Summary

Q6ZRK6

Homolog: F7DP49.
Function: Deuterosome assembly protein 1.

Statistics

Total GO Annotation: 111
Unique PROST Go: 111
Unique BLAST Go: 0

Total Homologs: 29
Unique PROST Homologs: 27
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was F7DP49 (Deuterosome assembly protein 1) with a FATCAT P-Value: 1.04e-05 and RMSD of 5.68 angstrom. The sequence alignment identity is 17.6%.
Structural alignment shown in left. Query protein Q6ZRK6 colored as red in alignment, homolog F7DP49 colored as blue. Query protein Q6ZRK6 is also shown in right top, homolog F7DP49 showed in right bottom. They are colored based on secondary structures. 

  Q6ZRK6 MESNFNTESSSTFTLQSSSETLFS-IQLLDFKTSLLEALEELRMRREAEIHYEEQIGKIIVETQELKWQK--ETLQNQKETLAEQHKEAMAVFKKQLQMK 97
  F7DP49 ---------------------MFTNIHSIARNSSCENELEEL-M------H---QI-DIMVSHRKVEWEKHVKVLE-QK--LEAQDRELTEA--RNL--- 60

  Q6ZRK6 MCALEEEKGKYQLATEIKEKEIEGLKETLKALQVSKYSLQKKVSEMEQKV--QLHLLAKEDYHKQLSEIEKYYATITGQFGLVKENHEKLEQNVREAIQS 195
  F7DP49 ---V-DEK-NHEIG--ILCKKLEGV-DT------AQH-------EMAQNYERQLQAL-K--F--QLCKLKKSYEKL--HF--HQEKHQKNENAAQE--RS 128

  Q6ZRK6 NKRLSALNKKQEAEICSLKKELKKAA---SDLIKSKVTCQYKMGEENINLTIKEQKFQEL--QERLNMELELNEKINEEITHIQEEKQDIIISFQHMQQL 290
  F7DP49 RCELQWLTQKIE-EFKARSREWEKQRVFYQDQLKS-LDEQRKTLAEKCQLFQKES----LSYQEQLSSQKQLQ---SEAITNNQSE-------MRRLRCL 212

  Q6ZRK6 L---RQQIQANTEMEAELK-VLKENNQTLERDNELQREKVKENEEKFLNLQNEHEKALGTWKRHAEELNGEINKIKNELSSLKE-THI-KLQEHY-NK-- 381
  F7DP49 LDTSQETIRSDGVIIENLKSTVKE--ITLSRDS-L---K-DENQQ--L-LQ-----ELRRCQKQSQNMEAQLYKAKLELQSCNDLLRVPALEERQAQKET 297

  Q6ZRK6 --LCNQKTFE-EDKKFQNV--PEVNNENSEMSTE---KSEN-TIIQKYNTEQEIR--EENMENFCSDTEYREKEEKKEGSFIEEIIIDDLQLFEKSFK-N 469
  F7DP49 ANLANQKTAQGEEASFQ-VTDPRMN----YMTSEPEHKSFNLSKSEKYQAENDLHGTEA--KN--SDLE-R---LRKD--------IGDL-----TAKLN 371

  Q6ZRK6 EID-TVVSQDENQSEISLSKTLS-LDKEVISQGQTSNVTDNRK-SVTTEIKDKIC-LEKDNGCTEFKSPNNHFVVLDTAIETEKIHLERTRGLDVHHTD- 564
  F7DP49 QKDVTIA---------TVSRKVSRLERELELKG-----AQNRQTSMPLSQKDVIAELE-----SEM--PQIH--AVNKAPQTD-------SG-EV---DP 437

  Q6ZRK6 -VNLEV-ENNKTSFNSILNETAHNTYHNNNKDVSENEPFKQFRLLPGTREHALEKEITNSDQTKADLDSSLDIKKNPVPCQKYSLRNSSNVMLDDKQCKI 662
  F7DP49 WISIKCGEHDKPQ--------KHRSFHGENNSL---KP-TNY---ADTRNHSV-----GSEW---ESEKSL------CPWNTPTLGSAT----DD----- 499

  Q6ZRK6 KQIQLLTKKSECSILLSKQTSDFLQVCNDTLEKSELTVP-----CDIVIDH-HVSYAA---FSANSKLLL----KNSD--K--NVHSMSMLVKPNSSPGG 745
  F7DP49 ----------DCD-LVDNE-NEWLSLYNSTLYPG-LDLPPISYACDQLKDSTNSSLAGSSLISAAEKFLLEETRRASDFEKILNSHIEEM--KRNSE--- 581

  Q6ZRK6 KTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLNNENSHASQAKDVKTAVHMKTCTETEFSNKKNQIDENQVTEATKNDLFLFVSINERQHTLLNNTEK 845
  F7DP49 STVSRYQSHGQSRHI------------------------------------------------------------------------------------- 596

  Q6ZRK6 TESLNDIVSGKMFSEGQLEESHSFHIEPSGDLVNRSGRSTFDLSTSDKKTEKTPVYMNFSDPGPWSKVNHIESQTASSSTPCISLLLKERPLDPSENKKI 945
  F7DP49 ---------------------------------------------------------------------------------------------------- 596

  Q6ZRK6 ISMALCKNIGVDDVGKDIGPDTTSINRVADTLNNWSIHPDPKGEPSEEKNAMAKTFYDSSFPTEHVKTKPLISTPLQSHLQAIKTTKNTSGDDDWQSLIT 1045
  F7DP49 ---------------------------------------------------------------------------------------------------- 596

  Q6ZRK6 NQLNKSENLLSLENDNQPKKRKAEETLEKNNRLK 1079
  F7DP49 ---------------------------------- 596

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0021545 cranial nerve development
2. P GO:1990414 replication-born double-strand break repair via sister chromatid exchange
2. P GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0050870 positive regulation of T cell activation
2. P GO:0006605 protein targeting
2. P GO:0030382 sperm mitochondrion organization
2. P GO:0051260 protein homooligomerization
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0030844 positive regulation of intermediate filament depolymerization
2. P GO:0007100 mitotic centrosome separation
2. P GO:0045111 intermediate filament cytoskeleton
2. P GO:0051932 synaptic transmission, GABAergic
2. P GO:0048311 mitochondrion distribution
2. P GO:0048858 cell projection morphogenesis
2. P GO:0019896 axonal transport of mitochondrion
2. P GO:0047496 vesicle transport along microtubule
2. P GO:0071962 mitotic sister chromatid cohesion, centromeric
2. P GO:0034503 protein localization to nucleolar rDNA repeats
2. P GO:0031295 T cell costimulation
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0045121 membrane raft
2. P GO:0044295 axonal growth cone
2. P GO:0038202 TORC1 signaling
2. P GO:0030331 estrogen receptor binding
2. P GO:0005102 signaling receptor binding
2. P GO:0043086 negative regulation of catalytic activity
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0006836 neurotransmitter transport
2. P GO:0048872 homeostasis of number of cells
2. P GO:2000179 positive regulation of neural precursor cell proliferation
2. P GO:0071392 cellular response to estradiol stimulus
2. P GO:0032743 positive regulation of interleukin-2 production
2. P GO:0043621 protein self-association
2. P GO:0019894 kinesin binding
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0007310 oocyte dorsal/ventral axis specification
2. P GO:0031730 CCR5 chemokine receptor binding
2. P GO:0034090 maintenance of meiotic sister chromatid cohesion
2. P GO:0001835 blastocyst hatching
2. P GO:0007030 Golgi organization
2. P GO:0045580 regulation of T cell differentiation
2. P GO:0007099 centriole replication
2. P GO:0022008 neurogenesis
2. P GO:0007020 microtubule nucleation
2. P GO:0098972 anterograde dendritic transport of mitochondrion
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0021503 neural fold bending
2. P GO:0007287 Nebenkern assembly
2. P GO:0051177 meiotic sister chromatid cohesion
2. P GO:0051654 establishment of mitochondrion localization
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0042110 T cell activation
2. P GO:0003281 ventricular septum development
2. P GO:0030183 B cell differentiation
2. P GO:0001772 immunological synapse
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0050776 regulation of immune response
2. P GO:0007097 nuclear migration
2. P GO:0001533 cornified envelope
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0051303 establishment of chromosome localization
2. P GO:0019215 intermediate filament binding
2. P GO:0060840 artery development
2. P GO:0072089 stem cell proliferation
2. P GO:0000183 rDNA heterochromatin assembly
2. P GO:0032839 dendrite cytoplasm
2. P GO:0007420 brain development
2. P GO:0046649 lymphocyte activation
2. P GO:0000775 chromosome, centromeric region
2. P GO:0051642 centrosome localization
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0098536 deuterosome
2. P GO:0048489 synaptic vesicle transport
2. P GO:0050862 positive regulation of T cell receptor signaling pathway
2. P GO:0051455 monopolar spindle attachment to meiosis I kinetochore
2. P GO:0042102 positive regulation of T cell proliferation
2. P GO:0005769 early endosome
2. P GO:0033551 monopolin complex
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0070550 rDNA condensation
2. P GO:0031424 keratinization
2. P GO:0050700 CARD domain binding
2. P GO:0030057 desmosome
2. P GO:0042981 regulation of apoptotic process
2. P GO:1904115 axon cytoplasm
2. P GO:0050811 GABA receptor binding
2. P GO:0098957 anterograde axonal transport of mitochondrion
2. P GO:0098939 dendritic transport of mitochondrion
2. P GO:0045143 homologous chromosome segregation
2. P GO:0030890 positive regulation of B cell proliferation
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0045061 thymic T cell selection
2. P GO:0048813 dendrite morphogenesis
2. P GO:0017022 myosin binding
2. P GO:0000137 Golgi cis cisterna
2. P GO:0030911 TPR domain binding
2. P GO:0032449 CBM complex
2. P GO:0005882 intermediate filament
2. P GO:0005801 cis-Golgi network
2. P GO:0045144 meiotic sister chromatid segregation
2. P GO:0008333 endosome to lysosome transport
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0045577 regulation of B cell differentiation
2. P GO:0000776 kinetochore
2. P GO:0050771 negative regulation of axonogenesis
2. P GO:0006493 protein O-linked glycosylation
2. P GO:0031076 embryonic camera-type eye development
2. P GO:0042100 B cell proliferation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZRK6 Coiled-coil domain-containing protein 73 0 4.01e-143 0.0
1. PB Q8CDM4 Coiled-coil domain-containing protein 73 1.68e-05 9.19e-34 0.0
2. P Q9ESV1 Leucine zipper protein 1 2.05e-02 6.48e-04 NA
2. P P86839 Nestin 2.45e-04 1.68e-06 NA
2. P Q9DCD5 Tight junction-associated protein 1 3.67e-02 3.97e-02 NA
2. P F7DP49 Deuterosome assembly protein 1 1.04e-05 5.50e-04 NA
2. P Q04087 Monopolin complex subunit LRS4 4.97e-02 3.96e-04 NA
2. P Q960V3 Trafficking kinesin-binding protein milt 8.84e-03 2.19e-04 NA
2. P Q9SLN1 Filament-like plant protein 7 3.22e-03 3.94e-02 NA
2. P Q9C698 Filament-like plant protein 6 7.50e-05 9.84e-03 NA
2. P Q08AF8 Putative golgin subfamily A member 8F/8G 5.04e-04 4.47e-02 NA
2. P Q9UPV9 Trafficking kinesin-binding protein 1 1.28e-02 3.53e-02 NA
2. P O45717 Protein nud-2 3.81e-05 2.86e-02 NA
2. P Q9BXL7 Caspase recruitment domain-containing protein 11 3.30e-03 3.56e-02 NA
2. P Q8R4U7 Leucine zipper protein 1 8.18e-04 1.47e-04 NA
2. P Q01550 Tanabin 4.29e-02 1.63e-04 NA
2. P E3VXF2 Shugoshin-1 1.19e-01 4.85e-03 NA
2. P Q8CIS0 Caspase recruitment domain-containing protein 11 7.34e-04 1.63e-02 NA
2. P Q32MZ4 Leucine-rich repeat flightless-interacting protein 1 8.92e-02 2.44e-06 NA
2. P Q674X7 Kazrin 3.49e-03 4.98e-02 NA
2. P Q66HF9 Leucine-rich repeat flightless-interacting protein 1 2.08e-02 1.73e-05 NA
2. P Q5FBB7 Shugoshin 1 2.06e-01 1.37e-02 NA
2. P Q0D2H9 Putative golgin subfamily A member 8D 7.68e-03 2.10e-02 NA
2. P Q6R6L0 Brain-enriched guanylate kinase-associated protein 9.38e-03 1.60e-03 NA
2. P Q86V48 Leucine zipper protein 1 2.32e-03 3.65e-07 NA
2. P Q6P9F0 Coiled-coil domain-containing protein 62 2.69e-04 3.73e-06 NA
2. P E9PVD1 Coiled-coil domain-containing protein 62 5.39e-04 1.72e-03 NA
2. P P48681 Nestin 1.51e-01 3.00e-02 NA
2. P Q8R2H7 Trafficking kinesin-binding protein 2 7.64e-03 1.59e-02 NA