Results | PROST

Summary

Q6ZQY2

Homolog: A0JPI9.
Function: Leucine-rich repeat-containing protein 74A.

Statistics

Total GO Annotation: 481
Unique PROST Go: 200
Unique BLAST Go: 251

Total Homologs: 399
Unique PROST Homologs: 259
Unique BLAST Homologs: 119

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0JPI9 (Leucine-rich repeat-containing protein 74A) with a FATCAT P-Value: 0.0 and RMSD of 1.83 angstrom. The sequence alignment identity is 31.4%.
Structural alignment shown in left. Query protein Q6ZQY2 colored as red in alignment, homolog A0JPI9 colored as blue. Query protein Q6ZQY2 is also shown in right top, homolog A0JPI9 showed in right bottom. They are colored based on secondary structures.

  Q6ZQY2 MRGSCERSGEDE------EQKE--EAMVA---------CGRLSGVPEAE-QGPEANWDS--DLETEGTD---GLGELVRDTLYLRSCRAHSVVPISCFLR 77
  A0JPI9 -------MDDDDIEPLEYETKDETEAALAPQSSEDTLYC-EAEAAPSVEKEKP-TREDSETDLEIEDTEKFFSIGQ--KE-LYLEACKLVGVVPVSYFIR 88

  Q6ZQY2 QGSAQELNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDVDLSENQLGVAGAQALCAALTVNQ-AMRKMQLSGNGLE 176
  A0JPI9 NMEESCMNLNHHGLGPMGIKAIAITLVSNTTVLKLELEDNSIQEEGILSLMEMLHENYYLQELNVSDNNLGLEGARIISDFLQENNSSLWKLKLSGNKFK 188

  Q6ZQY2 EQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGETLGPALAENTGLTELNVSWNH--LRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKAN 274
  A0JPI9 EECALLLCQALSSNYRIRSLNLSHNEFSDTAGEYLGQMLALNVGLQSLNLSWNHFNVR--GAVALCNGLRTNVTLKKLDVSMNGFGNDGALALGDTLKLN 286

  Q6ZQY2 NVLEELNMSNNRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDNPASALELLDFSDIQVNAEF----DGLAS----------SVRGI- 359
  A0JPI9 SCLVYVDVSRNGITNEGASRISKGLENNECLQVLKLFLNPVSLEGAYSLILAIKRNPKSRMEDLDISNVLVSEQFVKVLDGVCAIHPQLDVVYKGLQGLS 386

  Q6ZQY2 ------L---P-ELCIK--TGACR---VEYKKEL-------LPV--FRSAL--PASVPK----------------------------------- 392
  A0JPI9 TKKTVSLETNPIKL-IQNYTDQNKISVVEFFKSLNPSGLMTMPVGDFRKAIIQQTNIPINRYQARELIKKLEEKNGMVNFSGFKSLKVTAAGQL 479

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0006954	inflammatory response
1. PB	GO:0036336	dendritic cell migration
1. PB	GO:0032760	positive regulation of tumor necrosis factor production
1. PB	GO:0050729	positive regulation of inflammatory response
1. PB	GO:0032311	angiogenin-PRI complex
1. PB	GO:0043330	response to exogenous dsRNA
1. PB	GO:2000321	positive regulation of T-helper 17 cell differentiation
1. PB	GO:0009524	phragmoplast
1. PB	GO:0002237	response to molecule of bacterial origin
1. PB	GO:0007249	I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0071345	cellular response to cytokine stimulus
1. PB	GO:0045765	regulation of angiogenesis
1. PB	GO:0045471	response to ethanol
1. PB	GO:0032495	response to muramyl dipeptide
1. PB	GO:0008428	ribonuclease inhibitor activity
1. PB	GO:0032729	positive regulation of interferon-gamma production
1. PB	GO:0045087	innate immune response
1. PB	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
1. PB	GO:0004864	protein phosphatase inhibitor activity
1. PB	GO:0005856	cytoskeleton
1. PB	GO:0032757	positive regulation of interleukin-8 production
1. PB	GO:0035556	intracellular signal transduction
1. PB	GO:0045944	positive regulation of transcription by RNA polymerase II
1. PB	GO:0071222	cellular response to lipopolysaccharide
1. PB	GO:0032088	negative regulation of NF-kappaB transcription factor activity
1. PB	GO:0014070	response to organic cyclic compound
1. PB	GO:0007165	signal transduction
1. PB	GO:0030017	sarcomere
1. PB	GO:1901224	positive regulation of NIK/NF-kappaB signaling
1. PB	GO:0005654	nucleoplasm
2. P	GO:0021540	corpus callosum morphogenesis
2. P	GO:0010508	positive regulation of autophagy
2. P	GO:0021766	hippocampus development
2. P	GO:0010555	response to mannitol
2. P	GO:0090141	positive regulation of mitochondrial fission
2. P	GO:1901970	positive regulation of mitotic sister chromatid separation
2. P	GO:0070848	response to growth factor
2. P	GO:0042994	cytoplasmic sequestering of transcription factor
2. P	GO:0005589	collagen type VI trimer
2. P	GO:0055046	microgametogenesis
2. P	GO:0032496	response to lipopolysaccharide
2. P	GO:0043202	lysosomal lumen
2. P	GO:0005874	microtubule
2. P	GO:0051216	cartilage development
2. P	GO:0006404	RNA import into nucleus
2. P	GO:0034612	response to tumor necrosis factor
2. P	GO:0032491	detection of molecule of fungal origin
2. P	GO:0010375	stomatal complex patterning
2. P	GO:0035882	defecation rhythm
2. P	GO:0005201	extracellular matrix structural constituent
2. P	GO:0032914	positive regulation of transforming growth factor beta1 production
2. P	GO:0005796	Golgi lumen
2. P	GO:0001847	opsonin receptor activity
2. P	GO:0002718	regulation of cytokine production involved in immune response
2. P	GO:0070171	negative regulation of tooth mineralization
2. P	GO:0045121	membrane raft
2. P	GO:0006511	ubiquitin-dependent protein catabolic process
2. P	GO:0061608	nuclear import signal receptor activity
2. P	GO:0035307	positive regulation of protein dephosphorylation
2. P	GO:2000746	regulation of defecation rhythm
2. P	GO:0051059	NF-kappaB binding
2. P	GO:0016567	protein ubiquitination
2. P	GO:0031578	mitotic spindle orientation checkpoint signaling
2. P	GO:0010888	negative regulation of lipid storage
2. P	GO:0030021	extracellular matrix structural constituent conferring compression resistance
2. P	GO:0042567	insulin-like growth factor ternary complex
2. P	GO:0031430	M band
2. P	GO:0071562	nucleus-vacuole junction assembly
2. P	GO:0032026	response to magnesium ion
2. P	GO:0010376	stomatal complex formation
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0007021	tubulin complex assembly
2. P	GO:0005576	extracellular region
2. P	GO:0072542	protein phosphatase activator activity
2. P	GO:0010468	regulation of gene expression
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0008543	fibroblast growth factor receptor signaling pathway
2. P	GO:0042127	regulation of cell population proliferation
2. P	GO:0070891	lipoteichoic acid binding
2. P	GO:2001042	negative regulation of septum digestion after cytokinesis
2. P	GO:0005615	extracellular space
2. P	GO:0050840	extracellular matrix binding
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:0009897	external side of plasma membrane
2. P	GO:0010745	negative regulation of macrophage derived foam cell differentiation
2. P	GO:0009612	response to mechanical stimulus
2. P	GO:0004722	protein serine/threonine phosphatase activity
2. P	GO:0014005	microglia development
2. P	GO:0071378	cellular response to growth hormone stimulus
2. P	GO:0016239	positive regulation of macroautophagy
2. P	GO:0035583	sequestering of TGFbeta in extracellular matrix
2. P	GO:0033344	cholesterol efflux
2. P	GO:0055013	cardiac muscle cell development
2. P	GO:1905909	regulation of dauer entry
2. P	GO:1904027	negative regulation of collagen fibril organization
2. P	GO:0010977	negative regulation of neuron projection development
2. P	GO:0070062	extracellular exosome
2. P	GO:0036157	outer dynein arm
2. P	GO:0042995	cell projection
2. P	GO:0099575	regulation of protein catabolic process at presynapse, modulating synaptic transmission
2. P	GO:0001822	kidney development
2. P	GO:0050431	transforming growth factor beta binding
2. P	GO:0019005	SCF ubiquitin ligase complex
2. P	GO:0008203	cholesterol metabolic process
2. P	GO:0021670	lateral ventricle development
2. P	GO:0005520	insulin-like growth factor binding
2. P	GO:0010073	meristem maintenance
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0042635	positive regulation of hair cycle
2. P	GO:0035994	response to muscle stretch
2. P	GO:0061975	articular cartilage development
2. P	GO:0044830	modulation by host of viral RNA genome replication
2. P	GO:0071727	cellular response to triacyl bacterial lipopeptide
2. P	GO:0042383	sarcolemma
2. P	GO:0071365	cellular response to auxin stimulus
2. P	GO:0061303	cornea development in camera-type eye
2. P	GO:0071219	cellular response to molecule of bacterial origin
2. P	GO:0060348	bone development
2. P	GO:0061073	ciliary body morphogenesis
2. P	GO:1905034	regulation of antifungal innate immune response
2. P	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
2. P	GO:0033085	negative regulation of T cell differentiation in thymus
2. P	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
2. P	GO:0043624
2. P	GO:0070245	positive regulation of thymocyte apoptotic process
2. P	GO:0042564	NLS-dependent protein nuclear import complex
2. P	GO:0032911	negative regulation of transforming growth factor beta1 production
2. P	GO:1990727	tubulin folding cofactor complex
2. P	GO:0010596	negative regulation of endothelial cell migration
2. P	GO:0071726	cellular response to diacyl bacterial lipopeptide
2. P	GO:0045596	negative regulation of cell differentiation
2. P	GO:0009620	response to fungus
2. P	GO:0007568	aging
2. P	GO:0035914	skeletal muscle cell differentiation
2. P	GO:0030282	bone mineralization
2. P	GO:0046600	negative regulation of centriole replication
2. P	GO:0071800	podosome assembly
2. P	GO:0048145	regulation of fibroblast proliferation
2. P	GO:2000300	regulation of synaptic vesicle exocytosis
2. P	GO:0034142	toll-like receptor 4 signaling pathway
2. P	GO:0098633	collagen fibril binding
2. P	GO:0009953	dorsal/ventral pattern formation
2. P	GO:0021960	anterior commissure morphogenesis
2. P	GO:0034122	negative regulation of toll-like receptor signaling pathway
2. P	GO:0071460	cellular response to cell-matrix adhesion
2. P	GO:0030500	regulation of bone mineralization
2. P	GO:0007601	visual perception
2. P	GO:0036364	transforming growth factor beta1 activation
2. P	GO:0051901	positive regulation of mitochondrial depolarization
2. P	GO:1900155	negative regulation of bone trabecula formation
2. P	GO:0060122	inner ear receptor cell stereocilium organization
2. P	GO:0000151	ubiquitin ligase complex
2. P	GO:0044403	biological process involved in symbiotic interaction
2. P	GO:0055007	cardiac muscle cell differentiation
2. P	GO:0007023	post-chaperonin tubulin folding pathway
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0019834	phospholipase A2 inhibitor activity
2. P	GO:0043326	chemotaxis to folate
2. P	GO:0045638	negative regulation of myeloid cell differentiation
2. P	GO:1904761	negative regulation of myofibroblast differentiation
2. P	GO:0033209	tumor necrosis factor-mediated signaling pathway
2. P	GO:0008139	nuclear localization sequence binding
2. P	GO:0006898	receptor-mediated endocytosis
2. P	GO:0000086	G2/M transition of mitotic cell cycle
2. P	GO:1901332	negative regulation of lateral root development
2. P	GO:0005634	nucleus
2. P	GO:0005518	collagen binding
2. P	GO:0031012	extracellular matrix
2. P	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
2. P	GO:0032481	positive regulation of type I interferon production
2. P	GO:0043053	dauer entry
2. P	GO:0071723	lipopeptide binding
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0043010	camera-type eye development
2. P	GO:0045732	positive regulation of protein catabolic process
2. P	GO:0005539	glycosaminoglycan binding
2. P	GO:0001530	lipopolysaccharide binding
2. P	GO:0001890	placenta development
2. P	GO:0008157	protein phosphatase 1 binding
2. P	GO:0007155	cell adhesion
2. P	GO:0007253	cytoplasmic sequestering of NF-kappaB
2. P	GO:0071223	cellular response to lipoteichoic acid
2. P	GO:0014732	skeletal muscle atrophy
2. P	GO:0005199	structural constituent of cell wall
2. P	GO:0001974	blood vessel remodeling
2. P	GO:0031362	anchored component of external side of plasma membrane
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0010875	positive regulation of cholesterol efflux
2. P	GO:0030286	dynein complex
2. P	GO:1902916	positive regulation of protein polyubiquitination
2. P	GO:0045746	negative regulation of Notch signaling pathway
2. P	GO:0016019	peptidoglycan immune receptor activity
2. P	GO:0009617	response to bacterium
2. P	GO:0001662	behavioral fear response
2. P	GO:0042632	cholesterol homeostasis
2. P	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
2. P	GO:0030178	negative regulation of Wnt signaling pathway
2. P	GO:0097009	energy homeostasis
2. P	GO:0046696	lipopolysaccharide receptor complex
2. P	GO:0031344	regulation of cell projection organization
2. P	GO:0051602	response to electrical stimulus
2. P	GO:0031663	lipopolysaccharide-mediated signaling pathway
2. P	GO:0070936	protein K48-linked ubiquitination
2. P	GO:0005583	fibrillar collagen trimer
2. P	GO:0016021	integral component of membrane
2. P	GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway
2. P	GO:0046579	positive regulation of Ras protein signal transduction
2. P	GO:0051393	alpha-actinin binding
2. P	GO:0031514	motile cilium
2. P	GO:0019900	kinase binding
2. P	GO:0030513	positive regulation of BMP signaling pathway
2. P	GO:0098868	bone growth
2. P	GO:0033256	I-kappaB/NF-kappaB complex
2. P	GO:0030199	collagen fibril organization
2. P	GO:0016525	negative regulation of angiogenesis
2. P	GO:0047485	protein N-terminus binding
2. P	GO:0006606	protein import into nucleus
2. P	GO:0002240	response to molecule of oomycetes origin
2. P	GO:0007519	skeletal muscle tissue development
2. P	GO:0030133	transport vesicle
2. P	GO:0062023	collagen-containing extracellular matrix
2. P	GO:0010811	positive regulation of cell-substrate adhesion
2. P	GO:0042060	wound healing
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0007181	transforming growth factor beta receptor complex assembly
2. P	GO:0006607	NLS-bearing protein import into nucleus
2. P	GO:0000164	protein phosphatase type 1 complex
2. P	GO:0045807	positive regulation of endocytosis
2. P	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
2. P	GO:0032270	positive regulation of cellular protein metabolic process
3. B	GO:0009556	microsporogenesis
3. B	GO:0051656	establishment of organelle localization
3. B	GO:0045630	positive regulation of T-helper 2 cell differentiation
3. B	GO:0045111	intermediate filament cytoskeleton
3. B	GO:0032701	negative regulation of interleukin-18 production
3. B	GO:0044351	macropinocytosis
3. B	GO:0051639	actin filament network formation
3. B	GO:0002925	positive regulation of humoral immune response mediated by circulating immunoglobulin
3. B	GO:0009554	megasporogenesis
3. B	GO:0010942	positive regulation of cell death
3. B	GO:0043549	regulation of kinase activity
3. B	GO:2000553	positive regulation of T-helper 2 cell cytokine production
3. B	GO:0048147	negative regulation of fibroblast proliferation
3. B	GO:0031297	replication fork processing
3. B	GO:0031965	nuclear membrane
3. B	GO:0060471	cortical granule exocytosis
3. B	GO:0008180	COP9 signalosome
3. B	GO:0060340	positive regulation of type I interferon-mediated signaling pathway
3. B	GO:0032879	regulation of localization
3. B	GO:0032498	detection of muramyl dipeptide
3. B	GO:0044877	protein-containing complex binding
3. B	GO:1904417	positive regulation of xenophagy
3. B	GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0042834	peptidoglycan binding
3. B	GO:0032754	positive regulation of interleukin-5 production
3. B	GO:0106310	protein serine kinase activity
3. B	GO:1902350	cellular response to chloroquine
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0002830	positive regulation of type 2 immune response
3. B	GO:0061851	leading edge of lamellipodium
3. B	GO:0140608	cysteine-type endopeptidase activator activity
3. B	GO:1900029	positive regulation of ruffle assembly
3. B	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation
3. B	GO:0042110	T cell activation
3. B	GO:0007163	establishment or maintenance of cell polarity
3. B	GO:0001726	ruffle
3. B	GO:2000363	positive regulation of prostaglandin-E synthase activity
3. B	GO:0002227	innate immune response in mucosa
3. B	GO:0051496	positive regulation of stress fiber assembly
3. B	GO:0030011	maintenance of cell polarity
3. B	GO:0032753	positive regulation of interleukin-4 production
3. B	GO:0045345	positive regulation of MHC class I biosynthetic process
3. B	GO:0002730	regulation of dendritic cell cytokine production
3. B	GO:0032728	positive regulation of interferon-beta production
3. B	GO:0005865	striated muscle thin filament
3. B	GO:0030890	positive regulation of B cell proliferation
3. B	GO:0006936	muscle contraction
3. B	GO:0051092	positive regulation of NF-kappaB transcription factor activity
3. B	GO:0006913	nucleocytoplasmic transport
3. B	GO:0019966	interleukin-1 binding
3. B	GO:0048658	anther wall tapetum development
3. B	GO:0034162	toll-like receptor 9 signaling pathway
3. B	GO:0061339	establishment or maintenance of monopolar cell polarity
3. B	GO:0048821	erythrocyte development
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0051271	negative regulation of cellular component movement
3. B	GO:0039536	negative regulation of RIG-I signaling pathway
3. B	GO:0061702	inflammasome complex
3. B	GO:0036126	sperm flagellum
3. B	GO:0010233	phloem transport
3. B	GO:0071225	cellular response to muramyl dipeptide
3. B	GO:0007015	actin filament organization
3. B	GO:0030239	myofibril assembly
3. B	GO:0002674	negative regulation of acute inflammatory response
3. B	GO:0031529	ruffle organization
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0034163	regulation of toll-like receptor 9 signaling pathway
3. B	GO:0032735	positive regulation of interleukin-12 production
3. B	GO:0046597	negative regulation of viral entry into host cell
3. B	GO:0070374	positive regulation of ERK1 and ERK2 cascade
3. B	GO:0050679	positive regulation of epithelial cell proliferation
3. B	GO:0032692	negative regulation of interleukin-1 production
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:0071639	positive regulation of monocyte chemotactic protein-1 production
3. B	GO:0036064	ciliary basal body
3. B	GO:0016604	nuclear body
3. B	GO:0009956	radial pattern formation
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:0030335	positive regulation of cell migration
3. B	GO:0045348	positive regulation of MHC class II biosynthetic process
3. B	GO:0009933	meristem structural organization
3. B	GO:0051879	Hsp90 protein binding
3. B	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0051000	positive regulation of nitric-oxide synthase activity
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0032731	positive regulation of interleukin-1 beta production
3. B	GO:1902523	positive regulation of protein K63-linked ubiquitination
3. B	GO:0032741	positive regulation of interleukin-18 production
3. B	GO:0051015	actin filament binding
3. B	GO:0032689	negative regulation of interferon-gamma production
3. B	GO:0070373	negative regulation of ERK1 and ERK2 cascade
3. B	GO:0004672	protein kinase activity
3. B	GO:0032695	negative regulation of interleukin-12 production
3. B	GO:1900017	positive regulation of cytokine production involved in inflammatory response
3. B	GO:2000110	negative regulation of macrophage apoptotic process
3. B	GO:0005814	centriole
3. B	GO:0000724	double-strand break repair via homologous recombination
3. B	GO:0090022	regulation of neutrophil chemotaxis
3. B	GO:0032736	positive regulation of interleukin-13 production
3. B	GO:0034341	response to interferon-gamma
3. B	GO:0042585	germinal vesicle
3. B	GO:0051638	barbed-end actin filament uncapping
3. B	GO:0106333	subcortical maternal complex
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0097300	programmed necrotic cell death
3. B	GO:0034165	positive regulation of toll-like receptor 9 signaling pathway
3. B	GO:0106311
3. B	GO:0032740	positive regulation of interleukin-17 production
3. B	GO:0032691	negative regulation of interleukin-1 beta production
3. B	GO:0043406	positive regulation of MAP kinase activity
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0042555	MCM complex
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0032688	negative regulation of interferon-beta production
3. B	GO:0031982	vesicle
3. B	GO:0050727	regulation of inflammatory response
3. B	GO:0045577	regulation of B cell differentiation
3. B	GO:0016045	detection of bacterium
3. B	GO:0044782	cilium organization
3. B	GO:0005496	steroid binding
3. B	GO:0006965	positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0050830	defense response to Gram-positive bacterium
3. B	GO:0070269	pyroptosis
3. B	GO:0005635	nuclear envelope
3. B	GO:1900226	negative regulation of NLRP3 inflammasome complex assembly
3. B	GO:0031941	filamentous actin
3. B	GO:0051402	neuron apoptotic process
3. B	GO:0050680	negative regulation of epithelial cell proliferation
3. B	GO:0002526	acute inflammatory response
3. B	GO:0044319	wound healing, spreading of cells
3. B	GO:0036312	phosphatidylinositol 3-kinase regulatory subunit binding
3. B	GO:0072559	NLRP3 inflammasome complex
3. B	GO:0009595	detection of biotic stimulus
3. B	GO:0032720	negative regulation of tumor necrosis factor production
3. B	GO:0032755	positive regulation of interleukin-6 production
3. B	GO:0031953	negative regulation of protein autophosphorylation
3. B	GO:0072558	NLRP1 inflammasome complex
3. B	GO:0030016	myofibril
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0032733	positive regulation of interleukin-10 production
3. B	GO:0030032	lamellipodium assembly
3. B	GO:0002710	negative regulation of T cell mediated immunity
3. B	GO:0007270	neuron-neuron synaptic transmission
3. B	GO:0071224	cellular response to peptidoglycan
3. B	GO:0045751	negative regulation of Toll signaling pathway
3. B	GO:0002732	positive regulation of dendritic cell cytokine production
3. B	GO:1900016	negative regulation of cytokine production involved in inflammatory response
3. B	GO:0030838	positive regulation of actin filament polymerization
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0010592	positive regulation of lamellipodium assembly
3. B	GO:0090091	positive regulation of extracellular matrix disassembly
3. B	GO:0050871	positive regulation of B cell activation
3. B	GO:0046645	positive regulation of gamma-delta T cell activation
3. B	GO:0051293	establishment of spindle localization
3. B	GO:0032494	response to peptidoglycan
3. B	GO:0050766	positive regulation of phagocytosis
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0005884	actin filament
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:1990723	cytoplasmic periphery of the nuclear pore complex
3. B	GO:0030277	maintenance of gastrointestinal epithelium
3. B	GO:0046415	urate metabolic process
3. B	GO:0030863	cortical cytoskeleton
3. B	GO:0030544	Hsp70 protein binding
3. B	GO:0002862	negative regulation of inflammatory response to antigenic stimulus
3. B	GO:0050700	CARD domain binding
3. B	GO:0060339	negative regulation of type I interferon-mediated signaling pathway
3. B	GO:0016235	aggresome
3. B	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process
3. B	GO:0045010	actin nucleation
3. B	GO:0031252	cell leading edge
3. B	GO:0045089	positive regulation of innate immune response
3. B	GO:0051694	pointed-end actin filament capping
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0051353	positive regulation of oxidoreductase activity
3. B	GO:0045824	negative regulation of innate immune response
3. B	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0140374	antiviral innate immune response
3. B	GO:0060473	cortical granule
3. B	GO:0005096	GTPase activator activity
3. B	GO:0032661	regulation of interleukin-18 production
3. B	GO:0002606	positive regulation of dendritic cell antigen processing and presentation
3. B	GO:0045745	positive regulation of G protein-coupled receptor signaling pathway
3. B	GO:0035197	siRNA binding
3. B	GO:0048678	response to axon injury
3. B	GO:0044546	NLRP3 inflammasome complex assembly
3. B	GO:0038187	pattern recognition receptor activity
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0032727	positive regulation of interferon-alpha production
3. B	GO:0002720	positive regulation of cytokine production involved in immune response
3. B	GO:0046330	positive regulation of JNK cascade
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:1904784	NLRP1 inflammasome complex assembly
3. B	GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0012501	programmed cell death
3. B	GO:1905246	negative regulation of aspartic-type peptidase activity
3. B	GO:0005523	tropomyosin binding
3. B	GO:0030027	lamellipodium
3. B	GO:0010305	leaf vascular tissue pattern formation
3. B	GO:0097264	self proteolysis
3. B	GO:0044614	nuclear pore cytoplasmic filaments
3. B	GO:0036019	endolysosome
3. B	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
3. B	GO:0032715	negative regulation of interleukin-6 production
3. B	GO:0007611	learning or memory
3. B	GO:0043596	nuclear replication fork
3. B	GO:1901992	positive regulation of mitotic cell cycle phase transition
3. B	GO:0045322	unmethylated CpG binding
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0032687	negative regulation of interferon-alpha production
3. B	GO:0060335	positive regulation of interferon-gamma-mediated signaling pathway
3. B	GO:0051607	defense response to virus
3. B	GO:0002523	leukocyte migration involved in inflammatory response
3. B	GO:0042393	histone binding
3. B	GO:0019899	enzyme binding
3. B	GO:0002253	activation of immune response
3. B	GO:0002221	pattern recognition receptor signaling pathway
3. B	GO:0032703	negative regulation of interleukin-2 production
3. B	GO:2000813	negative regulation of barbed-end actin filament capping
3. B	GO:0017024	myosin I binding
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0043487	regulation of RNA stability
3. B	GO:0002639	positive regulation of immunoglobulin production
3. B	GO:0032009	early phagosome
3. B	GO:1902745	positive regulation of lamellipodium organization
3. B	GO:0042981	regulation of apoptotic process
3. B	GO:0030317	flagellated sperm motility
3. B	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
3. B	GO:0008233	peptidase activity
3. B	GO:0051302	regulation of cell division
3. B	GO:0005813	centrosome
3. B	GO:0070685	macropinocytic cup
3. B	GO:0032991	protein-containing complex
3. B	GO:0006963	positive regulation of antibacterial peptide biosynthetic process
3. B	GO:0005829	cytosol
3. B	GO:0003779	actin binding
3. B	GO:0032090	Pyrin domain binding
3. B	GO:0010540	basipetal auxin transport
3. B	GO:0060585	positive regulation of prostaglandin-endoperoxide synthase activity
3. B	GO:0046658	anchored component of plasma membrane
3. B	GO:0032874	positive regulation of stress-activated MAPK cascade
3. B	GO:0042742	defense response to bacterium
3. B	GO:0045335	phagocytic vesicle
3. B	GO:0070307	lens fiber cell development
3. B	GO:1904117	cellular response to vasopressin
3. B	GO:0044354	macropinosome
3. B	GO:0035101	FACT complex
3. B	GO:0032500	muramyl dipeptide binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q0VAA2	Leucine-rich repeat-containing protein 74A	0.00e+00	1.07e-20	2.69e-65
1. PB	Q9M651	RAN GTPase-activating protein 2	1.14e-10	9.51e-05	8.76e-10
1. PB	Q6ZQY2	Leucine-rich repeat-containing protein 74B	0	8.65e-152	0.0
1. PB	P10775	Ribonuclease inhibitor	5.16e-12	8.68e-05	1.74e-15
1. PB	Q1L994	Protein phosphatase 1 regulatory subunit 37	1.07e-10	6.08e-03	2.01e-07
1. PB	Q91VI7	Ribonuclease inhibitor	8.71e-12	6.49e-04	6.04e-19
1. PB	Q4R642	Dynein regulatory complex subunit 5	1.16e-07	1.07e-03	2.15e-13
1. PB	Q8IZ02	Leucine-rich repeat-containing protein 34	3.03e-14	2.81e-21	1.32e-20
1. PB	Q5JU00	Dynein regulatory complex subunit 5	4.40e-08	7.07e-03	7.88e-14
1. PB	P41391	Ran GTPase-activating protein 1	7.12e-14	1.05e-04	8.29e-05
1. PB	Q8HZP9	Ribonuclease inhibitor	8.20e-14	1.33e-04	1.36e-11
1. PB	A8HMZ4	Dynein regulatory complex subunit 5	1.04e-13	4.16e-11	4.47e-14
1. PB	Q9D3W5	Leucine-rich repeat-containing protein 71	9.99e-04	7.53e-06	1.39e-06
1. PB	P13489	Ribonuclease inhibitor	1.60e-13	7.75e-05	1.83e-11
1. PB	Q14BP6	Leucine-rich repeat-containing protein 74B	0.00e+00	3.29e-71	3.45e-169
1. PB	Q8N4P6	Leucine-rich repeat-containing protein 71	7.17e-04	2.32e-08	4.94e-06
1. PB	Q4V8D9	Leucine-rich repeat-containing protein 34	1.11e-16	2.22e-17	8.26e-20
1. PB	Q9LE82	RAN GTPase-activating protein 1	5.63e-09	2.71e-11	4.71e-15
1. PB	Q9DAM1	Leucine-rich repeat-containing protein 34	3.33e-16	6.58e-21	7.67e-22
1. PB	A0JPI9	Leucine-rich repeat-containing protein 74A	0.00e+00	1.07e-20	4.09e-70
1. PB	P29315	Ribonuclease inhibitor	5.55e-16	2.40e-04	4.76e-17
2. P	Q6PEZ8	Podocan-like protein 1	9.62e-07	3.85e-08	NA
2. P	Q8W3M4	Uncharacterized protein At4g06744	1.40e-04	5.08e-05	NA
2. P	Q9Y546	Leucine-rich repeat-containing protein 42	1.34e-02	2.51e-04	NA
2. P	D4ABB4	F-box/LRR-repeat protein 15	1.23e-05	8.22e-03	NA
2. P	Q6QMY6	Tsukushi	1.02e-04	2.61e-07	NA
2. P	P0ADK7	Protein YibA	9.62e-03	4.64e-02	NA
2. P	P22194	Protein phosphatase 1 regulatory subunit SDS22	9.78e-07	1.54e-12	NA
2. P	Q9BYS8	Leucine-rich repeat-containing protein 2	8.67e-05	3.30e-10	NA
2. P	Q8AVI4	Leucine-rich repeat protein SHOC-2	1.45e-04	4.69e-05	NA
2. P	Q6P5J6	Leucine-rich repeat-containing protein 42	5.15e-03	5.01e-03	NA
2. P	B4IBI9	Leucine-rich repeat protein soc-2 homolog	2.36e-04	8.13e-04	NA
2. P	Q32L08	Protein AMN1 homolog	1.64e-06	3.48e-09	NA
2. P	Q9GV46	Oplophorus-luciferin 2-monooxygenase non-catalytic subunit	3.58e-05	6.02e-07	NA
2. P	A2RTY3	Protein HEATR9	1.74e-02	1.18e-02	NA
2. P	Q9J5H8	Putative ankyrin repeat protein FPV023	NA	1.61e-04	NA
2. P	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	2.23e-05	1.83e-05	NA
2. P	A6NHZ5	Leucine-rich repeat-containing protein 14B	2.29e-06	4.13e-06	NA
2. P	Q641X1	Ankyrin repeat domain-containing protein 61	1.26e-01	2.79e-02	NA
2. P	Q2U5T5	Vacuolar protein 8	2.31e-02	3.65e-04	NA
2. P	Q9DE68	Decorin	3.07e-07	1.06e-07	NA
2. P	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	3.78e-05	3.72e-03	NA
2. P	P51885	Lumican	1.00e-06	1.07e-09	NA
2. P	O93233	Phospholipase A2 inhibitor	9.70e-08	8.04e-08	NA
2. P	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	2.94e-05	8.80e-06	NA
2. P	O88520	Leucine-rich repeat protein SHOC-2	1.60e-04	6.77e-04	NA
2. P	A6NM36	Leucine-rich repeat-containing protein 30	1.55e-05	3.75e-13	NA
2. P	Q9XSD9	Decorin	2.22e-06	9.80e-07	NA
2. P	Q8CI70	Leucine-rich repeat-containing protein 20	1.18e-05	6.17e-05	NA
2. P	P0ADK6	Protein YibA	1.01e-02	4.64e-02	NA
2. P	P07585	Decorin	2.10e-06	1.06e-04	NA
2. P	Q28680	Monocyte differentiation antigen CD14	4.80e-06	4.30e-03	NA
2. P	P13605	Fibromodulin	2.18e-05	2.94e-03	NA
2. P	Q8VC16	Leucine-rich repeat-containing protein 14	1.04e-06	3.81e-04	NA
2. P	Q6DHL5	Leucine-rich repeat-containing protein 57	2.58e-06	9.00e-03	NA
2. P	O15335	Chondroadherin	8.12e-07	1.42e-02	NA
2. P	Q9DAK8	Leucine-rich repeat-containing protein 51	5.38e-03	2.66e-02	NA
2. P	Q6C417	U2 small nuclear ribonucleoprotein A'	1.79e-03	1.35e-04	NA
2. P	Q3UV48	Leucine-rich repeat-containing protein 30	1.34e-05	4.62e-12	NA
2. P	Q08353	NF-kappa-B inhibitor alpha	3.28e-01	2.63e-06	NA
2. P	Q7Z5L7	Podocan	2.53e-05	1.26e-03	NA
2. P	P34284	F-box/LRR-repeat protein fbxl-1	8.18e-08	4.43e-03	NA
2. P	B3P3E8	Leucine-rich repeat protein soc-2 homolog	4.34e-04	1.16e-02	NA
2. P	Q8K0L0	Ankyrin repeat and SOCS box protein 2	4.63e-01	4.14e-02	NA
2. P	Q24K06	Leucine-rich repeat-containing protein 10	5.16e-05	3.80e-03	NA
2. P	Q7TQ62	Podocan	2.02e-05	1.40e-03	NA
2. P	Q9LUI1	Leucine-rich repeat extensin-like protein 6	6.66e-04	2.24e-03	NA
2. P	P21810	Biglycan	1.71e-05	5.38e-05	NA
2. P	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	6.38e-04	4.38e-05	NA
2. P	O00505	Importin subunit alpha-4	1.83e-02	1.09e-02	NA
2. P	Q5R8X9	Protein AMN1 homolog	2.80e-06	2.45e-06	NA
2. P	P0DUQ2	PRAME family member 9	NA	4.43e-02	NA
2. P	Q6DIQ3	Protein phosphatase 1 regulatory subunit 7	5.92e-07	4.97e-13	NA
2. P	Q27972	Chondroadherin	NA	1.54e-03	NA
2. P	Q2KID4	Dynein axonemal light chain 1	8.46e-06	5.60e-03	NA
2. P	Q0P4D1	Protein AMN1 homolog	1.56e-06	3.12e-12	NA
2. P	Q63746	NF-kappa-B inhibitor alpha	3.76e-01	1.71e-03	NA
2. P	Q15404	Ras suppressor protein 1	2.42e-07	1.02e-03	NA
2. P	Q5VT98	PRAME family member 20	8.69e-07	4.47e-02	NA
2. P	A8XWW4	Leucine-rich repeat protein soc-2	2.76e-04	8.00e-06	NA
2. P	O02678	Biglycan	9.54e-06	1.46e-05	NA
2. P	Q9BXN1	Asporin	2.09e-05	3.05e-02	NA
2. P	Q55837	Uncharacterized protein slr0516	1.12e-01	3.80e-03	NA
2. P	P11745	Ran GTPase-activating protein 1	1.86e-10	1.27e-03	NA
2. P	P47853	Biglycan	3.57e-05	8.29e-06	NA
2. P	Q4R3S3	Ankyrin repeat domain-containing protein 7	5.11e-01	1.62e-02	NA
2. P	Q641R9	Dynein axonemal light chain 1	9.14e-06	3.13e-03	NA
2. P	Q3UJB3	Leucine-rich repeat-containing protein 14B	6.93e-06	1.09e-05	NA
2. P	Q5R1V9	Decorin	9.20e-06	1.06e-04	NA
2. P	Q28CU0	Leucine-rich repeat-containing protein 23	2.76e-06	5.06e-15	NA
2. P	P28654	Decorin	6.33e-06	1.11e-06	NA
2. P	Q8WUA8	Tsukushi	1.64e-05	3.24e-06	NA
2. P	Q01730	Ras suppressor protein 1	2.50e-07	1.94e-03	NA
2. P	Q4KLV2	Leucine-rich repeat-containing protein 42	4.03e-03	4.17e-03	NA
2. P	Q9U3A0	P-granule-associated novel protein 1	5.46e-05	3.42e-02	NA
2. P	Q22875	Leucine-rich repeat protein soc-2	1.73e-04	5.57e-05	NA
2. P	Q640Z9	Leucine-rich repeat-containing protein 14	4.85e-07	1.30e-04	NA
2. P	Q8WXK4	Ankyrin repeat and SOCS box protein 12	1.77e-01	3.32e-02	NA
2. P	Q8N9N7	Leucine-rich repeat-containing protein 57	3.33e-06	8.98e-05	NA
2. P	Q15435	Protein phosphatase 1 regulatory subunit 7	1.98e-07	6.07e-14	NA
2. P	Q5UPH1	Putative ankyrin repeat protein L99	NA	4.17e-03	NA
2. P	Q9EQP5	Prolargin	1.39e-06	2.69e-02	NA
2. P	Q2TB02	NF-kappa-B inhibitor delta	5.66e-02	4.38e-02	NA
2. P	Q2HJ90	Leucine-rich repeat-containing protein 42	8.76e-03	4.18e-05	NA
2. P	Q4UMP3	Putative ankyrin repeat protein RF_0314	1.18e-01	2.39e-03	NA
2. P	O64566	Plant intracellular Ras-group-related LRR protein 6	3.65e-06	3.53e-06	NA
2. P	Q8IY45	Protein AMN1 homolog	2.63e-06	1.80e-06	NA
2. P	Q8K3W2	Leucine-rich repeat-containing protein 10	1.42e-06	4.79e-04	NA
2. P	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	2.31e-05	3.06e-03	NA
2. P	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	5.96e-05	2.88e-08	NA
2. P	Q4I1B1	Vacuolar protein 8	9.92e-03	8.82e-03	NA
2. P	P51890	Lumican	1.65e-06	4.73e-07	NA
2. P	Q29393	Decorin	2.06e-06	9.10e-07	NA
2. P	Q8LB33	F-box protein At3g58530	1.07e-09	7.64e-07	NA
2. P	P50609	Fibromodulin	1.68e-05	7.30e-04	NA
2. P	P50608	Fibromodulin	1.92e-05	6.46e-03	NA
2. P	Q6INV3	Leucine-rich repeat-containing protein 57	2.16e-07	2.48e-04	NA
2. P	O35367	Keratocan	5.09e-09	9.21e-07	NA
2. P	Q8TCA0	Leucine-rich repeat-containing protein 20	7.57e-05	1.97e-04	NA
2. P	Q54Q39	Protein phosphatase 1 regulatory subunit pprA	8.92e-08	8.44e-13	NA
2. P	E9Q5G7	Oogenesin-1	1.22e-05	3.39e-02	NA
2. P	C0STK7	Phospholipase A2 inhibitor beta	NA	1.74e-09	NA
2. P	Q91974	NF-kappa-B inhibitor alpha	1.89e-01	2.56e-02	NA
2. P	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	3.00e-06	5.64e-05	NA
2. P	Q9SSD1	Protein TOO MANY MOUTHS	1.17e-04	2.09e-09	NA
2. P	Q8R2U7	Leucine-rich repeat-containing protein 42	6.79e-03	3.36e-05	NA
2. P	Q75A58	Antagonist of mitotic exit network protein 1	8.58e-06	2.99e-02	NA
2. P	Q5BKY1	Leucine-rich repeat-containing protein 10	5.97e-08	9.96e-04	NA
2. P	Q32PL1	Protein phosphatase 1 regulatory subunit 7	2.44e-08	1.95e-09	NA
2. P	P21809	Biglycan	8.26e-06	2.16e-05	NA
2. P	B6CZ61	Leucine-rich repeat-containing protein 51	5.63e-03	2.56e-02	NA
2. P	Q65Z91	Tsukushi	3.19e-04	4.22e-08	NA
2. P	Q99MQ4	Asporin	1.58e-06	7.00e-03	NA
2. P	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	5.79e-05	1.59e-04	NA
2. P	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	3.04e-04	3.28e-05	NA
2. P	Q5RI43	Keratocan	7.94e-09	4.03e-10	NA
2. P	B4LXW1	Leucine-rich repeat protein soc-2 homolog	1.61e-04	1.24e-02	NA
2. P	Q3ZC49	Leucine-rich repeat-containing protein 39	6.26e-06	1.11e-14	NA
2. P	Q10303	Cell polarity protein alp21	7.03e-05	1.73e-03	NA
2. P	P0DUQ1	PRAME family member 15	NA	4.43e-02	NA
2. P	P45969	Protein phosphatase 1 regulatory subunit SDS22 homolog	4.03e-07	1.12e-10	NA
2. P	Q15048	Leucine-rich repeat-containing protein 14	4.21e-06	6.17e-05	NA
2. P	Q3T0W4	Protein phosphatase 1 regulatory subunit 7	1.83e-08	7.45e-13	NA
2. P	A7SFP1	Leucine-rich repeat protein soc-2 homolog	4.31e-04	1.18e-06	NA
2. P	P35858	Insulin-like growth factor-binding protein complex acid labile subunit	5.66e-05	8.34e-07	NA
2. P	Q96IG2	F-box/LRR-repeat protein 20	4.72e-10	3.36e-03	NA
2. P	Q63691	Monocyte differentiation antigen CD14	1.65e-05	3.07e-02	NA
2. P	Q05443	Lumican	9.06e-07	4.74e-11	NA
2. P	Q9MA83	Receptor-like protein 30	4.01e-04	1.84e-02	NA
2. P	B6CZ40	Leucine-rich repeat-containing protein 51	5.61e-03	1.31e-02	NA
2. P	O35125	Leucine-rich repeat-containing protein 23	1.01e-05	8.05e-13	NA
2. P	Q28888	Decorin	6.69e-06	2.77e-04	NA
2. P	Q91W61	F-box/LRR-repeat protein 15	1.51e-05	6.52e-03	NA
2. P	O60810	PRAME family member 4	8.35e-07	4.51e-02	NA
2. P	Q3ZBN5	Asporin	1.07e-05	6.08e-04	NA
2. P	Q65YW8	Tsukushi-A	2.86e-04	2.17e-08	NA
2. P	Q9XHH2	Dynein axonemal light chain 1	3.74e-04	1.04e-07	NA
2. P	P28653	Biglycan	4.58e-06	2.92e-05	NA
2. P	Q8RWU5	F-box/LRR-repeat protein 3	7.12e-06	2.04e-05	NA
2. P	Q5U2S6	Ankyrin repeat and SOCS box protein 2	5.89e-01	1.48e-02	NA
2. P	Q92527	Ankyrin repeat domain-containing protein 7	2.57e-01	3.29e-02	NA
2. P	O46542	Decorin	2.62e-06	5.90e-05	NA
2. P	P58823	Polygalacturonase inhibitor 3	1.44e-04	2.96e-05	NA
2. P	Q9SJH6	Receptor like protein 29	2.74e-04	1.10e-04	NA
2. P	Q4WVW4	Vacuolar protein 8	2.18e-02	9.44e-04	NA
2. P	Q862Z2	Ankyrin repeat and SOCS box protein 5	2.82e-01	4.04e-03	NA
2. P	Q9D1G5	Leucine-rich repeat-containing protein 57	2.88e-06	1.29e-05	NA
2. P	Q5I125	I-Kappa-B like protein N3	NA	2.41e-02	NA
2. P	Q5RAV5	Leucine-rich repeat protein SHOC-2	4.98e-04	1.76e-04	NA
2. P	Q5HZV9	Protein phosphatase 1 regulatory subunit 7	1.90e-08	5.89e-12	NA
2. P	P02750	Leucine-rich alpha-2-glycoprotein	5.67e-06	4.78e-14	NA
2. P	Q9CQ76	Nephrocan	1.65e-04	3.84e-06	NA
2. P	Q9D1A4	Ankyrin repeat and SOCS box protein 5	2.02e-01	7.44e-03	NA
2. P	Q9UQ13	Leucine-rich repeat protein SHOC-2	4.53e-04	1.76e-04	NA
2. P	Q5XGC0	F-box/LRR-repeat protein 15	2.49e-05	1.24e-02	NA
2. P	P51884	Lumican	1.08e-06	3.86e-10	NA
2. P	Q6AYI5	Leucine-rich repeat protein SHOC-2	5.63e-05	2.84e-04	NA
2. P	Q9CZV8	F-box/LRR-repeat protein 20	3.67e-08	1.40e-03	NA
2. P	B8JKV0	Protein AMN1 homolog	1.82e-06	3.36e-07	NA
2. P	Q5E9C0	Ras suppressor protein 1	2.63e-07	2.41e-03	NA
2. P	Q5RFS7	Protein phosphatase 1 regulatory subunit 7	6.57e-06	1.35e-14	NA
2. P	Q3UM45	Protein phosphatase 1 regulatory subunit 7	7.20e-07	7.15e-11	NA
2. P	P51887	Fibromodulin	9.05e-06	1.44e-04	NA
2. P	F1R6I3	Leucine-rich repeat-containing protein 39	1.44e-05	3.21e-12	NA
2. P	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	5.09e-05	2.39e-08	NA
2. P	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	2.21e-05	5.90e-05	NA
2. P	Q9SHI4	Receptor-like protein 3	1.32e-03	7.14e-03	NA
2. P	O35344	Importin subunit alpha-4	7.11e-03	1.80e-02	NA
2. P	Q13309	S-phase kinase-associated protein 2	4.79e-05	7.73e-07	NA
2. P	Q8BY98	Ankyrin repeat domain-containing protein SOWAHD	3.14e-01	8.48e-03	NA
2. P	Q95122	Monocyte differentiation antigen CD14	5.16e-06	3.15e-07	NA
2. P	O42235	Keratocan	7.79e-09	4.01e-08	NA
2. P	Q9IB75	Biglycan	1.94e-05	1.15e-06	NA
2. P	P36047	Protein phosphatase 1 regulatory subunit SDS22	4.59e-07	2.92e-11	NA
2. P	O70210	Chondroadherin	4.60e-06	4.64e-02	NA
2. P	Q58DG6	F-box/LRR-repeat protein 20	5.83e-10	3.36e-03	NA
2. P	H0Y7S4	Putative PRAME family member 26	8.22e-08	3.13e-05	NA
2. P	Q02821	Importin subunit alpha	1.11e-02	2.79e-02	NA
2. P	P08571	Monocyte differentiation antigen CD14	2.21e-04	7.08e-07	NA
2. P	O49286	F-box protein SKP2B	2.88e-07	5.44e-05	NA
2. P	Q569B5	Leucine-rich repeat-containing protein 14	1.34e-06	1.15e-04	NA
2. P	Q9Z0Z3	S-phase kinase-associated protein 2	7.39e-06	2.01e-05	NA
2. P	B0W6M9	Leucine-rich repeat protein soc-2 homolog	1.14e-03	3.95e-02	NA
2. P	P35334	Polygalacturonase inhibitor 1	3.01e-05	9.61e-05	NA
2. P	O46403	Biglycan	4.12e-05	2.08e-05	NA
2. P	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	6.78e-05	8.03e-07	NA
2. P	O62702	Keratocan	5.87e-09	2.32e-07	NA
2. P	P58822	Polygalacturonase inhibitor 2	6.70e-05	1.41e-04	NA
2. P	Q32KP2	Leucine-rich repeat-containing protein 23	1.26e-05	4.53e-13	NA
2. P	D3ZXS4	Leucine-rich repeat-containing protein 39	6.49e-06	4.08e-15	NA
2. P	Q9Z1S7	Osteomodulin	5.45e-07	3.04e-14	NA
2. P	Q8CBR6	Tsukushi	1.25e-04	4.33e-06	NA
2. P	Q53EV4	Leucine-rich repeat-containing protein 23	1.06e-05	1.15e-12	NA
2. P	Q5QNV8	Protein HEATR9	1.73e-02	4.55e-02	NA
2. P	Q9TTE2	Decorin	3.39e-07	1.96e-06	NA
2. P	Q5PP26	Piriformospora indica-insensitive protein 2	2.02e-04	4.21e-03	NA
2. P	Q9CQM6	Ankyrin repeat domain-containing protein 61	1.01e-01	5.60e-03	NA
2. P	Q4LDG9	Dynein axonemal light chain 1	8.67e-06	1.37e-03	NA
2. P	Q1L8H0	Leucine-rich repeat-containing protein 14B	2.70e-06	9.09e-05	NA
2. P	Q54AX5	Leucine-rich repeat protein lrrA	1.11e-04	2.58e-02	NA
2. P	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	3.12e-05	6.15e-04	NA
2. P	Q9Z1E3	NF-kappa-B inhibitor alpha	3.97e-01	7.96e-04	NA
2. P	E2RKN7	F-box/LRR-repeat protein 15	8.83e-07	3.66e-02	NA
2. P	B9F655	Plant intracellular Ras-group-related LRR protein 7	8.66e-08	1.41e-05	NA
2. P	Q58A48	Tsukushi	3.62e-04	1.14e-10	NA
2. P	Q1L8Y7	Leucine-rich repeat protein SHOC-2	2.09e-05	1.54e-04	NA
2. P	B4QVR7	Leucine-rich repeat protein soc-2 homolog	2.61e-04	1.63e-04	NA
2. P	Q8NEE6	Dynein regulatory complex subunit 6	2.45e-05	2.39e-02	NA
2. P	Q5FVI3	Leucine-rich repeat-containing protein 57	1.16e-07	3.77e-05	NA
2. P	P10810	Monocyte differentiation antigen CD14	6.78e-06	1.33e-03	NA
2. P	Q99983	Osteomodulin	5.54e-06	3.59e-11	NA
2. P	Q4PSE6	Leucine-rich repeat extensin-like protein 7	1.50e-04	2.63e-02	NA
2. P	Q96DD0	Leucine-rich repeat-containing protein 39	7.93e-06	2.57e-15	NA
2. P	Q28G94	Dynein axonemal light chain 1	8.71e-06	6.93e-03	NA
2. P	Q5U201	Protein AMN1 homolog	9.84e-07	1.95e-09	NA
2. P	O60938	Keratocan	2.27e-08	1.46e-06	NA
2. P	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	3.46e-03	1.32e-05	NA
2. P	E6ZHJ8	F-box/LRR-repeat protein 15	1.50e-05	2.59e-03	NA
2. P	Q8NI38	NF-kappa-B inhibitor delta	1.50e-01	1.90e-03	NA
2. P	O77742	Osteomodulin	3.67e-06	3.86e-10	NA
2. P	Q4KM95	Leucine-rich repeat-containing protein 42	4.55e-03	1.63e-05	NA
2. P	Q9LPL4	F-box protein SKP2A	1.60e-07	6.08e-04	NA
2. P	Q8BGI7	Leucine-rich repeat-containing protein 39	9.27e-06	1.33e-13	NA
2. P	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	1.44e-05	1.51e-03	NA
2. P	P51886	Lumican	1.10e-06	1.48e-09	NA
2. P	Q5EAD8	Leucine-rich repeat-containing protein 51	1.24e-02	2.03e-02	NA
2. P	Q06828	Fibromodulin	3.42e-05	6.79e-03	NA
2. P	Q84WJ9	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	5.56e-08	2.48e-07	NA
2. P	Q6DHB1	Dynein axonemal light chain 1	1.01e-05	4.60e-02	NA
2. P	Q55CN0	Tubulin-specific chaperone E	2.75e-04	3.56e-05	NA
2. P	Q8BH16	F-box/LRR-repeat protein 2	4.05e-08	1.75e-02	NA
2. P	P25963	NF-kappa-B inhibitor alpha	3.15e-01	2.23e-07	NA
2. P	Q05A62	Dynein axonemal light chain 1	9.21e-06	9.40e-05	NA
2. P	A0A096MJZ0	Dynein axonemal light chain 1	8.39e-06	2.76e-03	NA
2. P	A6QLV3	Leucine-rich repeat protein SHOC-2	3.40e-04	1.54e-04	NA
2. P	Q5M7S9	Tsukushi	9.86e-05	5.79e-09	NA
2. P	Q9CQ31	Ankyrin repeat and SOCS box protein 11	3.60e-01	7.22e-03	NA
2. P	Q8T888	Dynein axonemal light chain 1	5.48e-06	5.64e-05	NA
2. P	O35103	Osteomodulin	4.93e-07	7.11e-13	NA
2. P	Q01129	Decorin	6.22e-06	1.89e-06	NA
2. P	P28675	Decorin	1.43e-07	3.40e-06	NA
2. P	Q00874	DNA damage-repair/toleration protein DRT100	3.40e-05	3.10e-02	NA
2. P	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	8.98e-04	2.92e-05	NA
2. P	O46390	Biglycan	4.96e-06	9.68e-06	NA
2. P	Q6AXL3	Transforming growth factor beta activator LRRC33	7.68e-06	2.87e-02	NA
2. P	Q9DE66	Keratocan	4.27e-07	2.76e-08	NA
2. P	C8V4D4	SCF E3 ubiquitin ligase complex F-box protein grrA	5.63e-06	8.49e-06	NA
2. P	Q9FH99	F-box protein At5g67140	9.58e-05	2.19e-02	NA
2. P	Q0V9Y8	Leucine-rich repeat-containing protein 42	7.07e-03	2.30e-04	NA
2. P	Q6UY01	Leucine-rich repeat-containing protein 31	9.00e-10	5.78e-17	NA
2. P	Q8BNU0	Armadillo repeat-containing protein 6	7.50e-03	2.88e-03	NA
2. P	Q5F4C4	Leucine-rich repeat protein SHOC-2	1.15e-04	2.49e-02	NA
2. P	Q5EFZ4	Vacuolar protein 8	1.13e-02	6.26e-03	NA
2. P	Q3SZE4	Ankyrin repeat and SOCS box protein 11	2.70e-01	2.62e-03	NA
2. P	A5PJJ5	Leucine-rich repeat-containing protein 14	3.42e-06	1.23e-04	NA
2. P	Q9S9X4	Putative F-box/LRR-repeat protein 8	5.89e-07	1.80e-02	NA
2. P	Q9DE67	Lumican	1.33e-07	3.45e-07	NA
2. P	P21793	Decorin	3.45e-06	1.33e-07	NA
2. P	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	1.03e-04	6.57e-07	NA
2. P	Q8VDB8	Leucine-rich repeat-containing protein 2	8.60e-06	6.38e-13	NA
3. B	Q6IRU7	Centrosomal protein of 78 kDa	8.88e-06	NA	4.45e-09
3. B	Q5VZK9	F-actin-uncapping protein LRRC16A	5.54e-05	NA	1.81e-09
3. B	A6QLE5	NACHT, LRR and PYD domains-containing protein 3	3.75e-07	NA	2.18e-06
3. B	A6H639	Dynein regulatory complex subunit 5	7.12e-10	NA	8.60e-15
3. B	P0CD60	FERM domain-containing protein C	5.89e-06	NA	1.27e-12
3. B	Q3TL44	NLR family member X1	4.10e-05	NA	1.02e-06
3. B	I1Z695	LRR receptor-like serine/threonine-protein kinase ER2	1.32e-03	NA	0.034
3. B	Q9Y239	Nucleotide-binding oligomerization domain-containing protein 1	6.25e-11	NA	2.17e-13
3. B	A8Y3R9	Protein phosphatase 1 regulatory subunit 37 homolog	1.85e-08	NA	5.27e-10
3. B	Q7G768	Brassinosteroid LRR receptor kinase BRL2	1.29e-02	NA	9.19e-05
3. B	Q5DU56	Protein NLRC3	3.26e-10	NA	1.11e-29
3. B	Q9FL51	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940	6.47e-04	NA	0.003
3. B	Q53B88	Nucleotide-binding oligomerization domain-containing protein 2	1.70e-11	NA	1.50e-15
3. B	P33076	MHC class II transactivator	1.52e-03	NA	1.98e-04
3. B	C3VPR6	Protein NLRC5	7.63e-05	NA	5.97e-18
3. B	P70567	Tropomodulin-1	2.98e-04	NA	1.75e-04
3. B	Q3UFQ8	Capping protein, Arp2/3 and myosin-I linker protein 3	3.76e-04	NA	1.19e-06
3. B	Q6B966	NACHT, LRR and PYD domains-containing protein 14	4.14e-08	NA	1.56e-04
3. B	Q9R1M5	NACHT, LRR and PYD domains-containing protein 5	1.00e-05	NA	8.96e-10
3. B	D9I2G1	NACHT, LRR and PYD domains-containing protein 1a allele 4	2.77e-03	NA	0.010
3. B	Q9VFH6	Protein Cep78 homolog	5.30e-05	NA	3.69e-05
3. B	B2RYF1	Protein phosphatase 1 regulatory subunit 37	1.52e-10	NA	2.51e-08
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	5.68e-03	NA	0.004
3. B	P59047	NACHT, LRR and PYD domains-containing protein 5	3.01e-06	NA	1.36e-13
3. B	Q69SP5	LRR receptor-like serine/threonine-protein kinase ER1	1.37e-03	NA	4.55e-05
3. B	Q9SCT4	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	1.23e-03	NA	2.33e-04
3. B	Q9JKK7	Tropomodulin-2	9.61e-05	NA	9.70e-06
3. B	Q587K4	Leucine-rich repeat-containing protein 73	1.06e-11	NA	7.32e-05
3. B	Q9HC29	Nucleotide-binding oligomerization domain-containing protein 2	2.98e-11	NA	7.50e-16
3. B	Q96MN2	NACHT, LRR and PYD domains-containing protein 4	6.48e-09	NA	1.72e-13
3. B	Q5I2M4	Toll-like receptor 9	3.75e-03	NA	0.001
3. B	P34342	Ran GTPase-activating protein 2	1.06e-06	NA	6.72e-06
3. B	O82318	Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1	1.12e-02	NA	0.032
3. B	A0A0G2K0D3	Leiomodin-1	2.26e-03	NA	0.019
3. B	Q8RZV7	Leucine-rich repeat receptor protein kinase MSP1	2.10e-02	NA	0.001
3. B	D4A615	Tonsoku-like protein	3.54e-05	NA	0.017
3. B	P46061	Ran GTPase-activating protein 1	5.84e-10	NA	6.76e-06
3. B	Q288C4	NACHT, LRR and PYD domains-containing protein 9	6.69e-08	NA	1.61e-07
3. B	Q5MR23	Receptor-like protein 9DC3	4.00e-03	NA	0.007
3. B	Q9VIW3	Ran GTPase-activating protein	2.17e-09	NA	9.94e-07
3. B	Q19857	Protein phosphatase 1 regulatory subunit 37 homolog	8.89e-10	NA	9.54e-12
3. B	Q96HA7	Tonsoku-like protein	2.59e-05	NA	2.06e-04
3. B	Q9JLH8	Tropomodulin-4	2.87e-04	NA	0.003
3. B	P49813	Tropomodulin-1	1.25e-03	NA	1.31e-04
3. B	P28289	Tropomodulin-1	4.33e-04	NA	5.82e-05
3. B	Q6E804	Nucleotide-binding oligomerization domain-containing protein 2	1.78e-11	NA	1.80e-12
3. B	Q8ND23	Capping protein, Arp2/3 and myosin-I linker protein 3	3.70e-04	NA	8.30e-07
3. B	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	1.16e-02	NA	2.65e-04
3. B	Q9LRT1	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	7.25e-03	NA	0.013
3. B	P79621	MHC class II transactivator	1.62e-03	NA	0.032
3. B	O75864	Protein phosphatase 1 regulatory subunit 37	1.09e-10	NA	1.73e-08
3. B	Q66X22	NACHT, LRR and PYD domains-containing protein 9B	1.62e-07	NA	3.81e-05
3. B	Q86W24	NACHT, LRR and PYD domains-containing protein 14	7.96e-07	NA	9.41e-05
3. B	Q8BU40	NACHT, LRR and PYD domains-containing protein 4A	3.00e-07	NA	2.78e-04
3. B	P70566	Tropomodulin-2	1.82e-04	NA	2.70e-05
3. B	C6FG12	Protein NLRC5	4.24e-04	NA	2.35e-10
3. B	Q66X19	NACHT, LRR and PYD domains-containing protein 4E	1.89e-07	NA	1.45e-06
3. B	A0JNC0	Tropomodulin-1	4.07e-04	NA	6.96e-05
3. B	O49879	Receptor-like protein Cf-9 homolog	1.23e-03	NA	0.001
3. B	Q66X05	NACHT, LRR and PYD domains-containing protein 4F	NA	NA	8.11e-05
3. B	D9I2G3	NACHT, LRR and PYD domains-containing protein 1 allele 2	5.30e-03	NA	0.009
3. B	Q86WI3	Protein NLRC5	7.43e-05	NA	4.83e-12
3. B	Q96P20	NACHT, LRR and PYD domains-containing protein 3	2.38e-07	NA	1.93e-06
3. B	Q8WX94	NACHT, LRR and PYD domains-containing protein 7	2.75e-06	NA	0.043
3. B	Q9LJF3	Receptor-like protein kinase BRI1-like 3	NA	NA	0.043
3. B	Q9NZQ9	Tropomodulin-4	3.86e-04	NA	0.001
3. B	Q96CN5	Leucine-rich repeat-containing protein 45	2.20e-06	NA	2.96e-10
3. B	Q9C000	NACHT, LRR and PYD domains-containing protein 1	4.59e-05	NA	6.84e-05
3. B	Q8GUQ5	Brassinosteroid LRR receptor kinase	2.25e-03	NA	0.003
3. B	D9I2H0	NACHT, LRR and PYD domains-containing protein 1a allele 3	1.31e-02	NA	0.010
3. B	A7Z026	Protein phosphatase 1 regulatory subunit 37	1.63e-09	NA	5.42e-09
3. B	Q5I2M8	Toll-like receptor 9	8.28e-03	NA	0.030
3. B	Q6EDY6	F-actin-uncapping protein LRRC16A	3.82e-04	NA	5.82e-08
3. B	Q0VC48	Tropomodulin-4	4.84e-04	NA	0.006
3. B	Q8K3Z0	Nucleotide-binding oligomerization domain-containing protein 2	6.10e-11	NA	2.72e-18
3. B	Q9NZR1	Tropomodulin-2	2.47e-04	NA	4.73e-05
3. B	Q86W25	NACHT, LRR and PYD domains-containing protein 13	6.97e-10	NA	2.42e-10
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	3.15e-03	NA	3.48e-06
3. B	Q54G18	Rho GTPase-activating protein gacW	2.83e-05	NA	6.37e-06
3. B	Q8CIM1	Leucine-rich repeat-containing protein 45	1.17e-06	NA	1.63e-11
3. B	Q9JHJ0	Tropomodulin-3	9.10e-05	NA	2.15e-06
3. B	D9I2F9	NACHT, LRR and PYD domains-containing protein 1a allele 1	6.75e-03	NA	0.009
3. B	Q8BVA4	Leiomodin-1	1.75e-03	NA	0.019
3. B	Q5XHY1	Capping protein, Arp2/3 and myosin-I linker protein 3	7.13e-05	NA	8.44e-07
3. B	Q6F5E8	Capping protein, Arp2/3 and myosin-I linker protein 2	1.19e-04	NA	3.53e-08
3. B	Q9FJ57	Protein TORNADO 1	4.09e-05	NA	6.61e-06
3. B	Q86W28	NACHT, LRR and PYD domains-containing protein 8	3.88e-07	NA	8.01e-07
3. B	P46060	Ran GTPase-activating protein 1	4.39e-10	NA	6.41e-07
3. B	Q5JTD7	Leucine-rich repeat-containing protein 73	7.97e-12	NA	6.40e-05
3. B	Q0JA29	LRR receptor-like serine/threonine-protein kinase FLS2	5.50e-03	NA	0.039
3. B	D9I2G4	NACHT, LRR and PYD domains-containing protein 1a allele 5	1.32e-02	NA	0.011
3. B	Q7RTR2	NLR family CARD domain-containing protein 3	2.48e-10	NA	4.51e-32
3. B	Q8C6J9	NACHT, LRR and PYD domains-containing protein 4B	1.98e-06	NA	5.27e-04
3. B	O13066	Ran GTPase-activating protein 1	5.39e-10	NA	1.33e-10
3. B	Q8BKR5	Protein phosphatase 1 regulatory subunit 37	2.30e-09	NA	8.35e-09
3. B	Q3TKR3	NACHT, LRR and PYD domains-containing protein 4C	3.34e-07	NA	2.35e-05
3. B	Q3V3V9	Capping protein, Arp2/3 and myosin-I linker protein 2	1.31e-04	NA	9.12e-09
3. B	Q5JTW2	Centrosomal protein of 78 kDa	5.87e-06	NA	6.64e-11
3. B	Q66X01	NACHT, LRR and PYD domains-containing protein 9C	3.74e-09	NA	8.52e-06
3. B	C0LGP9	Probable leucine-rich repeat receptor-like protein kinase IMK3	1.84e-03	NA	0.009
3. B	E9Q5R7	NACHT, LRR and PYD domains-containing protein 12	4.10e-07	NA	1.33e-12
3. B	Q9ZWC8	Serine/threonine-protein kinase BRI1-like 1	5.19e-03	NA	0.002
3. B	P59046	NACHT, LRR and PYD domains-containing protein 12	9.09e-09	NA	2.49e-11
3. B	Q9NYL9	Tropomodulin-3	3.51e-04	NA	2.04e-07
3. B	Q5ZI11	Leucine-rich repeat-containing protein 45	3.23e-06	NA	5.54e-12
3. B	Q647I9	NACHT, LRR and PYD domains-containing protein 5	8.14e-07	NA	1.50e-14
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	6.77e-04
3. B	Q0P5G1	Tonsoku-like protein	3.35e-06	NA	9.94e-06
3. B	Q86UT6	NLR family member X1	4.23e-04	NA	3.42e-04
3. B	B0FPE9	NACHT, LRR and PYD domains-containing protein 3	2.22e-07	NA	1.94e-07
3. B	Q95VZ3	Protein CARMIL	3.37e-07	NA	1.09e-10
3. B	A2RRS8	Centrosomal protein of 78 kDa	2.37e-06	NA	1.20e-07
3. B	Q8BHB0	Nucleotide-binding oligomerization domain-containing protein 1	8.37e-11	NA	2.80e-18
3. B	Q53B87	Nucleotide-binding oligomerization domain-containing protein 2	2.48e-11	NA	5.46e-16
3. B	Q5FVQ8	NLR family member X1	5.11e-05	NA	4.47e-05
3. B	Q9NX02	NACHT, LRR and PYD domains-containing protein 2	2.38e-07	NA	0.005
3. B	Q6NZL6	Tonsoku-like protein	2.99e-07	NA	3.97e-04
3. B	D4A523	NACHT, LRR and PYD domains-containing protein 3	1.39e-07	NA	4.90e-10
3. B	Q8R4B8	NACHT, LRR and PYD domains-containing protein 3	1.23e-07	NA	5.25e-08