Summary

Q6ZRP5

Homolog: P02734.
Function: Ice-structuring protein 4.

Statistics

Total GO Annotation: 2
Unique PROST Go: 2
Unique BLAST Go: 0

Total Homologs: 12
Unique PROST Homologs: 11
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P02734 (Ice-structuring protein 4) with a FATCAT P-Value: 0.0197 and RMSD of 3.12 angstrom. The sequence alignment identity is 8.0%.
Structural alignment shown in left. Query protein Q6ZRP5 colored as red in alignment, homolog P02734 colored as blue. Query protein Q6ZRP5 is also shown in right top, homolog P02734 showed in right bottom. They are colored based on secondary structures.

  Q6ZRP5 MRIFRGCTQPSTLGQGVHSPLMKAQFITHHSRKQVKPGEGWGRSSFTRACRDHTTILSGNRSFSAVAATPAKHKHMHTRTHTHMHTHTGMHTLTGTHVHT 100
  P02734 ---------------------------------------------------------------------------------------------------- 0

  Q6ZRP5 PHTQMHTRILTLSHMH-THAHTHAHTHGHTHTRAHSTHAHTHAHSHYHTRTLTLTHSHAHSCTLTSTITHMHTHTHMHTHTSTLTRTLTLTHTHMHTFLS 199
  P02734 --------------MRITEANPDPDAKAVPAAAAPSTASDAAAAAA-AT---AATAAAAAAAT-AATAAAAAAAT-----AATAAKAAALTAANAAAAAA 76

  Q6ZRP5 LVSHLA--GYISCQFIFSSENPRLCH 223
  P02734 ATAAAAARG----------------- 85

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0050825 ice binding
2. P GO:0005576 extracellular region

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZRP5 Putative uncharacterized protein FLJ46204 0 1.08e-142 2.02e-149
2. P P53820 Putative uncharacterized protein YNL338W 2.18e-01 4.75e-04 NA
2. P P21733 Uncharacterized 29.1 kDa protein in cryB1 5'region 9.92e-01 4.35e-03 NA
2. P Q5T7N8 Protein FAM27D1 1.82e-01 1.70e-02 NA
2. P E2RYF7 Protein PBMUCL2 2.90e-01 7.84e-04 NA
2. P Q80X32 UPF0461 protein C5orf24 homolog 1.76e-01 6.58e-05 NA
2. P P02734 Ice-structuring protein 4 1.97e-02 6.48e-03 NA
2. P Q0II29 UPF0461 protein C5orf24 homolog 5.82e-01 1.19e-03 NA
2. P Q6IC83 Uncharacterized protein C22orf42 4.63e-01 2.00e-03 NA
2. P Q8TGJ7 Uncharacterized protein YLL066W-B 3.23e-01 3.26e-04 NA
2. P P40524 Uncharacterized membrane protein YIL054W 5.52e-02 2.21e-02 NA
2. P Q07811 Putative uncharacterized protein YLL020C 2.89e-02 5.89e-03 NA