Results | PROST

Summary

Q6ZTU2

Homolog: Q1KKX5.
Function: Homeobox protein Hox-B1a.

Statistics

Total GO Annotation: 359
Unique PROST Go: 349
Unique BLAST Go: 9

Total Homologs: 156
Unique PROST Homologs: 153
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q1KKX5 (Homeobox protein Hox-B1a) with a FATCAT P-Value: 0.0358 and RMSD of 7.68 angstrom. The sequence alignment identity is 22.3%.
Structural alignment shown in left. Query protein Q6ZTU2 colored as red in alignment, homolog Q1KKX5 colored as blue. Query protein Q6ZTU2 is also shown in right top, homolog Q1KKX5 showed in right bottom. They are colored based on secondary structures.

  Q6ZTU2 MQHVSSSQSSQRHVQWPGACPGAGEEQPACSQPSLPLTLPSPSHQLQQLMVRGGPAGGQNMN--VDLQGVGPGLQGSPQVTLAPLPLPSPTSPGFQFSAQ 98
  Q1KKX5 ---------------------------------------------------------MDNMNSFVEY-----SICNRP-ATGA-YSVPK--S-GYH-SHH 32

  Q6ZTU2 PRRFEHGSPSYIQVTSPLSQQ----VQTQS-PTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGDFVDASVLVRQISLSPSSGGHFVFQDGS-GLTQIAQ 192
  Q1KKX5 HLHHHH---------HPLDQNQGFPVTTGSFHTGLAASPA-AVNGSRTDSSAPG---AVYNPDG---------R---LYGTAG-----EEGAHGAT---- 98

  Q6ZTU2 G-AQVQLQHP-GTPITVRERRP-----SQPH--TQS--GGTI-H--HLGPQSPAAAGG--------AGLQPLAS------PS-----H---IT-TA-NLP 254
  Q1KKX5 GTSQHHHQHPHHFP----EQQPEQNGYSHPHLQTQTLQSGTLSHYNH-GSSGSAYAGQSCARNSEYASTNTIHSHYYMEEPAASTYYHQSSFTSTAPTVG 193

  Q6ZTU2 PQISSIIQGQLVQQQQVLQGPPLPRPL--GFERTPGVL-LPGAGGAAGFGMTSPPPPTSPSR-TAVPPGLSSLPLTSVGNT--GMKKVPKKLEEIPPASP 348
  Q1KKX5 PSYGA-LAGAYCGPQGALAGSQYPQQLVGGLD-AAGYLGLP-QG---GYG----EPQTTQERERGGEEGQQA----GQGQTFDWM-KV-KR---NPPKTV 274

  Q6ZTU2 EMAQMRKQCLDYHHQEMQALKEVFK-EYLIEL---FFLQHFQGNMMDFLAFKERLYGPLQAYLRQNDLDIEEEEEEHFEVINDEVKVVAR-KHGQPGTPV 443
  Q1KKX5 KVSDFG---LAGAHN--SAIRTNFSTRQLTELEKEF---HFS----KYLTRARRV--EIAATLELNETQV----KIWFQ--NRRMKQKKREREG--GC-- 350

  Q6ZTU2 AIATQLPPRT--SAAFPAQQQPLQQI-HMGTPV-PGDVNSIKMEASKRQ-- 488
  Q1KKX5 --AT---PRTPSSSGF---NKELEDTDHSSTSTSPG--ASPSSETSSERAA 391

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0003682	chromatin binding
2. P	GO:0019086	late viral transcription
2. P	GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P	GO:0051594	detection of glucose
2. P	GO:0001570	vasculogenesis
2. P	GO:0030014	CCR4-NOT complex
2. P	GO:0050905	neuromuscular process
2. P	GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
2. P	GO:0042473	outer ear morphogenesis
2. P	GO:0035136	forelimb morphogenesis
2. P	GO:0000122	negative regulation of transcription by RNA polymerase II
2. P	GO:0021661	rhombomere 4 morphogenesis
2. P	GO:0060113	inner ear receptor cell differentiation
2. P	GO:0008283	cell population proliferation
2. P	GO:0048709	oligodendrocyte differentiation
2. P	GO:0017025	TBP-class protein binding
2. P	GO:0006325	chromatin organization
2. P	GO:0060217	hemangioblast cell differentiation
2. P	GO:0021754	facial nucleus development
2. P	GO:0001744	insect visual primordium formation
2. P	GO:0007507	heart development
2. P	GO:0035497	cAMP response element binding
2. P	GO:0046697	decidualization
2. P	GO:0051059	NF-kappaB binding
2. P	GO:0060412	ventricular septum morphogenesis
2. P	GO:0007605	sensory perception of sound
2. P	GO:0050693	LBD domain binding
2. P	GO:0019894	kinesin binding
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0016574	histone ubiquitination
2. P	GO:0070986	left/right axis specification
2. P	GO:0048359	mucilage metabolic process involved in seed coat development
2. P	GO:0008406	gonad development
2. P	GO:0001092	TFIIA-class transcription factor complex binding
2. P	GO:0019094	pole plasm mRNA localization
2. P	GO:0090543	Flemming body
2. P	GO:1990391	DNA repair complex
2. P	GO:0021520	spinal cord motor neuron cell fate specification
2. P	GO:0030902	hindbrain development
2. P	GO:0008219	cell death
2. P	GO:0061156	pulmonary artery morphogenesis
2. P	GO:0043565	sequence-specific DNA binding
2. P	GO:0035224	genital disc anterior/posterior pattern formation
2. P	GO:0050885	neuromuscular process controlling balance
2. P	GO:0045860	positive regulation of protein kinase activity
2. P	GO:0048704	embryonic skeletal system morphogenesis
2. P	GO:0031519	PcG protein complex
2. P	GO:0048702	embryonic neurocranium morphogenesis
2. P	GO:0030336	negative regulation of cell migration
2. P	GO:0090444	regulation of nematode larval development, heterochronic
2. P	GO:2000036	regulation of stem cell population maintenance
2. P	GO:2000078	positive regulation of type B pancreatic cell development
2. P	GO:0005667	transcription regulator complex
2. P	GO:0007634	optokinetic behavior
2. P	GO:0030097	hemopoiesis
2. P	GO:0002089	lens morphogenesis in camera-type eye
2. P	GO:0048636	positive regulation of muscle organ development
2. P	GO:0071217	cellular response to external biotic stimulus
2. P	GO:0072718	response to cisplatin
2. P	GO:0007492	endoderm development
2. P	GO:0007417	central nervous system development
2. P	GO:0035102	PRC1 complex
2. P	GO:0002521	leukocyte differentiation
2. P	GO:0048536	spleen development
2. P	GO:0045637	regulation of myeloid cell differentiation
2. P	GO:0000124	SAGA complex
2. P	GO:2001222	regulation of neuron migration
2. P	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
2. P	GO:0007280	pole cell migration
2. P	GO:0021602	cranial nerve morphogenesis
2. P	GO:0061429	positive regulation of transcription from RNA polymerase II promoter by oleic acid
2. P	GO:0021599	abducens nerve formation
2. P	GO:1990904	ribonucleoprotein complex
2. P	GO:0036499	PERK-mediated unfolded protein response
2. P	GO:0090103	cochlea morphogenesis
2. P	GO:0005886	plasma membrane
2. P	GO:0045799	positive regulation of chromatin assembly or disassembly
2. P	GO:0003151	outflow tract morphogenesis
2. P	GO:0022409	positive regulation of cell-cell adhesion
2. P	GO:0014036	neural crest cell fate specification
2. P	GO:2000819	regulation of nucleotide-excision repair
2. P	GO:1905222	atrioventricular canal morphogenesis
2. P	GO:0048844	artery morphogenesis
2. P	GO:0006355	regulation of transcription, DNA-templated
2. P	GO:0030219	megakaryocyte differentiation
2. P	GO:0016592	mediator complex
2. P	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
2. P	GO:0001222	transcription corepressor binding
2. P	GO:0009952	anterior/posterior pattern specification
2. P	GO:0043249	erythrocyte maturation
2. P	GO:0048477	oogenesis
2. P	GO:0048821	erythrocyte development
2. P	GO:0071361	cellular response to ethanol
2. P	GO:0043627	response to estrogen
2. P	GO:0009996	negative regulation of cell fate specification
2. P	GO:0048839	inner ear development
2. P	GO:2000218	negative regulation of invasive growth in response to glucose limitation
2. P	GO:0140467	integrated stress response signaling
2. P	GO:0008045	motor neuron axon guidance
2. P	GO:0002064	epithelial cell development
2. P	GO:0006367	transcription initiation from RNA polymerase II promoter
2. P	GO:0003680	minor groove of adenine-thymine-rich DNA binding
2. P	GO:0007100	mitotic centrosome separation
2. P	GO:1900164	nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry
2. P	GO:0061061	muscle structure development
2. P	GO:0042659	regulation of cell fate specification
2. P	GO:0003160	endocardium morphogenesis
2. P	GO:0007179	transforming growth factor beta receptor signaling pathway
2. P	GO:0060018	astrocyte fate commitment
2. P	GO:0043130	ubiquitin binding
2. P	GO:0023019	signal transduction involved in regulation of gene expression
2. P	GO:0016363	nuclear matrix
2. P	GO:0048511	rhythmic process
2. P	GO:1900240	negative regulation of phenotypic switching
2. P	GO:0010763	positive regulation of fibroblast migration
2. P	GO:0042974	retinoic acid receptor binding
2. P	GO:0001947	heart looping
2. P	GO:1900746	regulation of vascular endothelial growth factor signaling pathway
2. P	GO:0006366	transcription by RNA polymerase II
2. P	GO:0035162	embryonic hemopoiesis
2. P	GO:0001843	neural tube closure
2. P	GO:0005634	nucleus
2. P	GO:1990527	Tec1p-Ste12p-Dig1p complex
2. P	GO:0042694	muscle cell fate specification
2. P	GO:0061308	cardiac neural crest cell development involved in heart development
2. P	GO:0030218	erythrocyte differentiation
2. P	GO:0045787	positive regulation of cell cycle
2. P	GO:0010629	negative regulation of gene expression
2. P	GO:0003197	endocardial cushion development
2. P	GO:0060216	definitive hemopoiesis
2. P	GO:0071364	cellular response to epidermal growth factor stimulus
2. P	GO:0098534	centriole assembly
2. P	GO:0051425	PTB domain binding
2. P	GO:0051879	Hsp90 protein binding
2. P	GO:0000785	chromatin
2. P	GO:0044613	nuclear pore central transport channel
2. P	GO:0030297	transmembrane receptor protein tyrosine kinase activator activity
2. P	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0001221	transcription coregulator binding
2. P	GO:0030183	B cell differentiation
2. P	GO:0045840	positive regulation of mitotic nuclear division
2. P	GO:0048644	muscle organ morphogenesis
2. P	GO:0003677	DNA binding
2. P	GO:0097178	ruffle assembly
2. P	GO:0001764	neuron migration
2. P	GO:0060840	artery development
2. P	GO:0060971	embryonic heart tube left/right pattern formation
2. P	GO:0061101	neuroendocrine cell differentiation
2. P	GO:0030178	negative regulation of Wnt signaling pathway
2. P	GO:0007422	peripheral nervous system development
2. P	GO:0016602	CCAAT-binding factor complex
2. P	GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
2. P	GO:0034405	response to fluid shear stress
2. P	GO:0031016	pancreas development
2. P	GO:1903438	positive regulation of mitotic cytokinetic process
2. P	GO:0051512	positive regulation of unidimensional cell growth
2. P	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
2. P	GO:0046332	SMAD binding
2. P	GO:0045931	positive regulation of mitotic cell cycle
2. P	GO:0048823	nucleate erythrocyte development
2. P	GO:0048675	axon extension
2. P	GO:0001740	Barr body
2. P	GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway
2. P	GO:0045648	positive regulation of erythrocyte differentiation
2. P	GO:0001952	regulation of cell-matrix adhesion
2. P	GO:0003712	transcription coregulator activity
2. P	GO:0016514	SWI/SNF complex
2. P	GO:0045687	positive regulation of glial cell differentiation
2. P	GO:0035225	determination of genital disc primordium
2. P	GO:0032993	protein-DNA complex
2. P	GO:0045944	positive regulation of transcription by RNA polymerase II
2. P	GO:0005642	annulate lamellae
2. P	GO:0045893	positive regulation of transcription, DNA-templated
2. P	GO:0017056	structural constituent of nuclear pore
2. P	GO:0014028	notochord formation
2. P	GO:0030516	regulation of axon extension
2. P	GO:0007595	lactation
2. P	GO:0008013	beta-catenin binding
2. P	GO:0008584	male gonad development
2. P	GO:0060234	neuroblast delamination
2. P	GO:1990907	beta-catenin-TCF complex
2. P	GO:0045686	negative regulation of glial cell differentiation
2. P	GO:0051402	neuron apoptotic process
2. P	GO:0008134	transcription factor binding
2. P	GO:0042118	endothelial cell activation
2. P	GO:0007080	mitotic metaphase plate congression
2. P	GO:0007530	sex determination
2. P	GO:0031290	retinal ganglion cell axon guidance
2. P	GO:0030220	platelet formation
2. P	GO:0072560	type B pancreatic cell maturation
2. P	GO:1990526	Ste12p-Dig1p-Dig2p complex
2. P	GO:0001666	response to hypoxia
2. P	GO:0007399	nervous system development
2. P	GO:0048663	neuron fate commitment
2. P	GO:0071345	cellular response to cytokine stimulus
2. P	GO:0048368	lateral mesoderm development
2. P	GO:0071837	HMG box domain binding
2. P	GO:0003156	regulation of animal organ formation
2. P	GO:0003714	transcription corepressor activity
2. P	GO:0043069	negative regulation of programmed cell death
2. P	GO:0021569	rhombomere 3 development
2. P	GO:0051123	RNA polymerase II preinitiation complex assembly
2. P	GO:0061428	negative regulation of transcription from RNA polymerase II promoter in response to hypoxia
2. P	GO:0021612	facial nerve structural organization
2. P	GO:0070369	beta-catenin-TCF7L2 complex
2. P	GO:0009653	anatomical structure morphogenesis
2. P	GO:0010272	response to silver ion
2. P	GO:2001145	negative regulation of phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity
2. P	GO:0090575	RNA polymerase II transcription regulator complex
2. P	GO:0061382	Malpighian tubule tip cell differentiation
2. P	GO:0001067	transcription regulatory region nucleic acid binding
2. P	GO:1902806	regulation of cell cycle G1/S phase transition
2. P	GO:2000221	negative regulation of pseudohyphal growth
2. P	GO:0060136	embryonic process involved in female pregnancy
2. P	GO:0048596	embryonic camera-type eye morphogenesis
2. P	GO:0035094	response to nicotine
2. P	GO:0043066	negative regulation of apoptotic process
2. P	GO:0030099	myeloid cell differentiation
2. P	GO:0050795	regulation of behavior
2. P	GO:0005669	transcription factor TFIID complex
2. P	GO:0002244	hematopoietic progenitor cell differentiation
2. P	GO:0005737	cytoplasm
2. P	GO:0070285	pigment cell development
2. P	GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P	GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0071375	cellular response to peptide hormone stimulus
2. P	GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P	GO:0042051	compound eye photoreceptor development
2. P	GO:0060044	negative regulation of cardiac muscle cell proliferation
2. P	GO:0021571	rhombomere 5 development
2. P	GO:0007098	centrosome cycle
2. P	GO:0030851	granulocyte differentiation
2. P	GO:0001742	oenocyte differentiation
2. P	GO:0010104	regulation of ethylene-activated signaling pathway
2. P	GO:0035035	histone acetyltransferase binding
2. P	GO:0006405	RNA export from nucleus
2. P	GO:0060384	innervation
2. P	GO:0007400	neuroblast fate determination
2. P	GO:0046695	SLIK (SAGA-like) complex
2. P	GO:0030544	Hsp70 protein binding
2. P	GO:0021578	hindbrain maturation
2. P	GO:0001739	sex chromatin
2. P	GO:0071300	cellular response to retinoic acid
2. P	GO:0042491	inner ear auditory receptor cell differentiation
2. P	GO:0060218	hematopoietic stem cell differentiation
2. P	GO:0060972	left/right pattern formation
2. P	GO:0061525	hindgut development
2. P	GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
2. P	GO:0070564	positive regulation of vitamin D receptor signaling pathway
2. P	GO:0070888	E-box binding
2. P	GO:0030946	protein tyrosine phosphatase activity, metal-dependent
2. P	GO:0000932	P-body
2. P	GO:0010259	multicellular organism aging
2. P	GO:0035802	adrenal cortex formation
2. P	GO:0007569	cell aging
2. P	GO:0021904	dorsal/ventral neural tube patterning
2. P	GO:0043425	bHLH transcription factor binding
2. P	GO:0000432	positive regulation of transcription from RNA polymerase II promoter by glucose
2. P	GO:0045165	cell fate commitment
2. P	GO:0031047	gene silencing by RNA
2. P	GO:0060236	regulation of mitotic spindle organization
2. P	GO:0030015	CCR4-NOT core complex
2. P	GO:0001746	Bolwig's organ morphogenesis
2. P	GO:0035914	skeletal muscle cell differentiation
2. P	GO:0009048	dosage compensation by inactivation of X chromosome
2. P	GO:1902183	regulation of shoot apical meristem development
2. P	GO:0021953	central nervous system neuron differentiation
2. P	GO:0033962	P-body assembly
2. P	GO:0005704	polytene chromosome band
2. P	GO:0045666	positive regulation of neuron differentiation
2. P	GO:0030159	signaling receptor complex adaptor activity
2. P	GO:0046601	positive regulation of centriole replication
2. P	GO:0030237	female sex determination
2. P	GO:0090367	negative regulation of mRNA modification
2. P	GO:0070983	dendrite guidance
2. P	GO:0003713	transcription coactivator activity
2. P	GO:0060876	semicircular canal formation
2. P	GO:0003323	type B pancreatic cell development
2. P	GO:0070822	Sin3-type complex
2. P	GO:0009948	anterior/posterior axis specification
2. P	GO:0000187	obsolete activation of MAPK activity
2. P	GO:0001889	liver development
2. P	GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific
2. P	GO:0001093	TFIIB-class transcription factor binding
2. P	GO:0001957	intramembranous ossification
2. P	GO:0007402	ganglion mother cell fate determination
2. P	GO:0003700	DNA-binding transcription factor activity
2. P	GO:0060214	endocardium formation
2. P	GO:2000020	positive regulation of male gonad development
2. P	GO:0090069	regulation of ribosome biogenesis
2. P	GO:0010393	galacturonan metabolic process
2. P	GO:0042306	regulation of protein import into nucleus
2. P	GO:0021535	cell migration in hindbrain
2. P	GO:0035053	dorsal vessel heart proper cell fate commitment
2. P	GO:0021561	facial nerve development
2. P	GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
2. P	GO:0021999	neural plate anterior/posterior regionalization
2. P	GO:0030707	ovarian follicle cell development
2. P	GO:0033689	negative regulation of osteoblast proliferation
2. P	GO:0071400	cellular response to oleic acid
2. P	GO:1904781	positive regulation of protein localization to centrosome
2. P	GO:0065004	protein-DNA complex assembly
2. P	GO:0043407	negative regulation of MAP kinase activity
2. P	GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0046966	thyroid hormone receptor binding
2. P	GO:0007384	specification of segmental identity, thorax
2. P	GO:0046020	negative regulation of transcription from RNA polymerase II promoter by pheromones
2. P	GO:0060349	bone morphogenesis
2. P	GO:0030154	cell differentiation
2. P	GO:0006357	regulation of transcription by RNA polymerase II
2. P	GO:0031523	Myb complex
2. P	GO:0080001	mucilage extrusion from seed coat
2. P	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
2. P	GO:1990837	sequence-specific double-stranded DNA binding
2. P	GO:0060375	regulation of mast cell differentiation
2. P	GO:0007438	oenocyte development
2. P	GO:0055088	lipid homeostasis
2. P	GO:0048538	thymus development
2. P	GO:0021562	vestibulocochlear nerve development
2. P	GO:0035855	megakaryocyte development
2. P	GO:0007636	chemosensory jump behavior
2. P	GO:0048646	anatomical structure formation involved in morphogenesis
2. P	GO:0044342	type B pancreatic cell proliferation
2. P	GO:0001892	embryonic placenta development
2. P	GO:0007307	eggshell chorion gene amplification
2. P	GO:0031018	endocrine pancreas development
2. P	GO:0030968	endoplasmic reticulum unfolded protein response
2. P	GO:0030513	positive regulation of BMP signaling pathway
2. P	GO:1903215	negative regulation of protein targeting to mitochondrion
2. P	GO:0010628	positive regulation of gene expression
2. P	GO:0042472	inner ear morphogenesis
2. P	GO:0050890	cognition
2. P	GO:0032991	protein-containing complex
2. P	GO:0046872	metal ion binding
2. P	GO:0042675	compound eye cone cell differentiation
2. P	GO:0090102	cochlea development
2. P	GO:0000430	regulation of transcription from RNA polymerase II promoter by glucose
2. P	GO:0042474	middle ear morphogenesis
2. P	GO:0030221	basophil differentiation
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0021527	spinal cord association neuron differentiation
2. P	GO:0021570	rhombomere 4 development
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0032024	positive regulation of insulin secretion
2. P	GO:0042169	SH2 domain binding
2. P	GO:0030900	forebrain development
2. P	GO:0046580	negative regulation of Ras protein signal transduction
2. P	GO:0001829	trophectodermal cell differentiation
2. P	GO:0046982	protein heterodimerization activity
2. P	GO:0005654	nucleoplasm
3. B	GO:0043968	histone H2A acetylation
3. B	GO:0000812	Swr1 complex
3. B	GO:0043967	histone H4 acetylation
3. B	GO:1990405	protein antigen binding
3. B	GO:0016787	hydrolase activity
3. B	GO:0035267	NuA4 histone acetyltransferase complex
3. B	GO:0004386	helicase activity
3. B	GO:0070615
3. B	GO:0016607	nuclear speck

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q6ZTU2	Putative EP400-like protein	0	8.54e-151	0.0
2. P	Q8CHH5	BRD4-interacting chromatin-remodeling complex-associated protein-like	2.94e-01	4.32e-05	NA
2. P	F4K4L7	Transcription initiation factor TFIID subunit 4b	3.74e-01	1.06e-04	NA
2. P	P12980	Protein lyl-1	1.52e-01	1.45e-02	NA
2. P	Q60554	Homeobox protein Nkx-6.1	6.62e-02	1.92e-03	NA
2. P	Q1KKX5	Homeobox protein Hox-B1a	3.58e-02	1.05e-02	NA
2. P	Q5RC05	Zinc finger protein 438	2.47e-01	2.90e-02	NA
2. P	Q0IHV2	Protein lin-54 homolog	5.45e-01	2.59e-04	NA
2. P	P54366	Homeobox protein goosecoid	1.32e-01	5.88e-04	NA
2. P	Q15319	POU domain, class 4, transcription factor 3	1.77e-01	3.73e-02	NA
2. P	O35740	Cbp/p300-interacting transactivator 2	3.73e-01	7.89e-07	NA
2. P	P15884	Transcription factor 4	3.24e-01	1.02e-02	NA
2. P	Q555L9	Transcription initiation factor TFIID subunit 12	1.59e-01	2.31e-02	NA
2. P	P17542	T-cell acute lymphocytic leukemia protein 1	5.58e-02	7.69e-06	NA
2. P	Q641Z1	Protein lin-54 homolog	1.66e-01	1.49e-05	NA
2. P	Q6ZPK0	PHD finger protein 21A	1.15e-01	4.63e-05	NA
2. P	P33417	Intrastrand cross-link recognition protein	1.47e-01	1.69e-02	NA
2. P	P34428	Glutamine/asparagine-rich protein mdt-30	3.30e-01	9.48e-06	NA
2. P	P15881	Transcription factor 4	7.31e-02	1.07e-03	NA
2. P	Q5F3U0	Histone deacetylase complex subunit SAP130	4.51e-01	1.22e-02	NA
2. P	Q8QHL5	Polyhomeotic-like protein 2	3.61e-01	3.66e-03	NA
2. P	Q6ZSG1	E3 ubiquitin-protein ligase RNF165	1.67e-01	2.42e-03	NA
2. P	C9J069	Apical junction component 1 homolog	3.28e-01	1.08e-02	NA
2. P	Q6DDH6	Histone deacetylase complex subunit SAP130-A	3.98e-01	7.59e-09	NA
2. P	Q62655	Transcription factor 4	1.45e-01	4.25e-03	NA
2. P	Q8GXT3	Transcription factor bHLH123	1.61e-01	3.88e-02	NA
2. P	Q99081	Transcription factor 12	2.11e-01	3.45e-03	NA
2. P	Q6AXT7	RNA-binding protein 42	2.34e-01	4.37e-02	NA
2. P	G5E8Z2	Transcription initiation factor TFIID subunit 4B	5.20e-01	1.50e-02	NA
2. P	Q6NS15	Mediator of RNA polymerase II transcription subunit 15	4.43e-01	3.28e-04	NA
2. P	Q29DV9	Mediator of RNA polymerase II transcription subunit 30	2.20e-01	3.64e-08	NA
2. P	Q5R9C3	Vasculin-like protein 1	7.75e-02	1.26e-02	NA
2. P	O08656	Homeobox protein Hox-A1	5.96e-02	1.19e-02	NA
2. P	P53544	Homeobox protein goosecoid	2.35e-01	4.42e-04	NA
2. P	O95429	BAG family molecular chaperone regulator 4	2.95e-01	1.40e-04	NA
2. P	A2VDB3	RNA-binding protein 42	1.74e-01	1.53e-02	NA
2. P	Q8CDD9	Ligand-dependent nuclear receptor-interacting factor 1	2.10e-01	2.76e-03	NA
2. P	P18576	Nuclear transcription factor Y subunit alpha	8.18e-01	1.62e-07	NA
2. P	Q52JK6	Probable NOT transcription complex subunit VIP2 (Fragment)	7.22e-01	4.68e-05	NA
2. P	Q02100	CRE-binding bZIP protein SKO1	1.70e-01	1.14e-02	NA
2. P	P70512	Hepatocyte nuclear factor 6	8.51e-02	1.66e-04	NA
2. P	P50219	Motor neuron and pancreas homeobox protein 1	1.64e-01	5.56e-03	NA
2. P	Q9NYJ8	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2	1.29e-01	6.91e-05	NA
2. P	Q172Y1	Mediator of RNA polymerase II transcription subunit 30	8.90e-02	4.96e-04	NA
2. P	Q10571	Transcriptional activator MN1	5.70e-01	1.03e-04	NA
2. P	P13468	DNA-binding protein K10	5.79e-02	2.45e-04	NA
2. P	Q0VCT9	Cbp/p300-interacting transactivator 2	1.82e-01	1.24e-05	NA
2. P	Q924H2	Mediator of RNA polymerase II transcription subunit 15	4.31e-01	7.40e-04	NA
2. P	Q66KL9	RNA-binding protein 42	1.31e-01	9.92e-03	NA
2. P	Q02591	Homeobox protein goosecoid	3.82e-01	4.78e-05	NA
2. P	Q571G4	Protein lin-54 homolog	1.31e-01	2.49e-05	NA
2. P	Q571K4	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3	6.16e-02	1.07e-04	NA
2. P	Q8RWA2	Mediator of RNA polymerase II transcription subunit 9	3.13e-01	2.68e-04	NA
2. P	Q17PR1	Zinc finger protein jing homolog	6.67e-01	1.33e-02	NA
2. P	Q5QLR5	Probable E3 ubiquitin-protein ligase ZFP1	2.02e-01	2.14e-03	NA
2. P	Q08CM4	Protein lin-54 homolog	3.67e-01	3.55e-08	NA
2. P	P56915	Homeobox protein goosecoid	3.21e-01	6.31e-06	NA
2. P	P47825	Transcription initiation factor TFIID subunit 4	4.90e-01	1.58e-04	NA
2. P	P53546	Homeobox protein goosecoid isoform B	2.44e-01	3.46e-04	NA
2. P	Q8CI61	BAG family molecular chaperone regulator 4	9.56e-02	3.52e-03	NA
2. P	P29555	Homeobox protein abdominal-A	7.40e-02	4.71e-02	NA
2. P	Q0P5J0	Transcriptional regulator QRICH1	1.65e-01	5.91e-05	NA
2. P	Q9UBC0	Hepatocyte nuclear factor 6	1.73e-01	1.68e-04	NA
2. P	P17955	Nuclear pore glycoprotein p62	8.87e-02	4.00e-03	NA
2. P	Q5E9S2	Nuclear transcription factor Y subunit alpha	4.47e-01	3.33e-08	NA
2. P	P24350	Inhibitory POU protein	2.31e-01	1.22e-05	NA
2. P	P30985	Transcription factor 12 (Fragment)	6.94e-02	6.33e-04	NA
2. P	Q15853	Upstream stimulatory factor 2	5.21e-02	4.34e-03	NA
2. P	O93507	T-cell acute lymphocytic leukemia protein 1 homolog	4.88e-02	3.53e-02	NA
2. P	Q9QZW9	Motor neuron and pancreas homeobox protein 1	1.17e-01	2.30e-03	NA
2. P	Q940A7	Transcription initiation factor TFIID subunit 12b	1.26e-01	8.00e-09	NA
2. P	P23708	Nuclear transcription factor Y subunit alpha	5.25e-01	3.13e-07	NA
2. P	P78364	Polyhomeotic-like protein 1	3.27e-01	2.30e-03	NA
2. P	P23511	Nuclear transcription factor Y subunit alpha	7.64e-01	5.50e-08	NA
2. P	A2T7P4	Homeobox protein goosecoid	1.71e-01	1.39e-05	NA
2. P	Q24645	Homeotic protein antennapedia	2.56e-01	2.12e-02	NA
2. P	Q7RTU5	Achaete-scute homolog 5	1.88e-01	2.54e-02	NA
2. P	P78424	POU domain, class 6, transcription factor 2	4.05e-01	8.91e-05	NA
2. P	E9QAU8	E3 ubiquitin-protein ligase RNF165	2.85e-01	2.99e-03	NA
2. P	Q9FUY2	Transcriptional corepressor LEUNIG	4.15e-01	4.33e-02	NA
2. P	P49639	Homeobox protein Hox-A1	2.12e-01	2.45e-02	NA
2. P	P78426	Homeobox protein Nkx-6.1	9.74e-02	2.50e-03	NA
2. P	Q99K90	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2	2.13e-01	1.84e-03	NA
2. P	Q08CG8	RING finger protein 44	5.31e-02	1.06e-02	NA
2. P	A1YFI3	Homeobox protein goosecoid	2.83e-01	1.10e-05	NA
2. P	P11420	Protein daughterless	1.30e-01	5.09e-03	NA
2. P	Q8BJI4	POU domain, class 6, transcription factor 2	2.84e-01	4.47e-05	NA
2. P	O35762	Homeobox protein Nkx-6.1	1.51e-01	8.32e-03	NA
2. P	Q9LJE5	YTH domain-containing protein ECT2	1.55e-01	8.07e-05	NA
2. P	A1Z9E2	Protein lin-54 homolog	3.25e-01	4.71e-02	NA
2. P	Q05201	Developmental protein eyes absent	2.86e-01	4.51e-04	NA
2. P	Q99MA9	Homeobox protein Nkx-6.1	1.07e-01	7.62e-03	NA
2. P	P53545	Homeobox protein goosecoid	2.50e-01	6.83e-05	NA
2. P	Q9XUS2	Mediator of RNA polymerase II transcription subunit 29	4.45e-02	1.06e-04	NA
2. P	Q5M7C3	Histone deacetylase complex subunit SAP130-B	2.15e-01	2.19e-05	NA
2. P	D3YWE6	Transcriptional activator MN1	4.31e-01	1.52e-04	NA
2. P	P31367	POU domain, class 6, transcription factor 1	2.43e-01	4.29e-03	NA
2. P	A2T733	Homeobox protein goosecoid	4.81e-01	9.94e-06	NA
2. P	Q6MZP7	Protein lin-54 homolog	2.72e-01	1.83e-05	NA
2. P	Q21446	Protein lin-14	3.87e-01	3.46e-04	NA
2. P	P24899	T-cell acute lymphocytic leukemia protein 1 homolog	4.01e-02	1.75e-02	NA
2. P	A1YEY5	Homeobox protein goosecoid	3.98e-01	9.94e-06	NA
2. P	P40535	ATF/CREB activator 2	4.93e-02	1.50e-03	NA
2. P	Q7ZVN7	Mediator of RNA polymerase II transcription subunit 15	5.55e-01	2.73e-03	NA
2. P	P22091	T-cell acute lymphocytic leukemia protein 1 homolog	8.09e-02	4.84e-05	NA
2. P	P29454	Homeobox protein goosecoid isoform A	4.41e-01	1.41e-04	NA
2. P	Q61286	Transcription factor 12	1.33e-01	3.38e-06	NA
2. P	Q5U303	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2	2.11e-01	1.77e-03	NA
2. P	Q9GNL2	Protein lin-14	2.00e-01	1.77e-02	NA
2. P	Q9SR71	Transcription initiation factor TFIID subunit 12	8.41e-02	1.79e-12	NA
2. P	O42366	Homeobox protein Hox-B1a	1.13e-01	1.89e-02	NA
2. P	Q03063	Down-regulator of invasive growth 1	8.75e-02	3.04e-02	NA
2. P	O08755	Hepatocyte nuclear factor 6	1.05e-01	1.43e-04	NA
2. P	Q04787	Brain-specific homeobox protein	5.76e-02	9.71e-04	NA
2. P	Q96BD5	PHD finger protein 21A	1.12e-01	6.32e-03	NA
2. P	Q63955	POU domain, class 4, transcription factor 3	3.07e-01	4.06e-02	NA
2. P	A1YG57	Homeobox protein goosecoid	3.35e-01	9.94e-06	NA
2. P	Q9Y149	Mediator of RNA polymerase II transcription subunit 15	1.95e-01	3.45e-03	NA
2. P	Q5T3J3	Ligand-dependent nuclear receptor-interacting factor 1	2.62e-01	5.53e-05	NA
2. P	Q99967	Cbp/p300-interacting transactivator 2	2.73e-01	1.27e-05	NA
2. P	Q3UA37	Transcriptional regulator QRICH1	3.10e-01	1.11e-04	NA
2. P	P09022	Homeobox protein Hox-A1	9.50e-02	3.01e-02	NA
2. P	B2C6R6	Transcription initiation factor TFIID subunit 12b	1.93e-01	1.14e-08	NA
2. P	Q7ZXH3	Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 homolog	1.54e-01	3.10e-02	NA
2. P	Q8C5L3	CCR4-NOT transcription complex subunit 2	2.57e-01	5.23e-04	NA
2. P	Q96RN5	Mediator of RNA polymerase II transcription subunit 15	1.84e-01	1.49e-04	NA
2. P	Q0WPK4	Protein PAT1 homolog	7.98e-02	2.52e-03	NA
2. P	Q60722	Transcription factor 4	1.12e-01	1.67e-02	NA
2. P	Q64028	Polyhomeotic-like protein 1	3.03e-01	6.26e-03	NA
2. P	Q63850	Nuclear pore glycoprotein p62	9.63e-02	1.80e-03	NA
2. P	Q60YF6	Mediator of RNA polymerase II transcription subunit 29	1.12e-01	1.06e-05	NA
2. P	Q9IA19	Homeobox protein Hox-A1	1.90e-01	9.18e-03	NA
2. P	Q17BA4	Mediator of RNA polymerase II transcription subunit 15	3.38e-01	2.62e-03	NA
2. P	A1YFU7	Cbp/p300-interacting transactivator 2	NA	4.71e-07	NA
2. P	Q06615	Homeobox protein notochord	5.86e-01	3.62e-03	NA
2. P	Q64705	Upstream stimulatory factor 2	2.25e-01	1.91e-02	NA
2. P	Q499M7	Ligand-dependent nuclear receptor-interacting factor 1	3.22e-01	1.24e-02	NA
2. P	Q9HC44	Vasculin-like protein 1	1.94e-01	1.26e-02	NA
2. P	Q63665	Upstream stimulatory factor 2	1.03e-01	1.91e-02	NA
2. P	Q2TAL8	Transcriptional regulator QRICH1	3.50e-01	1.65e-04	NA
2. P	P51514	Transcription factor 12	1.28e-01	2.97e-06	NA
2. P	Q94547	Regulator of gene activity	2.84e-01	3.05e-03	NA
2. P	Q9FPW4	Probable NOT transcription complex subunit VIP2	2.71e-01	3.08e-03	NA
2. P	Q9W0P3	Mediator of RNA polymerase II transcription subunit 30	2.29e-01	2.40e-05	NA
2. P	D3ZTL1	POU domain, class 4, transcription factor 3	6.39e-01	4.58e-02	NA
2. P	A2RRV3	Protein PAT1 homolog 1	1.03e-01	4.71e-02	NA
2. P	Q6AI39	BRD4-interacting chromatin-remodeling complex-associated protein-like	4.72e-01	3.99e-06	NA
2. P	Q8BIH0	Histone deacetylase complex subunit SAP130	4.22e-01	1.92e-03	NA
2. P	P37198	Nuclear pore glycoprotein p62	1.57e-01	2.21e-03	NA
2. P	Q92750	Transcription initiation factor TFIID subunit 4B	3.15e-01	1.02e-02	NA
2. P	Q8N5C8	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3	6.40e-02	5.29e-03	NA
2. P	Q91770	Homeobox protein not2	2.67e-01	4.14e-02	NA
2. P	Q5RBN8	Protein lin-54 homolog	4.49e-01	3.25e-07	NA
2. P	Q9NZN8	CCR4-NOT transcription complex subunit 2	1.87e-01	5.23e-04	NA
3. B	Q96L91	E1A-binding protein p400	NA	NA	0.0
3. B	Q8CHI8	E1A-binding protein p400	NA	NA	0.0