Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
A2A5X4
(Keratin-associated protein 29-1) with a FATCAT P-Value: 0.0111 and RMSD of 5.50 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein Q6ZQT7 colored as red in alignment, homolog A2A5X4 colored as blue.
Query protein Q6ZQT7 is also shown in right top, homolog A2A5X4 showed in right bottom. They are colored based on secondary structures.
Q6ZQT7 ---------------------MQPGGTAG-----PEEAPMR--------EAEAGPPQVGL-SRP-----TCSLPASSP--G-PALPPG-----CVSRPDS 52 A2A5X4 MADSCCPENPTAVPTVPTISTCSNGGSIRNAIRLPSSCRCRTWQLVTHQENRQGPDSVPVSSEPVSCPSTC-FPE-TPCVGFICQPIGSHMACCAS--DT 96 Q6ZQT7 GLPTTSLDSAPAQLPAALVDPQLPEAKLPRPSSGL-TVASPGSAPALRWHLQAPNGLRSV---GSSRPSLGLPAASAGPK--RPEVGLSRPSS-----GL 141 A2A5X4 G-------GSPH--PAASCQPSC----L--ESAGCHTMCYENSS----CHQSSGQG--SACTSGSCQTACG-PSASCDDRSCQP--SCSEATSYAETPCL 172 Q6ZQT7 PAAF-AG---PS-------RPQVGLELG-LEEQQVSLSGP-SSILSAASPGAKLPRVSLS-RP-------SSS-CLPLASFSP-AQPSSWLSAAFPGPAF 218 A2A5X4 PAGCEAGSCQPTSCQGGSHQPTRG-E-GQL-CQSVYYQ-PICYVLKSCQ---STPCMSVSCQPLTCMCFCSQTCCVP-----PTCQP---LHCQ-TTPII 256 Q6ZQT7 DF-WRPL-QAQN---LPS----------SG-PLQARPRPRPHSGLSTPS-------------------------------------- 251 A2A5X4 SFICQPVAPCQSPCFLKSSSKSASCVMISGQQICGGPTP-DQSGCQSPSCHPPCCVTGLGQPSSSGPGCCPPTSPDICQAGTYGPTS 342
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0045735 | nutrient reservoir activity |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0043029 | T cell homeostasis |
| 2. P | GO:1900740 | positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway |
| 2. P | GO:0090729 | toxin activity |
| 2. P | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0030246 | carbohydrate binding |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0009411 | response to UV |
| 2. P | GO:0010921 | regulation of phosphatase activity |
| 2. P | GO:0033172 | gas vesicle shell |
| 2. P | GO:0042633 | hair cycle |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0004867 | serine-type endopeptidase inhibitor activity |
| 2. P | GO:0048147 | negative regulation of fibroblast proliferation |
| 2. P | GO:0005184 | neuropeptide hormone activity |
| 2. P | GO:0008630 | intrinsic apoptotic signaling pathway in response to DNA damage |
| 2. P | GO:0010165 | response to X-ray |
| 2. P | GO:0043065 | positive regulation of apoptotic process |
| 2. P | GO:1902110 | positive regulation of mitochondrial membrane permeability involved in apoptotic process |
| 2. P | GO:0016835 | carbon-oxygen lyase activity |
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:0010917 | negative regulation of mitochondrial membrane potential |
| 2. P | GO:0044099 | polar tube |
| 2. P | GO:0017001 | antibiotic catabolic process |
| 2. P | GO:0070059 | intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress |
| 2. P | GO:0040014 | regulation of multicellular organism growth |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0001836 | release of cytochrome c from mitochondria |
| 2. P | GO:0005179 | hormone activity |
| 2. P | GO:0032355 | response to estradiol |
| 2. P | GO:0010224 | response to UV-B |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:0005537 | mannose binding |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0043525 | positive regulation of neuron apoptotic process |
| 2. P | GO:0008544 | epidermis development |
| 2. P | GO:0032539 | negative regulation of host-seeking behavior |
| 2. P | GO:0032095 | regulation of response to food |
| 2. P | GO:0046870 | cadmium ion binding |
| 2. P | GO:0019212 | phosphatase inhibitor activity |
| 2. P | GO:0007568 | aging |
| 2. P | GO:0050819 | negative regulation of coagulation |
| 2. P | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0031412 | gas vesicle organization |
| 2. P | GO:0009877 | nodulation |
| 2. P | GO:0004865 | protein serine/threonine phosphatase inhibitor activity |
| 2. P | GO:0003785 | actin monomer binding |
| 2. P | GO:0001533 | cornified envelope |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZQT7 | Putative uncharacterized protein FLJ44672 | 0 | 6.01e-160 | 3.55e-165 |
| 2. P | Q4W7G7 | Keratin-associated protein 13-4 | 5.54e-02 | 2.68e-04 | NA |
| 2. P | P05560 | Ovomucoid | 9.14e-01 | 3.46e-02 | NA |
| 2. P | Q9PR55 | Uncharacterized protein UU089.1 | 9.55e-01 | 4.88e-02 | NA |
| 2. P | Q9CQK8 | Small proline-rich protein 2A1 | 7.45e-01 | 8.27e-05 | NA |
| 2. P | Q8BGJ3 | Uncharacterized protein C17orf100 homolog | 9.37e-01 | 2.35e-05 | NA |
| 2. P | P60411 | Keratin-associated protein 10-9 | 1.92e-01 | 1.03e-04 | NA |
| 2. P | C0HL89 | Lectin SfL-1 | 9.91e-01 | 8.21e-03 | NA |
| 2. P | Q8WSW3 | Cadmium metallothionein | 9.80e-01 | 3.98e-09 | NA |
| 2. P | P24710 | Involucrin | 5.50e-01 | 1.27e-02 | NA |
| 2. P | P08688 | Albumin-2 | 9.97e-01 | 3.06e-04 | NA |
| 2. P | Q3TXZ1 | Zinc finger protein 575 | 8.73e-01 | 3.69e-04 | NA |
| 2. P | A8MXZ3 | Keratin-associated protein 9-1 | 9.90e-01 | 9.37e-04 | NA |
| 2. P | A0SIF1 | Short neuropeptide F | 7.75e-01 | 4.97e-02 | NA |
| 2. P | P05225 | Preprocaerulein clone PXC202 (Fragment) | 7.36e-01 | 6.06e-03 | NA |
| 2. P | P08685 | Uncharacterized 8.4 kDa protein | NA | 4.07e-02 | NA |
| 2. P | Q4W7G8 | Keratin-associated protein 13-4 | 1.51e-01 | 2.68e-04 | NA |
| 2. P | A0A023W157 | U-scoloptoxin(08)-Er5b | 9.97e-01 | 6.00e-03 | NA |
| 2. P | P06472 | C-hordein (Fragment) | 1.49e-01 | 7.57e-03 | NA |
| 2. P | O76942 | Polar tube protein 1 | 1.49e-01 | 1.84e-02 | NA |
| 2. P | Q4W7H0 | Keratin-associated protein 13-4 | 3.87e-01 | 7.48e-04 | NA |
| 2. P | Q9WU12 | SNRPN upstream reading frame protein | 8.52e-01 | 4.51e-03 | NA |
| 2. P | Q5EB30 | Outer dense fiber protein 3 | 8.30e-01 | 4.70e-02 | NA |
| 2. P | P39564 | Uncharacterized protein YAR068W | 8.18e-01 | 2.17e-05 | NA |
| 2. P | O96790 | Serine protease inhibitor dipetalogastin (Fragment) | 9.93e-01 | 1.34e-02 | NA |
| 2. P | A0A023W0V9 | U-scoloptoxin-Er5c | 9.96e-01 | 1.46e-02 | NA |
| 2. P | D4AEP7 | Albumin-2 | 9.97e-01 | 4.79e-03 | NA |
| 2. P | P60369 | Keratin-associated protein 10-3 | 7.04e-01 | 6.58e-05 | NA |
| 2. P | P16531 | Seminal vesicle protein SVP-2 (Fragment) | 2.08e-01 | 4.27e-02 | NA |
| 2. P | P24399 | Zinc finger protein 239 | 9.94e-01 | 3.14e-02 | NA |
| 2. P | P17941 | Involucrin | 9.33e-01 | 4.35e-02 | NA |
| 2. P | A0A023W0B6 | U-scoloptoxin(08)-Er5a | 9.95e-01 | 1.42e-02 | NA |
| 2. P | Q08AN1 | Zinc finger protein 616 | 9.93e-01 | 4.03e-02 | NA |
| 2. P | Q4W7G9 | Keratin-associated protein 13-4 | 1.01e-01 | 2.68e-04 | NA |
| 2. P | A2A5X4 | Keratin-associated protein 29-1 | 1.11e-02 | 5.96e-08 | NA |
| 2. P | O31794 | Uncharacterized protein YmaF | 8.77e-01 | 8.63e-03 | NA |
| 2. P | Q3SY46 | Keratin-associated protein 13-3 | 7.92e-02 | 2.45e-03 | NA |
| 2. P | Q9JM54 | Phorbol-12-myristate-13-acetate-induced protein 1 | 9.46e-01 | 2.63e-03 | NA |
| 2. P | P05815 | Zein-alpha B49 (Fragment) | 9.91e-01 | 5.32e-06 | NA |
| 2. P | P37801 | Calponin homolog OV9M | 9.74e-01 | 2.02e-05 | NA |
| 2. P | P18726 | Gastrula zinc finger protein XlCGF51.1A (Fragment) | 9.80e-01 | 4.65e-03 | NA |
| 2. P | P14591 | Involucrin | 7.22e-01 | 3.46e-02 | NA |
| 2. P | O70554 | Small proline-rich protein 2B | 3.79e-02 | 3.45e-04 | NA |
| 2. P | Q3LI77 | Keratin-associated protein 13-4 | 6.48e-02 | 6.57e-03 | NA |
| 2. P | Q8NC38 | Putative uncharacterized protein ZNF436-AS1 | 3.16e-01 | 2.40e-04 | NA |
| 2. P | P04672 | Nodulin-44 | 5.92e-01 | 2.39e-02 | NA |
| 2. P | Q9D2F5 | O(6)-methylguanine-induced apoptosis 2 | 5.80e-01 | 4.88e-02 | NA |
| 2. P | P60014 | Keratin-associated protein 10-10 | 2.69e-01 | 1.05e-03 | NA |
| 2. P | Q27084 | Tachylectin-2 | 9.57e-01 | 4.35e-05 | NA |
| 2. P | Q5UQY4 | Putative ankyrin repeat protein R886 (Fragment) | NA | 1.46e-03 | NA |
| 2. P | Q6ZTB9 | Putative zinc finger protein 833 | 9.94e-01 | 1.50e-04 | NA |
| 2. P | A0A023VZR2 | U-scoloptoxin(08)-Cw1a | 8.89e-01 | 2.05e-02 | NA |
| 2. P | O96001 | Protein phosphatase 1 regulatory subunit 17 | 5.94e-01 | 1.14e-02 | NA |
| 2. P | P60412 | Keratin-associated protein 10-11 | 1.39e-01 | 3.08e-06 | NA |
| 2. P | P24711 | Involucrin | 2.36e-01 | 1.93e-02 | NA |
| 2. P | Q8K0G7 | Proline, histidine and glycine-rich protein 1 | 9.35e-01 | 1.07e-05 | NA |
| 2. P | Q84WP3 | B3 domain-containing protein REM17 | 9.63e-01 | 3.24e-03 | NA |
| 2. P | Q9BYR0 | Keratin-associated protein 4-7 | 9.58e-01 | 3.33e-02 | NA |
| 2. P | O17389 | Thymosin beta | 4.83e-01 | 4.42e-07 | NA |
| 2. P | P86784 | Gigasin-1 (Fragment) | 3.98e-01 | 2.89e-03 | NA |
| 2. P | Q9Z2E4 | Protein phosphatase 1 regulatory subunit 17 | 4.77e-01 | 1.10e-02 | NA |
| 2. P | P27058 | Systemin | 7.47e-02 | 1.99e-03 | NA |
| 2. P | R9RL27 | Mannose-specific lectin CEA | 9.50e-01 | 4.33e-03 | NA |
| 2. P | Q9KZX7 | Virginiamycin B lyase | 9.63e-01 | 4.23e-02 | NA |
| 2. P | P60410 | Keratin-associated protein 10-8 | 1.13e-01 | 2.66e-03 | NA |
| 2. P | P29087 | Uncharacterized protein in sor 5'region | 9.98e-01 | 1.95e-03 | NA |
| 2. P | Q28658 | Small proline-rich protein 3 | 6.90e-01 | 1.83e-03 | NA |
| 2. P | Q4KLY8 | O(6)-methylguanine-induced apoptosis 2 | 4.93e-01 | 4.74e-02 | NA |
| 2. P | P60368 | Keratin-associated protein 10-2 | 7.92e-01 | 1.87e-03 | NA |
| 2. P | Q8N2A0 | Putative uncharacterized protein encoded by LINC00269 | 4.67e-01 | 8.84e-07 | NA |
| 2. P | Q8YUS9 | Gas vesicle protein C | NA | 1.51e-02 | NA |
| 2. P | P09444 | Late embryogenesis abundant protein D-34 | 9.58e-01 | 9.26e-03 | NA |
| 2. P | Q9GQV7 | Head peptide | 9.09e-01 | 1.42e-02 | NA |
| 2. P | O13534 | Putative uncharacterized protein YHR214W-A | 4.55e-01 | 8.30e-06 | NA |
| 2. P | Q8T0W2 | Pacifastin-like protease inhibitor cvp4 | 8.15e-01 | 8.54e-03 | NA |
| 2. P | Q4W7H1 | Keratin-associated protein 13-4 | 9.25e-02 | 7.48e-04 | NA |
| 2. P | P82151 | Lectin L6 | 9.94e-01 | 4.46e-03 | NA |
| 2. P | Q4KL71 | Small proline-rich protein 2A3 | 8.40e-01 | 8.27e-05 | NA |
| 2. P | Q5UPI7 | Uncharacterized protein L111 | NA | 1.04e-02 | NA |
| 2. P | Q9BYR2 | Keratin-associated protein 4-5 | 9.88e-01 | 2.28e-02 | NA |
| 2. P | O24006 | Antimicrobial peptides | 9.68e-01 | 1.65e-02 | NA |
| 2. P | C0HL90 | Lectin SfL-2 | 9.82e-01 | 4.27e-02 | NA |
| 2. P | P01068 | Bromelain inhibitor | 9.77e-01 | 1.87e-03 | NA |
| 2. P | Q05B44 | Keratin-associated protein 12-2 | 1.42e-01 | 1.68e-02 | NA |
| 2. P | Q9BYQ6 | Keratin-associated protein 4-11 | 9.84e-01 | 3.52e-02 | NA |
| 3. B | Q75L30 | Putative uncharacterized protein FLJ92257 | 2.76e-01 | NA | 1.24e-17 |
| 3. B | Q6ZRM9 | Putative uncharacterized protein FLJ46235 | 3.77e-02 | NA | 0.002 |