Summary

Q6ZS52

Homolog: Q68UT4.
Function: Melanocortin-2 receptor accessory protein.

Statistics

Total GO Annotation: 51
Unique PROST Go: 51
Unique BLAST Go: 0

Total Homologs: 24
Unique PROST Homologs: 23
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q68UT4 (Melanocortin-2 receptor accessory protein) with a FATCAT P-Value: 0.0202 and RMSD of 3.64 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein Q6ZS52 colored as red in alignment, homolog Q68UT4 colored as blue. Query protein Q6ZS52 is also shown in right top, homolog Q68UT4 showed in right bottom. They are colored based on secondary structures. 

  Q6ZS52 MHQTHAIQRLEVLPSFSNESPTSRETSESWTNQDDIFYAYASMSPGAEHRGTTQLLRFQLAPI--KKLEG-----------SLQTH----FLLSSLHPRM 83
  Q68UT4 --------------------------MANGTNASAPYYSY-------EY----YLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLI-LLY--M 60

  Q6ZS52 TFPGRAGGGEAGSRPPRR---PWA-GI---LILQ--LP------STRGGRRSG--HGAVRSWGPWKVVAEQ-----PVG--GTDP------PAHGG---R 150
  Q68UT4 SW---SGSPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGS-RT-GPDQPLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVR 155

  Q6ZS52 GRPS---PNENT----- 159
  Q68UT4 SKPSEPPPGDRTSQLQS 172

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1902510 regulation of apoptotic DNA fragmentation
2. P GO:0033088 negative regulation of immature T cell proliferation in thymus
2. P GO:0010389 regulation of G2/M transition of mitotic cell cycle
2. P GO:0031780 corticotropin hormone receptor binding
2. P GO:0090398 cellular senescence
2. P GO:0008134 transcription factor binding
2. P GO:0008637 apoptotic mitochondrial changes
2. P GO:0070534 protein K63-linked ubiquitination
2. P GO:0044196 host cell nucleolus
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0019789 SUMO transferase activity
2. P GO:0050873 brown fat cell differentiation
2. P GO:1903214 regulation of protein targeting to mitochondrion
2. P GO:0051882 mitochondrial depolarization
2. P GO:1904667 negative regulation of ubiquitin protein ligase activity
2. P GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:1990948 ubiquitin ligase inhibitor activity
2. P GO:0097371 MDM2/MDM4 family protein binding
2. P GO:0106070 regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0055105 ubiquitin-protein transferase inhibitor activity
2. P GO:1900182 positive regulation of protein localization to nucleus
2. P GO:0072659 protein localization to plasma membrane
2. P GO:1903051 negative regulation of proteolysis involved in cellular protein catabolic process
2. P GO:0031783 type 5 melanocortin receptor binding
2. P GO:0005783 endoplasmic reticulum
2. P GO:0008452 RNA ligase activity
2. P GO:0030545 signaling receptor regulator activity
2. P GO:1903077 negative regulation of protein localization to plasma membrane
2. P GO:0033235 positive regulation of protein sumoylation
2. P GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
2. P GO:0031782 type 4 melanocortin receptor binding
2. P GO:0097718 disordered domain specific binding
2. P GO:1990000 amyloid fibril formation
2. P GO:0106071 positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0106072 negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0070996 type 1 melanocortin receptor binding
2. P GO:0030889 negative regulation of B cell proliferation
2. P GO:0031781 type 3 melanocortin receptor binding
2. P GO:0002039 p53 binding
2. P GO:0046825 regulation of protein export from nucleus
2. P GO:0031647 regulation of protein stability
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:1901798 positive regulation of signal transduction by p53 class mediator
2. P GO:0031648 protein destabilization
2. P GO:2000435 negative regulation of protein neddylation
2. P GO:0006396 RNA processing
2. P GO:0048103 somatic stem cell division
2. P GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
2. P GO:0051444 negative regulation of ubiquitin-protein transferase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZS52 Putative uncharacterized protein FLJ45825 0 2.63e-147 1.32e-113
2. P P65086 Uncharacterized protein Mb3458c 4.36e-01 2.88e-03 NA
2. P P75675 Putative uncharacterized protein YkfJ 5.40e-01 1.97e-03 NA
2. P Q8TCY5 Melanocortin-2 receptor accessory protein 4.85e-02 7.59e-03 NA
2. P P9WKY3 Uncharacterized protein Rv3424c 5.21e-01 2.88e-03 NA
2. P Q6ZVU0 Putative uncharacterized protein FLJ42102 7.57e-01 1.31e-03 NA
2. P Q8N726 Tumor suppressor ARF 2.12e-01 6.10e-03 NA
2. P P9WLE4 Uncharacterized protein MT2345.1 6.21e-01 7.36e-03 NA
2. P P0CT01 UPF0329 protein ECU11_0080 1.93e-02 2.96e-03 NA
2. P Q9ZGS5 Uncharacterized protein YuaZ 7.65e-01 2.50e-02 NA
2. P Q68UT4 Melanocortin-2 receptor accessory protein 2.02e-02 3.35e-02 NA
2. P P9WKY2 Uncharacterized protein MT3532.2 5.80e-01 2.88e-03 NA
2. P P32630 Protein UTR5 8.94e-01 2.21e-02 NA
2. P Q8X7P0 Uncharacterized protein YkfJ 1.63e-01 2.55e-03 NA
2. P Q9H2J1 Uncharacterized protein ARRDC1-AS1 5.70e-02 2.76e-04 NA
2. P P9WLE5 Uncharacterized protein Rv2288 7.47e-01 7.36e-03 NA
2. P P0CT00 UPF0329 protein ECU05_1650 5.98e-02 9.56e-04 NA
2. P P64976 Uncharacterized protein Mb2310 5.23e-01 7.36e-03 NA
2. P P15830 Protein Rev NA 7.12e-04 NA
2. P Q5QJJ0 Uncharacterized protein YuaZ 8.20e-01 2.50e-02 NA
2. P Q9D159 Melanocortin-2 receptor accessory protein 2.80e-02 1.54e-03 NA
2. P P16819 Uncharacterized protein UL62 NA 7.08e-03 NA
2. P Q98185 Protein MC014 NA 1.42e-03 NA
2. P I3L1E1 Uncharacterized protein C19orf84 1.69e-02 1.28e-03 NA