0010917 negative regulation of mitochondrial membrane potential
2. P GO:0044099 polar tube
2. P GO:0017001 antibiotic catabolic process
2. P GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
2. P GO:0040014 regulation of multicellular organism growth
2. P GO:0005829 cytosol
2. P GO:0005576 extracellular region
2. P GO:0001836 release of cytochrome c from mitochondria
2. P GO:0005179 hormone activity
2. P GO:0032355 response to estradiol
2. P GO:0010224 response to UV-B
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0005537 mannose binding
2. P GO:0005882 intermediate filament
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0008544 epidermis development
2. P GO:0032539 negative regulation of host-seeking behavior
2. P GO:0032095 regulation of response to food
2. P GO:0046870 cadmium ion binding
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:0007568 aging
2. P GO:0050819 negative regulation of coagulation
2. P GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
2. P GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0031412 gas vesicle organization
2. P GO:0009877 nodulation
2. P GO:0004865 protein serine/threonine phosphatase inhibitor activity
2. P GO:0003785 actin monomer binding
2. P GO:0001533 cornified envelope

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZQT7 Putative uncharacterized protein FLJ44672 0 6.01e-160 3.55e-165
2. P Q4W7G7 Keratin-associated protein 13-4 5.54e-02 2.68e-04 NA
2. P P05560 Ovomucoid 9.14e-01 3.46e-02 NA
2. P Q9PR55 Uncharacterized protein UU089.1 9.55e-01 4.88e-02 NA
2. P Q9CQK8 Small proline-rich protein 2A1 7.45e-01 8.27e-05 NA
2. P Q8BGJ3 Uncharacterized protein C17orf100 homolog 9.37e-01 2.35e-05 NA
2. P P60411 Keratin-associated protein 10-9 1.92e-01 1.03e-04 NA
2. P C0HL89 Lectin SfL-1 9.91e-01 8.21e-03 NA
2. P Q8WSW3 Cadmium metallothionein 9.80e-01 3.98e-09 NA
2. P P24710 Involucrin 5.50e-01 1.27e-02 NA
2. P P08688 Albumin-2 9.97e-01 3.06e-04 NA
2. P Q3TXZ1 Zinc finger protein 575 8.73e-01 3.69e-04 NA
2. P A8MXZ3 Keratin-associated protein 9-1 9.90e-01 9.37e-04 NA
2. P A0SIF1 Short neuropeptide F 7.75e-01 4.97e-02 NA
2. P P05225 Preprocaerulein clone PXC202 (Fragment) 7.36e-01 6.06e-03 NA
2. P P08685 Uncharacterized 8.4 kDa protein NA 4.07e-02 NA
2. P Q4W7G8 Keratin-associated protein 13-4 1.51e-01 2.68e-04 NA
2. P A0A023W157 U-scoloptoxin(08)-Er5b 9.97e-01 6.00e-03 NA
2. P P06472 C-hordein (Fragment) 1.49e-01 7.57e-03 NA
2. P O76942 Polar tube protein 1 1.49e-01 1.84e-02 NA
2. P Q4W7H0 Keratin-associated protein 13-4 3.87e-01 7.48e-04 NA
2. P Q9WU12 SNRPN upstream reading frame protein 8.52e-01 4.51e-03 NA
2. P Q5EB30 Outer dense fiber protein 3 8.30e-01 4.70e-02 NA
2. P P39564 Uncharacterized protein YAR068W 8.18e-01 2.17e-05 NA
2. P O96790 Serine protease inhibitor dipetalogastin (Fragment) 9.93e-01 1.34e-02 NA
2. P A0A023W0V9 U-scoloptoxin-Er5c 9.96e-01 1.46e-02 NA
2. P D4AEP7 Albumin-2 9.97e-01 4.79e-03 NA
2. P P60369 Keratin-associated protein 10-3 7.04e-01 6.58e-05 NA
2. P P16531 Seminal vesicle protein SVP-2 (Fragment) 2.08e-01 4.27e-02 NA
2. P P24399 Zinc finger protein 239 9.94e-01 3.14e-02 NA
2. P P17941 Involucrin 9.33e-01 4.35e-02 NA
2. P A0A023W0B6 U-scoloptoxin(08)-Er5a 9.95e-01 1.42e-02 NA
2. P Q08AN1 Zinc finger protein 616 9.93e-01 4.03e-02 NA
2. P Q4W7G9 Keratin-associated protein 13-4 1.01e-01 2.68e-04 NA
2. P A2A5X4 Keratin-associated protein 29-1 1.11e-02 5.96e-08 NA
2. P O31794 Uncharacterized protein YmaF 8.77e-01 8.63e-03 NA
2. P Q3SY46 Keratin-associated protein 13-3 7.92e-02 2.45e-03 NA
2. P Q9JM54 Phorbol-12-myristate-13-acetate-induced protein 1 9.46e-01 2.63e-03 NA
2. P P05815 Zein-alpha B49 (Fragment) 9.91e-01 5.32e-06 NA
2. P P37801 Calponin homolog OV9M 9.74e-01 2.02e-05 NA
2. P P18726 Gastrula zinc finger protein XlCGF51.1A (Fragment) 9.80e-01 4.65e-03 NA
2. P P14591 Involucrin 7.22e-01 3.46e-02 NA
2. P O70554 Small proline-rich protein 2B 3.79e-02 3.45e-04 NA
2. P Q3LI77 Keratin-associated protein 13-4 6.48e-02 6.57e-03 NA
2. P Q8NC38 Putative uncharacterized protein ZNF436-AS1 3.16e-01 2.40e-04 NA
2. P P04672 Nodulin-44 5.92e-01 2.39e-02 NA
2. P Q9D2F5 O(6)-methylguanine-induced apoptosis 2 5.80e-01 4.88e-02 NA
2. P P60014 Keratin-associated protein 10-10 2.69e-01 1.05e-03 NA
2. P Q27084 Tachylectin-2 9.57e-01 4.35e-05 NA
2. P Q5UQY4 Putative ankyrin repeat protein R886 (Fragment) NA 1.46e-03 NA
2. P Q6ZTB9 Putative zinc finger protein 833 9.94e-01 1.50e-04 NA
2. P A0A023VZR2 U-scoloptoxin(08)-Cw1a 8.89e-01 2.05e-02 NA
2. P O96001 Protein phosphatase 1 regulatory subunit 17 5.94e-01 1.14e-02 NA
2. P P60412 Keratin-associated protein 10-11 1.39e-01 3.08e-06 NA
2. P P24711 Involucrin 2.36e-01 1.93e-02 NA
2. P Q8K0G7 Proline, histidine and glycine-rich protein 1 9.35e-01 1.07e-05 NA
2. P Q84WP3 B3 domain-containing protein REM17 9.63e-01 3.24e-03 NA
2. P Q9BYR0 Keratin-associated protein 4-7 9.58e-01 3.33e-02 NA
2. P O17389 Thymosin beta 4.83e-01 4.42e-07 NA
2. P P86784 Gigasin-1 (Fragment) 3.98e-01 2.89e-03 NA
2. P Q9Z2E4 Protein phosphatase 1 regulatory subunit 17 4.77e-01 1.10e-02 NA
2. P P27058 Systemin 7.47e-02 1.99e-03 NA
2. P R9RL27 Mannose-specific lectin CEA 9.50e-01 4.33e-03 NA
2. P Q9KZX7 Virginiamycin B lyase 9.63e-01 4.23e-02 NA
2. P P60410 Keratin-associated protein 10-8 1.13e-01 2.66e-03 NA
2. P P29087 Uncharacterized protein in sor 5'region 9.98e-01 1.95e-03 NA
2. P Q28658 Small proline-rich protein 3 6.90e-01 1.83e-03 NA
2. P Q4KLY8 O(6)-methylguanine-induced apoptosis 2 4.93e-01 4.74e-02 NA
2. P P60368 Keratin-associated protein 10-2 7.92e-01 1.87e-03 NA
2. P Q8N2A0 Putative uncharacterized protein encoded by LINC00269 4.67e-01 8.84e-07 NA
2. P Q8YUS9 Gas vesicle protein C NA 1.51e-02 NA
2. P P09444 Late embryogenesis abundant protein D-34 9.58e-01 9.26e-03 NA
2. P Q9GQV7 Head peptide 9.09e-01 1.42e-02 NA
2. P O13534 Putative uncharacterized protein YHR214W-A 4.55e-01 8.30e-06 NA
2. P Q8T0W2 Pacifastin-like protease inhibitor cvp4 8.15e-01 8.54e-03 NA
2. P Q4W7H1 Keratin-associated protein 13-4 9.25e-02 7.48e-04 NA
2. P P82151 Lectin L6 9.94e-01 4.46e-03 NA
2. P Q4KL71 Small proline-rich protein 2A3 8.40e-01 8.27e-05 NA
2. P Q5UPI7 Uncharacterized protein L111 NA 1.04e-02 NA
2. P Q9BYR2 Keratin-associated protein 4-5 9.88e-01 2.28e-02 NA
2. P O24006 Antimicrobial peptides 9.68e-01 1.65e-02 NA
2. P C0HL90 Lectin SfL-2 9.82e-01 4.27e-02 NA
2. P P01068 Bromelain inhibitor 9.77e-01 1.87e-03 NA
2. P Q05B44 Keratin-associated protein 12-2 1.42e-01 1.68e-02 NA
2. P Q9BYQ6 Keratin-associated protein 4-11 9.84e-01 3.52e-02 NA
3. B Q75L30 Putative uncharacterized protein FLJ92257 2.76e-01 NA 1.24e-17
3. B Q6ZRM9 Putative uncharacterized protein FLJ46235 3.77e-02 NA 0.002