Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q68UT4
(Melanocortin-2 receptor accessory protein) with a FATCAT P-Value: 0.0202 and RMSD of 3.64 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein Q6ZS52 colored as red in alignment, homolog Q68UT4 colored as blue.
Query protein Q6ZS52 is also shown in right top, homolog Q68UT4 showed in right bottom. They are colored based on secondary structures.
Q6ZS52 MHQTHAIQRLEVLPSFSNESPTSRETSESWTNQDDIFYAYASMSPGAEHRGTTQLLRFQLAPI--KKLEG-----------SLQTH----FLLSSLHPRM 83 Q68UT4 --------------------------MANGTNASAPYYSY-------EY----YLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLI-LLY--M 60 Q6ZS52 TFPGRAGGGEAGSRPPRR---PWA-GI---LILQ--LP------STRGGRRSG--HGAVRSWGPWKVVAEQ-----PVG--GTDP------PAHGG---R 150 Q68UT4 SW---SGSPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGS-RT-GPDQPLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVR 155 Q6ZS52 GRPS---PNENT----- 159 Q68UT4 SKPSEPPPGDRTSQLQS 172
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:1902510 | regulation of apoptotic DNA fragmentation |
| 2. P | GO:0033088 | negative regulation of immature T cell proliferation in thymus |
| 2. P | GO:0010389 | regulation of G2/M transition of mitotic cell cycle |
| 2. P | GO:0031780 | corticotropin hormone receptor binding |
| 2. P | GO:0090398 | cellular senescence |
| 2. P | GO:0008134 | transcription factor binding |
| 2. P | GO:0008637 | apoptotic mitochondrial changes |
| 2. P | GO:0070534 | protein K63-linked ubiquitination |
| 2. P | GO:0044196 | host cell nucleolus |
| 2. P | GO:0000422 | autophagy of mitochondrion |
| 2. P | GO:0019789 | SUMO transferase activity |
| 2. P | GO:0050873 | brown fat cell differentiation |
| 2. P | GO:1903214 | regulation of protein targeting to mitochondrion |
| 2. P | GO:0051882 | mitochondrial depolarization |
| 2. P | GO:1904667 | negative regulation of ubiquitin protein ligase activity |
| 2. P | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:1990948 | ubiquitin ligase inhibitor activity |
| 2. P | GO:0097371 | MDM2/MDM4 family protein binding |
| 2. P | GO:0106070 | regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0055105 | ubiquitin-protein transferase inhibitor activity |
| 2. P | GO:1900182 | positive regulation of protein localization to nucleus |
| 2. P | GO:0072659 | protein localization to plasma membrane |
| 2. P | GO:1903051 | negative regulation of proteolysis involved in cellular protein catabolic process |
| 2. P | GO:0031783 | type 5 melanocortin receptor binding |
| 2. P | GO:0005783 | endoplasmic reticulum |
| 2. P | GO:0008452 | RNA ligase activity |
| 2. P | GO:0030545 | signaling receptor regulator activity |
| 2. P | GO:1903077 | negative regulation of protein localization to plasma membrane |
| 2. P | GO:0033235 | positive regulation of protein sumoylation |
| 2. P | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 2. P | GO:0031782 | type 4 melanocortin receptor binding |
| 2. P | GO:0097718 | disordered domain specific binding |
| 2. P | GO:1990000 | amyloid fibril formation |
| 2. P | GO:0106071 | positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0106072 | negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0070996 | type 1 melanocortin receptor binding |
| 2. P | GO:0030889 | negative regulation of B cell proliferation |
| 2. P | GO:0031781 | type 3 melanocortin receptor binding |
| 2. P | GO:0002039 | p53 binding |
| 2. P | GO:0046825 | regulation of protein export from nucleus |
| 2. P | GO:0031647 | regulation of protein stability |
| 2. P | GO:0006469 | negative regulation of protein kinase activity |
| 2. P | GO:0005789 | endoplasmic reticulum membrane |
| 2. P | GO:1901798 | positive regulation of signal transduction by p53 class mediator |
| 2. P | GO:0031648 | protein destabilization |
| 2. P | GO:2000435 | negative regulation of protein neddylation |
| 2. P | GO:0006396 | RNA processing |
| 2. P | GO:0048103 | somatic stem cell division |
| 2. P | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0051444 | negative regulation of ubiquitin-protein transferase activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZS52 | Putative uncharacterized protein FLJ45825 | 0 | 2.63e-147 | 1.32e-113 |
| 2. P | P65086 | Uncharacterized protein Mb3458c | 4.36e-01 | 2.88e-03 | NA |
| 2. P | P75675 | Putative uncharacterized protein YkfJ | 5.40e-01 | 1.97e-03 | NA |
| 2. P | Q8TCY5 | Melanocortin-2 receptor accessory protein | 4.85e-02 | 7.59e-03 | NA |
| 2. P | P9WKY3 | Uncharacterized protein Rv3424c | 5.21e-01 | 2.88e-03 | NA |
| 2. P | Q6ZVU0 | Putative uncharacterized protein FLJ42102 | 7.57e-01 | 1.31e-03 | NA |
| 2. P | Q8N726 | Tumor suppressor ARF | 2.12e-01 | 6.10e-03 | NA |
| 2. P | P9WLE4 | Uncharacterized protein MT2345.1 | 6.21e-01 | 7.36e-03 | NA |
| 2. P | P0CT01 | UPF0329 protein ECU11_0080 | 1.93e-02 | 2.96e-03 | NA |
| 2. P | Q9ZGS5 | Uncharacterized protein YuaZ | 7.65e-01 | 2.50e-02 | NA |
| 2. P | Q68UT4 | Melanocortin-2 receptor accessory protein | 2.02e-02 | 3.35e-02 | NA |
| 2. P | P9WKY2 | Uncharacterized protein MT3532.2 | 5.80e-01 | 2.88e-03 | NA |
| 2. P | P32630 | Protein UTR5 | 8.94e-01 | 2.21e-02 | NA |
| 2. P | Q8X7P0 | Uncharacterized protein YkfJ | 1.63e-01 | 2.55e-03 | NA |
| 2. P | Q9H2J1 | Uncharacterized protein ARRDC1-AS1 | 5.70e-02 | 2.76e-04 | NA |
| 2. P | P9WLE5 | Uncharacterized protein Rv2288 | 7.47e-01 | 7.36e-03 | NA |
| 2. P | P0CT00 | UPF0329 protein ECU05_1650 | 5.98e-02 | 9.56e-04 | NA |
| 2. P | P64976 | Uncharacterized protein Mb2310 | 5.23e-01 | 7.36e-03 | NA |
| 2. P | P15830 | Protein Rev | NA | 7.12e-04 | NA |
| 2. P | Q5QJJ0 | Uncharacterized protein YuaZ | 8.20e-01 | 2.50e-02 | NA |
| 2. P | Q9D159 | Melanocortin-2 receptor accessory protein | 2.80e-02 | 1.54e-03 | NA |
| 2. P | P16819 | Uncharacterized protein UL62 | NA | 7.08e-03 | NA |
| 2. P | Q98185 | Protein MC014 | NA | 1.42e-03 | NA |
| 2. P | I3L1E1 | Uncharacterized protein C19orf84 | 1.69e-02 | 1.28e-03 | NA |