Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8BUP8
(Protein FAM43A) with a FATCAT P-Value: 9.4e-08 and RMSD of 3.22 angstrom. The sequence alignment identity is 37.1%.
Structural alignment shown in left. Query protein Q6ZT52 colored as red in alignment, homolog Q8BUP8 colored as blue.
Query protein Q6ZT52 is also shown in right top, homolog Q8BUP8 showed in right bottom. They are colored based on secondary structures.
Q6ZT52 MLPWRRNKFVLVED-----EAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAV 95 Q8BUP8 MLPWKKHKFELLAEAPPRQASKPKGYAVS--LHY-SALSSLARAC----PEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAV 93 Q6ZT52 GKIWARCGPG-GGTKMKLTLGPHGIRMQPCERSAAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALARLL 194 Q8BUP8 GKIWSKSEAGRQGTKMKLTVSAQGIRMVHAEERAL-----RRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLL 188 Q6ZT52 RQTALAAFSDFKRLQRQSDARHVRQQHLRAGGAAASVPRAPLRR-LLNAKCAYRPPPSERSRGAPRLSSI--------QEED--EEEEE--DDA----EE 277 Q8BUP8 YQTSANALAEFKRLKRRDDARH-QQQEL-VG--AHTIPLVPLRKLLLHGPCCYK-PPVERSRSAPKLGSITEDLLGEQQEEELQEEEEEHLEDCLEEEEE 283 Q6ZT52 QEG---GVPQRERPE---VLSLARELRTC-SLRGAPAPPPPAQPRRWKAGPRERAGQAR----------------------------------------- 329 Q8BUP8 EDGVGDGDPAEEEAEAQRALVVAMQLE-CEDLL-----DPLEN------GHEEALGDGGVSLGPSSGTSLPLSVCASDMKAQLSQLISDLGDLSFGNDVS 371 Q6ZT52 ----------------------------------------------------- 329 Q8BUP8 TLETDLRVTRLLSGESTGSESSIEGGGLDATPVSPGNPSGPADSTSLDEPYSG 424
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1904707 | positive regulation of vascular associated smooth muscle cell proliferation |
| 1. PB | GO:0035591 | signaling adaptor activity |
| 1. PB | GO:0030159 | signaling receptor complex adaptor activity |
| 1. PB | GO:0009898 | cytoplasmic side of plasma membrane |
| 1. PB | GO:0043393 | regulation of protein binding |
| 1. PB | GO:0042632 | cholesterol homeostasis |
| 1. PB | GO:0005769 | early endosome |
| 1. PB | GO:0009925 | basal plasma membrane |
| 1. PB | GO:0001784 | phosphotyrosine residue binding |
| 1. PB | GO:0008203 | cholesterol metabolic process |
| 1. PB | GO:0055037 | recycling endosome |
| 1. PB | GO:0071345 | cellular response to cytokine stimulus |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0005883 | neurofilament |
| 1. PB | GO:0031623 | receptor internalization |
| 1. PB | GO:0030669 | clathrin-coated endocytic vesicle membrane |
| 1. PB | GO:0035650 | AP-1 adaptor complex binding |
| 1. PB | GO:1905581 | positive regulation of low-density lipoprotein particle clearance |
| 1. PB | GO:0006898 | receptor-mediated endocytosis |
| 1. PB | GO:0050750 | low-density lipoprotein particle receptor binding |
| 1. PB | GO:0006897 | endocytosis |
| 1. PB | GO:0048260 | positive regulation of receptor-mediated endocytosis |
| 1. PB | GO:0030276 | clathrin binding |
| 1. PB | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 1. PB | GO:0001540 | amyloid-beta binding |
| 1. PB | GO:0090118 | receptor-mediated endocytosis involved in cholesterol transport |
| 1. PB | GO:0035612 | AP-2 adaptor complex binding |
| 1. PB | GO:0030301 | cholesterol transport |
| 1. PB | GO:0042982 | amyloid precursor protein metabolic process |
| 1. PB | GO:1903076 | regulation of protein localization to plasma membrane |
| 1. PB | GO:1905602 | positive regulation of receptor-mediated endocytosis involved in cholesterol transport |
| 1. PB | GO:0034383 | low-density lipoprotein particle clearance |
| 1. PB | GO:0035615 | clathrin adaptor activity |
| 1. PB | GO:0090205 | positive regulation of cholesterol metabolic process |
| 2. P | GO:0046907 | intracellular transport |
| 2. P | GO:0050790 | regulation of catalytic activity |
| 2. P | GO:0051028 | mRNA transport |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0005643 | nuclear pore |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0006112 | energy reserve metabolic process |
| 3. B | GO:0070346 | positive regulation of fat cell proliferation |
| 3. B | GO:0046627 | negative regulation of insulin receptor signaling pathway |
| 3. B | GO:0010635 | regulation of mitochondrial fusion |
| 3. B | GO:0010628 | positive regulation of gene expression |
| 3. B | GO:1903077 | negative regulation of protein localization to plasma membrane |
| 3. B | GO:0071354 | cellular response to interleukin-6 |
| 3. B | GO:2001170 | negative regulation of ATP biosynthetic process |
| 3. B | GO:0044320 | cellular response to leptin stimulus |
| 3. B | GO:2000377 | regulation of reactive oxygen species metabolic process |
| 3. B | GO:0001933 | negative regulation of protein phosphorylation |
| 3. B | GO:2000379 | positive regulation of reactive oxygen species metabolic process |
| 3. B | GO:0051881 | regulation of mitochondrial membrane potential |
| 3. B | GO:2001171 | positive regulation of ATP biosynthetic process |
| 3. B | GO:0071398 | cellular response to fatty acid |
| 3. B | GO:0046325 | negative regulation of glucose import |
| 3. B | GO:0070584 | mitochondrion morphogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q67FQ3 | Low density lipoprotein receptor adapter protein 1-B | 1.00e-03 | 1.34e-08 | 1.16e-07 |
| 1. PB | Q5SW96 | Low density lipoprotein receptor adapter protein 1 | 6.03e-04 | 1.63e-07 | 8.37e-07 |
| 1. PB | Q801G1 | Low density lipoprotein receptor adapter protein 1-A | 3.67e-04 | 3.55e-09 | 2.24e-07 |
| 1. PB | Q8BUP8 | Protein FAM43A | 9.40e-08 | 3.30e-02 | 2.19e-81 |
| 1. PB | D3ZAR1 | Low density lipoprotein receptor adapter protein 1 | 9.30e-05 | 6.20e-08 | 6.73e-05 |
| 1. PB | Q6ZT52 | Protein FAM43B | 0 | 2.69e-123 | 0.0 |
| 1. PB | Q8N2R8 | Protein FAM43A | 1.56e-05 | 1.25e-02 | 3.06e-82 |
| 1. PB | Q8C142 | Low density lipoprotein receptor adapter protein 1 | 3.62e-04 | 9.89e-09 | 3.76e-07 |
| 2. P | Q8NEG0 | Protein FAM71C | 5.19e-02 | 8.22e-03 | NA |
| 2. P | Q32L49 | Protein FAM71E1 | 2.57e-02 | 1.65e-04 | NA |
| 2. P | A1L3C1 | Protein FAM71E1 | 8.57e-02 | 6.85e-06 | NA |
| 2. P | Q9LMK7 | Ran-binding protein 1 homolog a | 2.70e-03 | 9.59e-03 | NA |
| 2. P | Q6NXP2 | Protein FAM71F2 | 3.78e-02 | 1.90e-02 | NA |
| 2. P | Q68FV5 | Protein FAM71F1 | 2.34e-02 | 1.07e-06 | NA |
| 2. P | P92985 | Ran-binding protein 1 homolog c | 9.33e-03 | 4.66e-03 | NA |
| 2. P | Q2KIP3 | Protein FAM71F1 | 2.21e-02 | 1.71e-05 | NA |
| 2. P | Q96KD3 | Protein FAM71F1 | 2.04e-02 | 1.81e-06 | NA |
| 2. P | Q5RJN7 | Protein FAM71F2 | 1.06e-01 | 4.81e-04 | NA |
| 2. P | Q3UZD7 | Protein FAM71F1 | 8.44e-02 | 4.77e-07 | NA |
| 3. B | Q3UBG2 | PTB-containing, cubilin and LRP1-interacting protein | 1.13e-05 | NA | 4.68e-04 |
| 3. B | Q7Z2X4 | PTB-containing, cubilin and LRP1-interacting protein | 9.77e-05 | NA | 4.10e-05 |